F481600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 805 | 313 | 804 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300024225|Ga0224572_1000076|Ga0224572_10000762 |
| Length | 233 |
| Sequence | MQPTAQAMGKTHDNTLAPAGRKVIRETQLSSSSYNVRSMIAHLRGKLLAKHPNQAIVETAGVGYDVTITIPTFSDLPNPGNEVALHIHTHVREDQIALYGFLRPAEKQLFEKLITVSGIGPKLAITILSGMPADEMVGAIRHNDIARLTRIPGIGKKTAERMVLELRDKLPPAGAETPVAPTMTAMEEDVLSALVNLGYQRPAAERALAQAAKNGKEESFEALFRNTLAALAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 118 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 119 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 301 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 1.49 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.49 |
| Nodule | 0 |
| Rhizoplane | 4.47 |
| Rhizosphere | 93.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000342 | 3300000546 | Bacteria | 8182 |
| 2 | JGI24752J21851_1000910 | 3300001976 | Bacteria | 4026 |
| 3 | JGI24034J26672_10030077 | 3300002239 | Unclassified | 881 |
| 4 | Ga0065712_10155690 | 3300005290 | Bacteria | 1330 |
| 5 | Ga0065715_10184495 | 3300005293 | Bacteria | 1454 |
| 6 | Ga0065715_10240193 | 3300005293 | Bacteria | 1202 |
| 7 | Ga0070658_10463608 | 3300005327 | Bacteria | 1092 |
| 8 | Ga0070658_10539358 | 3300005327 | Bacteria | 1009 |
| 9 | Ga0070676_10004984 | 3300005328 | Bacteria | 7030 |
| 10 | Ga0070676_10008222 | 3300005328 | Bacteria | 5617 |
| 11 | Ga0070683_100000704 | 3300005329 | Bacteria | 24281 |
| 12 | Ga0070683_100017534 | 3300005329 | Bacteria | 6329 |
| 13 | Ga0070683_100018333 | 3300005329 | Bacteria | 6197 |
| 14 | Ga0070690_100024489 | 3300005330 | Unclassified | 3710 |
| 15 | Ga0070690_100120734 | 3300005330 | Bacteria | 1759 |
| 16 | Ga0070677_10053135 | 3300005333 | Unclassified | 1646 |
| 17 | Ga0068869_100002537 | 3300005334 | Bacteria | 11022 |
| 18 | Ga0070666_10100199 | 3300005335 | Bacteria | 1995 |
| 19 | Ga0070666_10180028 | 3300005335 | Unclassified | 1482 |
| 20 | Ga0070680_100005837 | 3300005336 | Bacteria | 9342 |
| 21 | Ga0070680_100164109 | 3300005336 | Bacteria | 1867 |
| 22 | Ga0070680_100282941 | 3300005336 | Bacteria | 1405 |
| 23 | Ga0070680_100497083 | 3300005336 | Bacteria | 1043 |
| 24 | Ga0068868_100002614 | 3300005338 | Bacteria | 12491 |
| 25 | Ga0068868_100020227 | 3300005338 | Bacteria | 4997 |
| 26 | Ga0068868_100072644 | 3300005338 | Unclassified | 2745 |
| 27 | Ga0068868_100129068 | 3300005338 | Unclassified | 2067 |
| 28 | Ga0068868_100187907 | 3300005338 | Bacteria | 1717 |
| 29 | Ga0068868_100430568 | 3300005338 | Bacteria | 1144 |
| 30 | Ga0070660_100002180 | 3300005339 | Bacteria | 13501 |
| 31 | Ga0070660_100014667 | 3300005339 | Bacteria | 5653 |
| 32 | Ga0070660_100112287 | 3300005339 | Bacteria | 2169 |
| 33 | Ga0070660_100355809 | 3300005339 | Bacteria | 1206 |
| 34 | Ga0070689_100013990 | 3300005340 | Bacteria | 5822 |
| 35 | Ga0070689_100268710 | 3300005340 | Bacteria | 1411 |
| 36 | Ga0070687_100005205 | 3300005343 | Bacteria | 5250 |
| 37 | Ga0070661_100045393 | 3300005344 | Bacteria | 3212 |
| 38 | Ga0070661_100067305 | 3300005344 | Bacteria | 2632 |
| 39 | Ga0070661_100170097 | 3300005344 | Bacteria | 1654 |
| 40 | Ga0070661_100197107 | 3300005344 | Bacteria | 1537 |
| 41 | Ga0070668_100007418 | 3300005347 | Bacteria | 8138 |
| 42 | Ga0070668_100102469 | 3300005347 | Bacteria | 2270 |
| 43 | Ga0070668_100486100 | 3300005347 | Bacteria | 1067 |
| 44 | Ga0070669_100064364 | 3300005353 | Unclassified | 2700 |
| 45 | Ga0070669_100997533 | 3300005353 | Bacteria | 718 |
| 46 | Ga0070675_100043128 | 3300005354 | Unclassified | 3685 |
| 47 | Ga0070673_100026626 | 3300005364 | Bacteria | 4274 |
| 48 | Ga0070673_100137611 | 3300005364 | Bacteria | 2057 |
| 49 | Ga0070688_100008741 | 3300005365 | Bacteria | 5507 |
| 50 | Ga0070659_100034279 | 3300005366 | Bacteria | 3948 |
| 51 | Ga0070659_100084160 | 3300005366 | Bacteria | 2543 |
| 52 | Ga0070659_100116782 | 3300005366 | Unclassified | 2157 |
| 53 | Ga0070659_100181936 | 3300005366 | Bacteria | 1725 |
| 54 | Ga0070667_100069184 | 3300005367 | Unclassified | 3004 |
| 55 | Ga0070667_100120440 | 3300005367 | Bacteria | 2282 |
| 56 | Ga0070667_100747966 | 3300005367 | Bacteria | 906 |
| 57 | Ga0070709_10045030 | 3300005434 | Viruses | 2736 |
| 58 | Ga0070709_10359932 | 3300005434 | Bacteria | 1077 |
| 59 | Ga0070709_10782961 | 3300005434 | Bacteria | 747 |
| 60 | Ga0070714_100000047 | 3300005435 | Bacteria | 112707 |
| 61 | Ga0070714_100044948 | 3300005435 | Bacteria | 3741 |
| 62 | Ga0070714_100059829 | 3300005435 | Unclassified | 3267 |
| 63 | Ga0070714_100256355 | 3300005435 | Bacteria | 1619 |
| 64 | Ga0070714_100264948 | 3300005435 | Bacteria | 1592 |
| 65 | Ga0070714_100297966 | 3300005435 | Bacteria | 1502 |
| 66 | Ga0070714_100420624 | 3300005435 | Bacteria | 1266 |
| 67 | Ga0070714_100588692 | 3300005435 | Unclassified | 1067 |
| 68 | Ga0070714_100819582 | 3300005435 | Bacteria | 902 |
| 69 | Ga0070714_100937253 | 3300005435 | Bacteria | 841 |
| 70 | Ga0070713_100005398 | 3300005436 | Bacteria | 8732 |
| 71 | Ga0070713_100017385 | 3300005436 | Bacteria | 5437 |
| 72 | Ga0070713_100021670 | 3300005436 | Bacteria | 4949 |
| 73 | Ga0070713_100093786 | 3300005436 | Bacteria | 2587 |
| 74 | Ga0070713_100405881 | 3300005436 | Bacteria | 1273 |
| 75 | Ga0070713_101018833 | 3300005436 | Bacteria | 799 |
| 76 | Ga0070710_10010881 | 3300005437 | Unclassified | 4480 |
| 77 | Ga0070710_10418170 | 3300005437 | Unclassified | 902 |
| 78 | Ga0070711_100003811 | 3300005439 | Bacteria | 8854 |
| 79 | Ga0070711_100055759 | 3300005439 | Unclassified | 2731 |
| 80 | Ga0070711_100057805 | 3300005439 | Bacteria | 2687 |
| 81 | Ga0070711_100496406 | 3300005439 | Unclassified | 1006 |
| 82 | Ga0070705_100263388 | 3300005440 | Bacteria | 1217 |
| 83 | Ga0070705_100277750 | 3300005440 | Bacteria | 1189 |
| 84 | Ga0070700_100092015 | 3300005441 | Bacteria | 1981 |
| 85 | Ga0070708_100001160 | 3300005445 | Bacteria | 20288 |
| 86 | Ga0070708_100002478 | 3300005445 | Bacteria | 14259 |
| 87 | Ga0070708_100004782 | 3300005445 | Bacteria | 10675 |
| 88 | Ga0070708_100027906 | 3300005445 | Bacteria | 4850 |
| 89 | Ga0070708_100043931 | 3300005445 | Bacteria | 3928 |
| 90 | Ga0070708_100081593 | 3300005445 | Plasmid | 2928 |
| 91 | Ga0070663_100006657 | 3300005455 | Bacteria | 6967 |
| 92 | Ga0070663_100062577 | 3300005455 | Unclassified | 2683 |
| 93 | Ga0070663_100102325 | 3300005455 | Bacteria | 2139 |
| 94 | Ga0070662_100001840 | 3300005457 | Bacteria | 12997 |
| 95 | Ga0070662_100090027 | 3300005457 | Bacteria | 2302 |
| 96 | Ga0070681_10014865 | 3300005458 | Bacteria | 7739 |
| 97 | Ga0070681_10020326 | 3300005458 | Bacteria | 6654 |
| 98 | Ga0070681_10022144 | 3300005458 | Bacteria | 6378 |
| 99 | Ga0070681_10045959 | 3300005458 | Bacteria | 4366 |
| 100 | Ga0068867_100003948 | 3300005459 | Bacteria | 10433 |
| 101 | Ga0068867_100027341 | 3300005459 | Bacteria | 4098 |
| 102 | Ga0068867_100345427 | 3300005459 | Bacteria | 1240 |
| 103 | Ga0070685_10069247 | 3300005466 | Unclassified | 2086 |
| 104 | Ga0070706_100000430 | 3300005467 | Bacteria | 50312 |
| 105 | Ga0070706_100000710 | 3300005467 | Bacteria | 37432 |
| 106 | Ga0070706_100020174 | 3300005467 | Bacteria | 6141 |
| 107 | Ga0070706_100025488 | 3300005467 | Bacteria | 5443 |
| 108 | Ga0070706_100046337 | 3300005467 | Bacteria | 4014 |
| 109 | Ga0070707_100000607 | 3300005468 | Bacteria | 36047 |
| 110 | Ga0070707_100148036 | 3300005468 | Bacteria | 2285 |
| 111 | Ga0070707_100171160 | 3300005468 | Bacteria | 2116 |
| 112 | Ga0070707_100207310 | 3300005468 | Bacteria | 1911 |
| 113 | Ga0070707_100274541 | 3300005468 | Bacteria | 1639 |
| 114 | Ga0070707_100462659 | 3300005468 | Bacteria | 1229 |
| 115 | Ga0070707_100801266 | 3300005468 | Bacteria | 906 |
| 116 | Ga0070698_100000091 | 3300005471 | Bacteria | 71604 |
| 117 | Ga0070698_100155391 | 3300005471 | Unclassified | 2233 |
| 118 | Ga0070699_100013395 | 3300005518 | Bacteria | 7066 |
| 119 | Ga0070699_100087304 | 3300005518 | Bacteria | 2723 |
| 120 | Ga0070699_100292263 | 3300005518 | Bacteria | 1461 |
| 121 | Ga0070679_100042315 | 3300005530 | Unclassified | 4536 |
| 122 | Ga0070679_100107507 | 3300005530 | Bacteria | 2775 |
| 123 | Ga0070679_100341082 | 3300005530 | Bacteria | 1446 |
| 124 | Ga0070679_100473447 | 3300005530 | Bacteria | 1197 |
| 125 | Ga0070679_100478762 | 3300005530 | Bacteria | 1189 |
| 126 | Ga0070679_100517902 | 3300005530 | Unclassified | 1137 |
| 127 | Ga0070679_100756834 | 3300005530 | Unclassified | 914 |
| 128 | Ga0070684_100003207 | 3300005535 | Bacteria | 12234 |
| 129 | Ga0070684_100003777 | 3300005535 | Bacteria | 11430 |
| 130 | Ga0070684_100383253 | 3300005535 | Unclassified | 1295 |
| 131 | Ga0070684_100617637 | 3300005535 | Bacteria | 1008 |
| 132 | Ga0070697_100001219 | 3300005536 | Bacteria | 19410 |
| 133 | Ga0070697_100001461 | 3300005536 | Bacteria | 18005 |
| 134 | Ga0070697_100020940 | 3300005536 | Bacteria | 5176 |
| 135 | Ga0070697_100064481 | 3300005536 | Bacteria | 2992 |
| 136 | Ga0070697_100179896 | 3300005536 | Unclassified | 1792 |
| 137 | Ga0070697_100391018 | 3300005536 | Bacteria | 1206 |
| 138 | Ga0070697_100787639 | 3300005536 | Bacteria | 841 |
| 139 | Ga0068853_100274324 | 3300005539 | Bacteria | 1553 |
| 140 | Ga0068853_100346819 | 3300005539 | Bacteria | 1380 |
| 141 | Ga0068853_100359177 | 3300005539 | Bacteria | 1356 |
| 142 | Ga0070672_100060922 | 3300005543 | Unclassified | 2973 |
| 143 | Ga0070672_100158642 | 3300005543 | Bacteria | 1875 |
| 144 | Ga0070686_100008501 | 3300005544 | Bacteria | 5749 |
| 145 | Ga0070686_100015652 | 3300005544 | Bacteria | 4400 |
| 146 | Ga0070693_100157563 | 3300005547 | Bacteria | 1443 |
| 147 | Ga0070693_100160501 | 3300005547 | Bacteria | 1431 |
| 148 | Ga0070693_100474877 | 3300005547 | Bacteria | 882 |
| 149 | Ga0070665_100004447 | 3300005548 | Bacteria | 14722 |
| 150 | Ga0070665_100248502 | 3300005548 | Bacteria | 1779 |
| 151 | Ga0070665_100891979 | 3300005548 | Bacteria | 902 |
| 152 | Ga0068855_100009456 | 3300005563 | Bacteria | 11778 |
| 153 | Ga0068855_100031927 | 3300005563 | Bacteria | 6286 |
| 154 | Ga0068855_100147526 | 3300005563 | Bacteria | 2677 |
| 155 | Ga0068855_100153482 | 3300005563 | Bacteria | 2617 |
| 156 | Ga0068855_100203147 | 3300005563 | Bacteria | 2230 |
| 157 | Ga0068855_100333063 | 3300005563 | Bacteria | 1675 |
| 158 | Ga0070664_100002061 | 3300005564 | Bacteria | 16056 |
| 159 | Ga0070664_100007016 | 3300005564 | Bacteria | 9091 |
| 160 | Ga0068857_100001890 | 3300005577 | Bacteria | 16879 |
| 161 | Ga0068857_100139948 | 3300005577 | Bacteria | 2187 |
| 162 | Ga0068857_100167457 | 3300005577 | Bacteria | 1996 |
| 163 | Ga0068857_100179572 | 3300005577 | Bacteria | 1926 |
| 164 | Ga0068854_100000866 | 3300005578 | Bacteria | 18145 |
| 165 | Ga0068854_100005607 | 3300005578 | Bacteria | 7933 |
| 166 | Ga0068854_100015075 | 3300005578 | Bacteria | 5110 |
| 167 | Ga0068854_100064803 | 3300005578 | Bacteria | 2655 |
| 168 | Ga0068854_100308735 | 3300005578 | Bacteria | 1282 |
| 169 | Ga0068856_100021283 | 3300005614 | Bacteria | 6300 |
| 170 | Ga0068856_100071560 | 3300005614 | Bacteria | 3433 |
| 171 | Ga0068856_100111870 | 3300005614 | Unclassified | 2728 |
| 172 | Ga0068856_100166773 | 3300005614 | Unclassified | 2213 |
| 173 | Ga0068852_100038418 | 3300005616 | Unclassified | 4023 |
| 174 | Ga0068852_100127510 | 3300005616 | Bacteria | 2339 |
| 175 | Ga0068852_100164463 | 3300005616 | Bacteria | 2075 |
| 176 | Ga0068859_100000418 | 3300005617 | Bacteria | 42477 |
| 177 | Ga0068859_100016871 | 3300005617 | Bacteria | 7330 |
| 178 | Ga0068859_100022181 | 3300005617 | Bacteria | 6366 |
| 179 | Ga0068859_100071137 | 3300005617 | Unclassified | 3514 |
| 180 | Ga0068859_100126142 | 3300005617 | Bacteria | 2629 |
| 181 | Ga0068864_100006714 | 3300005618 | Bacteria | 9427 |
| 182 | Ga0068864_100130421 | 3300005618 | Bacteria | 2257 |
| 183 | Ga0068866_10027896 | 3300005718 | Bacteria | 2685 |
| 184 | Ga0068866_10037368 | 3300005718 | Bacteria | 2384 |
| 185 | Ga0068866_10072406 | 3300005718 | Bacteria | 1826 |
| 186 | Ga0068866_10201822 | 3300005718 | Bacteria | 1189 |
| 187 | Ga0068861_100083767 | 3300005719 | Bacteria | 2502 |
| 188 | Ga0068861_100306472 | 3300005719 | Bacteria | 1378 |
| 189 | Ga0068861_100658232 | 3300005719 | Bacteria | 968 |
| 190 | Ga0068851_10002042 | 3300005834 | Bacteria | 8905 |
| 191 | Ga0068851_10033133 | 3300005834 | Bacteria | 2574 |
| 192 | Ga0068870_10109236 | 3300005840 | Bacteria | 1576 |
| 193 | Ga0068870_10174904 | 3300005840 | Bacteria | 1284 |
| 194 | Ga0068863_100026510 | 3300005841 | Bacteria | 5528 |
| 195 | Ga0068863_100099134 | 3300005841 | Bacteria | 2768 |
| 196 | Ga0068863_100874231 | 3300005841 | Bacteria | 898 |
| 197 | Ga0068858_100001025 | 3300005842 | Bacteria | 28816 |
| 198 | Ga0068858_100446202 | 3300005842 | Bacteria | 1246 |
| 199 | Ga0068860_100019413 | 3300005843 | Bacteria | 6593 |
| 200 | Ga0068860_100054827 | 3300005843 | Bacteria | 3789 |
| 201 | Ga0068860_100219507 | 3300005843 | Bacteria | 1846 |
| 202 | Ga0068860_100332493 | 3300005843 | Bacteria | 1492 |
| 203 | Ga0068862_100008956 | 3300005844 | Bacteria | 8285 |
| 204 | Ga0081540_1140573 | 3300005983 | Unclassified | 970 |
| 205 | Ga0070717_10000592 | 3300006028 | Bacteria | 23200 |
| 206 | Ga0070717_10002404 | 3300006028 | Bacteria | 13207 |
| 207 | Ga0070717_10005064 | 3300006028 | Bacteria | 9608 |
| 208 | Ga0070717_10010992 | 3300006028 | Bacteria | 6856 |
| 209 | Ga0070717_10070371 | 3300006028 | Bacteria | 2915 |
| 210 | Ga0070717_10211575 | 3300006028 | Bacteria | 1702 |
| 211 | Ga0070717_10322499 | 3300006028 | Unclassified | 1376 |
| 212 | Ga0070717_10407630 | 3300006028 | Bacteria | 1222 |
| 213 | Ga0070717_10444175 | 3300006028 | Unclassified | 1168 |
| 214 | Ga0075368_10008321 | 3300006042 | Bacteria | 3688 |
| 215 | Ga0075368_10039209 | 3300006042 | Bacteria | 1856 |
| 216 | Ga0075368_10067901 | 3300006042 | Bacteria | 1436 |
| 217 | Ga0070715_10033994 | 3300006163 | Bacteria | 2087 |
| 218 | Ga0070715_10104633 | 3300006163 | Bacteria | 1326 |
| 219 | Ga0070715_10258998 | 3300006163 | Unclassified | 913 |
| 220 | Ga0070716_100004330 | 3300006173 | Bacteria | 6769 |
| 221 | Ga0070716_100020309 | 3300006173 | Bacteria | 3486 |
| 222 | Ga0070716_100352858 | 3300006173 | Unclassified | 1042 |
| 223 | Ga0070716_100377611 | 3300006173 | Unclassified | 1012 |
| 224 | Ga0070716_100407866 | 3300006173 | Bacteria | 979 |
| 225 | Ga0070712_100000132 | 3300006175 | Bacteria | 39155 |
| 226 | Ga0070712_100012732 | 3300006175 | Bacteria | 5355 |
| 227 | Ga0070712_100064725 | 3300006175 | Bacteria | 2593 |
| 228 | Ga0070712_100124098 | 3300006175 | Bacteria | 1947 |
| 229 | Ga0075362_10160609 | 3300006177 | Bacteria | 1082 |
| 230 | Ga0075367_10580233 | 3300006178 | Bacteria | 712 |
| 231 | Ga0075366_10003527 | 3300006195 | Bacteria | 8265 |
| 232 | Ga0097621_100000840 | 3300006237 | Bacteria | 21630 |
| 233 | Ga0097621_100030626 | 3300006237 | Unclassified | 4261 |
| 234 | Ga0097621_100053049 | 3300006237 | Bacteria | 3304 |
| 235 | Ga0097621_100125479 | 3300006237 | Bacteria | 2180 |
| 236 | Ga0097621_100227312 | 3300006237 | Unclassified | 1628 |
| 237 | Ga0068871_100017898 | 3300006358 | Bacteria | 5372 |
| 238 | Ga0068871_100026092 | 3300006358 | Bacteria | 4555 |
| 239 | Ga0068871_100157662 | 3300006358 | Bacteria | 1939 |
| 240 | Ga0075433_10004588 | 3300006852 | Bacteria | 10778 |
| 241 | Ga0075434_100000295 | 3300006871 | Bacteria | 35374 |
| 242 | Ga0075434_100032828 | 3300006871 | Bacteria | 5121 |
| 243 | Ga0075434_100342823 | 3300006871 | Bacteria | 1515 |
| 244 | Ga0068865_100005849 | 3300006881 | Bacteria | 7481 |
| 245 | Ga0068865_100079240 | 3300006881 | Bacteria | 2352 |
| 246 | Ga0075436_100000175 | 3300006914 | Bacteria | 40019 |
| 247 | Ga0075436_100001101 | 3300006914 | Bacteria | 18258 |
| 248 | Ga0075436_100005310 | 3300006914 | Bacteria | 8859 |
| 249 | Ga0075436_100057607 | 3300006914 | Unclassified | 2683 |
| 250 | Ga0075436_100090155 | 3300006914 | Bacteria | 2131 |
| 251 | Ga0097620_100000418 | 3300006931 | Bacteria | 42477 |
| 252 | Ga0097620_100016871 | 3300006931 | Bacteria | 7330 |
| 253 | Ga0097620_100022179 | 3300006931 | Bacteria | 6366 |
| 254 | Ga0097620_100071142 | 3300006931 | Unclassified | 3514 |
| 255 | Ga0097620_100126141 | 3300006931 | Bacteria | 2629 |
| 256 | Ga0075435_100000025 | 3300007076 | Bacteria | 87314 |
| 257 | Ga0075435_100036040 | 3300007076 | Bacteria | 3929 |
| 258 | Ga0075435_100039758 | 3300007076 | Bacteria | 3754 |
| 259 | Ga0075435_100046895 | 3300007076 | Bacteria | 3468 |
| 260 | Ga0075435_100444203 | 3300007076 | Bacteria | 1118 |
| 261 | Ga0099794_10362801 | 3300007265 | Bacteria | 754 |
| 262 | Ga0105240_10020606 | 3300009093 | Bacteria | 8789 |
| 263 | Ga0105240_10041278 | 3300009093 | Bacteria | 5891 |
| 264 | Ga0105240_10066126 | 3300009093 | Bacteria | 4486 |
| 265 | Ga0105240_10076981 | 3300009093 | Bacteria | 4111 |
| 266 | Ga0105240_10108353 | 3300009093 | Bacteria | 3366 |
| 267 | Ga0105240_10214715 | 3300009093 | Bacteria | 2245 |
| 268 | Ga0105240_10290921 | 3300009093 | Bacteria | 1873 |
| 269 | Ga0105240_10586626 | 3300009093 | Bacteria | 1229 |
| 270 | Ga0111539_10747887 | 3300009094 | Bacteria | 1138 |
| 271 | Ga0105245_10000741 | 3300009098 | Bacteria | 29480 |
| 272 | Ga0105245_10012235 | 3300009098 | Bacteria | 7465 |
| 273 | Ga0105245_10093699 | 3300009098 | Bacteria | 2768 |
| 274 | Ga0105245_10742145 | 3300009098 | Bacteria | 1017 |
| 275 | Ga0105247_10009654 | 3300009101 | Bacteria | 5853 |
| 276 | Ga0105247_10017244 | 3300009101 | Unclassified | 4334 |
| 277 | Ga0114129_10248700 | 3300009147 | Bacteria | 2388 |
| 278 | Ga0105243_10085335 | 3300009148 | Bacteria | 2588 |
| 279 | Ga0105241_10063394 | 3300009174 | Bacteria | 2851 |
| 280 | Ga0105241_10067844 | 3300009174 | Bacteria | 2762 |
| 281 | Ga0105241_10139656 | 3300009174 | Bacteria | 1971 |
| 282 | Ga0105242_10020694 | 3300009176 | Bacteria | 5160 |
| 283 | Ga0105242_10037701 | 3300009176 | Bacteria | 3884 |
| 284 | Ga0105242_10139623 | 3300009176 | Bacteria | 2101 |
| 285 | Ga0105248_10011199 | 3300009177 | Bacteria | 9892 |
| 286 | Ga0105248_10022175 | 3300009177 | Bacteria | 7040 |
| 287 | Ga0105248_10078291 | 3300009177 | Bacteria | 3716 |
| 288 | Ga0105248_10855439 | 3300009177 | Bacteria | 1027 |
| 289 | Ga0105237_10045385 | 3300009545 | Unclassified | 4423 |
| 290 | Ga0105237_10110696 | 3300009545 | Unclassified | 2738 |
| 291 | Ga0105237_10176019 | 3300009545 | Bacteria | 2140 |
| 292 | Ga0105237_10608632 | 3300009545 | Bacteria | 1099 |
| 293 | Ga0105237_10643988 | 3300009545 | Bacteria | 1067 |
| 294 | Ga0105237_10664704 | 3300009545 | Bacteria | 1049 |
| 295 | Ga0105238_10285501 | 3300009551 | Bacteria | 1632 |
| 296 | Ga0105238_10411322 | 3300009551 | Bacteria | 1346 |
| 297 | Ga0099796_10023123 | 3300010159 | Bacteria | 1937 |
| 298 | Ga0105239_10012609 | 3300010375 | Bacteria | 9406 |
| 299 | Ga0105239_10044133 | 3300010375 | Bacteria | 4887 |
| 300 | Ga0105239_10351876 | 3300010375 | Bacteria | 1663 |
| 301 | Ga0105246_10038994 | 3300011119 | Bacteria | 3198 |
| 302 | Ga0105246_10297511 | 3300011119 | Bacteria | 1301 |
| 303 | Ga0157373_10009287 | 3300013100 | Bacteria | 7270 |
| 304 | Ga0157373_10051692 | 3300013100 | Bacteria | 2926 |
| 305 | Ga0157371_10028747 | 3300013102 | Unclassified | 4024 |
| 306 | Ga0157371_10130659 | 3300013102 | Bacteria | 1787 |
| 307 | Ga0157370_10053910 | 3300013104 | Bacteria | 3834 |
| 308 | Ga0157369_10038801 | 3300013105 | Bacteria | 5207 |
| 309 | Ga0157369_10062504 | 3300013105 | Bacteria | 4012 |
| 310 | Ga0157369_10350128 | 3300013105 | Bacteria | 1534 |
| 311 | Ga0157369_10434871 | 3300013105 | Bacteria | 1359 |
| 312 | Ga0157369_10495862 | 3300013105 | Bacteria | 1263 |
| 313 | Ga0157369_10542291 | 3300013105 | Bacteria | 1202 |
| 314 | Ga0157369_10722062 | 3300013105 | Bacteria | 1026 |
| 315 | Ga0157369_11267596 | 3300013105 | Bacteria | 752 |
| 316 | Ga0157374_10000254 | 3300013296 | Bacteria | 49194 |
| 317 | Ga0157374_10022672 | 3300013296 | Bacteria | 5604 |
| 318 | Ga0157374_10050911 | 3300013296 | Unclassified | 3852 |
| 319 | Ga0157374_10058425 | 3300013296 | Bacteria | 3604 |
| 320 | Ga0157374_10869705 | 3300013296 | Unclassified | 919 |
| 321 | Ga0157378_10000554 | 3300013297 | Bacteria | 35545 |
| 322 | Ga0157378_10003465 | 3300013297 | Bacteria | 13997 |
| 323 | Ga0157378_10079130 | 3300013297 | Bacteria | 2967 |
| 324 | Ga0157378_10238162 | 3300013297 | Bacteria | 1737 |
| 325 | Ga0157378_11524281 | 3300013297 | Bacteria | 713 |
| 326 | Ga0163162_10001180 | 3300013306 | Bacteria | 24381 |
| 327 | Ga0163162_10253681 | 3300013306 | Bacteria | 1891 |
| 328 | Ga0163162_10499787 | 3300013306 | Bacteria | 1346 |
| 329 | Ga0157372_10001984 | 3300013307 | Bacteria | 22243 |
| 330 | Ga0157372_10003830 | 3300013307 | Bacteria | 16171 |
| 331 | Ga0157372_10015279 | 3300013307 | Bacteria | 8223 |
| 332 | Ga0157372_10018474 | 3300013307 | Bacteria | 7495 |
| 333 | Ga0157372_10052817 | 3300013307 | Unclassified | 4527 |
| 334 | Ga0157372_10098762 | 3300013307 | Bacteria | 3331 |
| 335 | Ga0157372_10119184 | 3300013307 | Bacteria | 3029 |
| 336 | Ga0157372_10176433 | 3300013307 | Bacteria | 2473 |
| 337 | Ga0157372_11035565 | 3300013307 | Bacteria | 950 |
| 338 | Ga0157375_10015800 | 3300013308 | Bacteria | 6764 |
| 339 | Ga0157375_10039540 | 3300013308 | Bacteria | 4541 |
| 340 | Ga0163163_10223800 | 3300014325 | Bacteria | 1930 |
| 341 | Ga0163163_10429703 | 3300014325 | Bacteria | 1380 |
| 342 | Ga0157380_10015217 | 3300014326 | Bacteria | 5648 |
| 343 | Ga0157380_10800762 | 3300014326 | Bacteria | 959 |
| 344 | Ga0157377_10002280 | 3300014745 | Bacteria | 8432 |
| 345 | Ga0157379_10023584 | 3300014968 | Bacteria | 5461 |
| 346 | Ga0157379_10033116 | 3300014968 | Bacteria | 4608 |
| 347 | Ga0157379_10123908 | 3300014968 | Bacteria | 2325 |
| 348 | Ga0157379_10136581 | 3300014968 | Bacteria | 2209 |
| 349 | Ga0157379_11429221 | 3300014968 | Unclassified | 671 |
| 350 | Ga0157376_10022460 | 3300014969 | Bacteria | 4919 |
| 351 | Ga0157376_10026292 | 3300014969 | Bacteria | 4597 |
| 352 | Ga0157376_10087658 | 3300014969 | Bacteria | 2687 |
| 353 | Ga0157376_10754716 | 3300014969 | Bacteria | 982 |
| 354 | Ga0182006_1116740 | 3300015261 | Unclassified | 931 |
| 355 | Ga0163161_10029760 | 3300017792 | Unclassified | 3882 |
| 356 | Ga0213876_10200798 | 3300021384 | Unclassified | 1060 |
| 357 | Ga0224570_100839 | 3300022730 | Bacteria | 2453 |
| 358 | Ga0224572_1000076 | 3300024225 | Bacteria | 6856 |
| 359 | Ga0224572_1010563 | 3300024225 | Bacteria | 1739 |
| 360 | Ga0224572_1053580 | 3300024225 | Bacteria | 750 |
| 361 | Ga0228598_1000540 | 3300024227 | Bacteria | 7878 |
| 362 | Ga0228598_1030768 | 3300024227 | Bacteria | 1056 |
| 363 | Ga0207656_10001134 | 3300025321 | Bacteria | 8757 |
| 364 | Ga0207682_10046546 | 3300025893 | Bacteria | 1783 |
| 365 | Ga0207692_10031221 | 3300025898 | Bacteria | 2549 |
| 366 | Ga0207692_10040352 | 3300025898 | Bacteria | 2303 |
| 367 | Ga0207692_10056291 | 3300025898 | Bacteria | 2016 |
| 368 | Ga0207692_10478098 | 3300025898 | Bacteria | 788 |
| 369 | Ga0207692_10507679 | 3300025898 | Unclassified | 766 |
| 370 | Ga0207642_10008671 | 3300025899 | Bacteria | 3501 |
| 371 | Ga0207642_10420757 | 3300025899 | Bacteria | 803 |
| 372 | Ga0207710_10006090 | 3300025900 | Bacteria | 5166 |
| 373 | Ga0207688_10006430 | 3300025901 | Bacteria | 6400 |
| 374 | Ga0207680_10047873 | 3300025903 | Bacteria | 2536 |
| 375 | Ga0207680_10126470 | 3300025903 | Bacteria | 1679 |
| 376 | Ga0207647_10006190 | 3300025904 | Bacteria | 8718 |
| 377 | Ga0207647_10015515 | 3300025904 | Bacteria | 5219 |
| 378 | Ga0207647_10028240 | 3300025904 | Bacteria | 3647 |
| 379 | Ga0207647_10189962 | 3300025904 | Bacteria | 1190 |
| 380 | Ga0207685_10205557 | 3300025905 | Bacteria | 928 |
| 381 | Ga0207685_10259791 | 3300025905 | Unclassified | 843 |
| 382 | Ga0207699_10035039 | 3300025906 | Bacteria | 2853 |
| 383 | Ga0207699_10061687 | 3300025906 | Bacteria | 2257 |
| 384 | Ga0207699_10245404 | 3300025906 | Unclassified | 1232 |
| 385 | Ga0207645_10003011 | 3300025907 | Bacteria | 13020 |
| 386 | Ga0207645_10299494 | 3300025907 | Bacteria | 1070 |
| 387 | Ga0207643_10087426 | 3300025908 | Bacteria | 1812 |
| 388 | Ga0207643_10104823 | 3300025908 | Bacteria | 1661 |
| 389 | Ga0207705_10000723 | 3300025909 | Bacteria | 27209 |
| 390 | Ga0207705_10657420 | 3300025909 | Unclassified | 815 |
| 391 | Ga0207684_10000383 | 3300025910 | Bacteria | 59620 |
| 392 | Ga0207684_10003824 | 3300025910 | Bacteria | 14503 |
| 393 | Ga0207684_10032595 | 3300025910 | Bacteria | 4429 |
| 394 | Ga0207684_10107417 | 3300025910 | Bacteria | 2388 |
| 395 | Ga0207654_10010946 | 3300025911 | Bacteria | 4619 |
| 396 | Ga0207654_10042598 | 3300025911 | Bacteria | 2570 |
| 397 | Ga0207707_10008797 | 3300025912 | Bacteria | 8762 |
| 398 | Ga0207707_10012850 | 3300025912 | Bacteria | 7285 |
| 399 | Ga0207707_10043693 | 3300025912 | Bacteria | 3907 |
| 400 | Ga0207707_10257922 | 3300025912 | Bacteria | 1513 |
| 401 | Ga0207695_10081298 | 3300025913 | Bacteria | 3279 |
| 402 | Ga0207695_10091543 | 3300025913 | Bacteria | 3055 |
| 403 | Ga0207695_10154217 | 3300025913 | Bacteria | 2233 |
| 404 | Ga0207695_10223414 | 3300025913 | Bacteria | 1790 |
| 405 | Ga0207695_10381741 | 3300025913 | Bacteria | 1295 |
| 406 | Ga0207671_10004535 | 3300025914 | Bacteria | 13199 |
| 407 | Ga0207671_10088142 | 3300025914 | Bacteria | 2334 |
| 408 | Ga0207693_10001889 | 3300025915 | Bacteria | 18329 |
| 409 | Ga0207693_10004669 | 3300025915 | Bacteria | 11542 |
| 410 | Ga0207693_10009131 | 3300025915 | Bacteria | 8095 |
| 411 | Ga0207693_10013125 | 3300025915 | Bacteria | 6683 |
| 412 | Ga0207693_10174255 | 3300025915 | Unclassified | 1693 |
| 413 | Ga0207663_10043419 | 3300025916 | Unclassified | 2752 |
| 414 | Ga0207663_10056071 | 3300025916 | Bacteria | 2476 |
| 415 | Ga0207663_10084573 | 3300025916 | Unclassified | 2087 |
| 416 | Ga0207663_10097572 | 3300025916 | Bacteria | 1966 |
| 417 | Ga0207663_10194318 | 3300025916 | Unclassified | 1459 |
| 418 | Ga0207660_10024966 | 3300025917 | Bacteria | 4052 |
| 419 | Ga0207660_10105062 | 3300025917 | Bacteria | 2116 |
| 420 | Ga0207657_10003667 | 3300025919 | Bacteria | 16349 |
| 421 | Ga0207657_10007212 | 3300025919 | Bacteria | 11414 |
| 422 | Ga0207657_10012925 | 3300025919 | Bacteria | 8208 |
| 423 | Ga0207649_10002381 | 3300025920 | Bacteria | 10544 |
| 424 | Ga0207649_10425202 | 3300025920 | Bacteria | 998 |
| 425 | Ga0207652_10045172 | 3300025921 | Bacteria | 3754 |
| 426 | Ga0207652_10088087 | 3300025921 | Bacteria | 2723 |
| 427 | Ga0207652_10118218 | 3300025921 | Unclassified | 2356 |
| 428 | Ga0207652_10595484 | 3300025921 | Unclassified | 992 |
| 429 | Ga0207646_10000229 | 3300025922 | Bacteria | 77035 |
| 430 | Ga0207646_10177886 | 3300025922 | Bacteria | 1921 |
| 431 | Ga0207646_10215745 | 3300025922 | Bacteria | 1733 |
| 432 | Ga0207646_10654400 | 3300025922 | Bacteria | 941 |
| 433 | Ga0207681_10066782 | 3300025923 | Unclassified | 2490 |
| 434 | Ga0207681_10134550 | 3300025923 | Bacteria | 1832 |
| 435 | Ga0207694_10177493 | 3300025924 | Bacteria | 1726 |
| 436 | Ga0207694_10391812 | 3300025924 | Bacteria | 1154 |
| 437 | Ga0207650_10001413 | 3300025925 | Bacteria | 17302 |
| 438 | Ga0207650_10005500 | 3300025925 | Bacteria | 8646 |
| 439 | Ga0207659_10018944 | 3300025926 | Unclassified | 4520 |
| 440 | Ga0207687_10001100 | 3300025927 | Bacteria | 18374 |
| 441 | Ga0207687_10072265 | 3300025927 | Bacteria | 2467 |
| 442 | Ga0207687_10122411 | 3300025927 | Bacteria | 1947 |
| 443 | Ga0207700_10019942 | 3300025928 | Bacteria | 4540 |
| 444 | Ga0207700_10136536 | 3300025928 | Unclassified | 2010 |
| 445 | Ga0207700_10160412 | 3300025928 | Unclassified | 1867 |
| 446 | Ga0207700_10936253 | 3300025928 | Unclassified | 775 |
| 447 | Ga0207664_10000076 | 3300025929 | Bacteria | 102019 |
| 448 | Ga0207664_10041519 | 3300025929 | Bacteria | 3584 |
| 449 | Ga0207664_10141429 | 3300025929 | Bacteria | 2036 |
| 450 | Ga0207664_10176617 | 3300025929 | Unclassified | 1831 |
| 451 | Ga0207664_10261413 | 3300025929 | Bacteria | 1514 |
| 452 | Ga0207664_10281554 | 3300025929 | Bacteria | 1459 |
| 453 | Ga0207664_10641119 | 3300025929 | Unclassified | 955 |
| 454 | Ga0207664_10703356 | 3300025929 | Bacteria | 909 |
| 455 | Ga0207664_10917805 | 3300025929 | Unclassified | 786 |
| 456 | Ga0207690_10020615 | 3300025932 | Unclassified | 4076 |
| 457 | Ga0207690_10296121 | 3300025932 | Bacteria | 1264 |
| 458 | Ga0207706_10000790 | 3300025933 | Bacteria | 32752 |
| 459 | Ga0207706_10000880 | 3300025933 | Bacteria | 30836 |
| 460 | Ga0207706_10094879 | 3300025933 | Bacteria | 2624 |
| 461 | Ga0207706_10336593 | 3300025933 | Bacteria | 1313 |
| 462 | Ga0207686_10035930 | 3300025934 | Bacteria | 2978 |
| 463 | Ga0207670_10005022 | 3300025936 | Bacteria | 7211 |
| 464 | Ga0207670_10047313 | 3300025936 | Bacteria | 2864 |
| 465 | Ga0207670_10180636 | 3300025936 | Bacteria | 1589 |
| 466 | Ga0207669_10322540 | 3300025937 | Bacteria | 1183 |
| 467 | Ga0207704_10204765 | 3300025938 | Bacteria | 1447 |
| 468 | Ga0207665_10000085 | 3300025939 | Bacteria | 60799 |
| 469 | Ga0207665_10030051 | 3300025939 | Unclassified | 3591 |
| 470 | Ga0207665_10050444 | 3300025939 | Bacteria | 2798 |
| 471 | Ga0207665_10080110 | 3300025939 | Bacteria | 2246 |
| 472 | Ga0207665_10091791 | 3300025939 | Unclassified | 2106 |
| 473 | Ga0207665_10101498 | 3300025939 | Bacteria | 2009 |
| 474 | Ga0207665_10192209 | 3300025939 | Unclassified | 1484 |
| 475 | Ga0207665_10272479 | 3300025939 | Bacteria | 1257 |
| 476 | Ga0207665_10381303 | 3300025939 | Unclassified | 1070 |
| 477 | Ga0207665_10847135 | 3300025939 | Unclassified | 724 |
| 478 | Ga0207691_10001778 | 3300025940 | Bacteria | 21200 |
| 479 | Ga0207711_10001004 | 3300025941 | Bacteria | 27059 |
| 480 | Ga0207711_10089923 | 3300025941 | Bacteria | 2698 |
| 481 | Ga0207711_10098663 | 3300025941 | Unclassified | 2581 |
| 482 | Ga0207689_10000300 | 3300025942 | Bacteria | 45314 |
| 483 | Ga0207689_10006573 | 3300025942 | Bacteria | 10251 |
| 484 | Ga0207689_10051957 | 3300025942 | Bacteria | 3378 |
| 485 | Ga0207661_10000720 | 3300025944 | Bacteria | 21511 |
| 486 | Ga0207661_10193967 | 3300025944 | Bacteria | 1782 |
| 487 | Ga0207679_10000359 | 3300025945 | Bacteria | 33269 |
| 488 | Ga0207679_10008269 | 3300025945 | Bacteria | 6626 |
| 489 | Ga0207679_10148014 | 3300025945 | Bacteria | 1907 |
| 490 | Ga0207667_10008905 | 3300025949 | Bacteria | 11873 |
| 491 | Ga0207667_10012807 | 3300025949 | Bacteria | 9635 |
| 492 | Ga0207667_10046283 | 3300025949 | Bacteria | 4606 |
| 493 | Ga0207667_10072845 | 3300025949 | Bacteria | 3570 |
| 494 | Ga0207667_10146997 | 3300025949 | Unclassified | 2426 |
| 495 | Ga0207651_10060678 | 3300025960 | Unclassified | 2626 |
| 496 | Ga0207651_10083894 | 3300025960 | Bacteria | 2306 |
| 497 | Ga0207668_10016324 | 3300025972 | Bacteria | 4632 |
| 498 | Ga0207640_10009050 | 3300025981 | Bacteria | 5557 |
| 499 | Ga0207640_10010511 | 3300025981 | Bacteria | 5216 |
| 500 | Ga0207640_10067752 | 3300025981 | Bacteria | 2390 |
| 501 | Ga0207658_10084780 | 3300025986 | Bacteria | 2439 |
| 502 | Ga0207658_10194809 | 3300025986 | Bacteria | 1687 |
| 503 | Ga0207658_10231070 | 3300025986 | Bacteria | 1561 |
| 504 | Ga0207677_10008642 | 3300026023 | Bacteria | 5701 |
| 505 | Ga0207677_10039324 | 3300026023 | Bacteria | 3110 |
| 506 | Ga0207677_10068035 | 3300026023 | Bacteria | 2497 |
| 507 | Ga0207677_10080754 | 3300026023 | Bacteria | 2331 |
| 508 | Ga0207703_10003668 | 3300026035 | Bacteria | 12799 |
| 509 | Ga0207639_10887305 | 3300026041 | Bacteria | 833 |
| 510 | Ga0207678_10000498 | 3300026067 | Bacteria | 35724 |
| 511 | Ga0207678_10001010 | 3300026067 | Bacteria | 25646 |
| 512 | Ga0207678_10008712 | 3300026067 | Bacteria | 8932 |
| 513 | Ga0207678_10009433 | 3300026067 | Bacteria | 8583 |
| 514 | Ga0207708_10115810 | 3300026075 | Bacteria | 2085 |
| 515 | Ga0207708_10120793 | 3300026075 | Bacteria | 2041 |
| 516 | Ga0207702_10014378 | 3300026078 | Bacteria | 6571 |
| 517 | Ga0207702_10026955 | 3300026078 | Bacteria | 4772 |
| 518 | Ga0207702_10118623 | 3300026078 | Unclassified | 2364 |
| 519 | Ga0207702_10225798 | 3300026078 | Bacteria | 1747 |
| 520 | Ga0207702_10323709 | 3300026078 | Unclassified | 1469 |
| 521 | Ga0207702_11323065 | 3300026078 | Bacteria | 715 |
| 522 | Ga0207641_10000147 | 3300026088 | Bacteria | 99902 |
| 523 | Ga0207641_10084058 | 3300026088 | Bacteria | 2770 |
| 524 | Ga0207648_10001035 | 3300026089 | Bacteria | 31211 |
| 525 | Ga0207648_10002663 | 3300026089 | Bacteria | 19026 |
| 526 | Ga0207648_10005754 | 3300026089 | Bacteria | 12423 |
| 527 | Ga0207648_10311104 | 3300026089 | Bacteria | 1414 |
| 528 | Ga0207648_10451093 | 3300026089 | Bacteria | 1171 |
| 529 | Ga0207676_10001035 | 3300026095 | Bacteria | 21311 |
| 530 | Ga0207676_10098771 | 3300026095 | Unclassified | 2414 |
| 531 | Ga0207676_10758061 | 3300026095 | Bacteria | 944 |
| 532 | Ga0207674_10000432 | 3300026116 | Bacteria | 54683 |
| 533 | Ga0207674_10000514 | 3300026116 | Bacteria | 50775 |
| 534 | Ga0207674_10002218 | 3300026116 | Bacteria | 24590 |
| 535 | Ga0207674_10046839 | 3300026116 | Bacteria | 4437 |
| 536 | Ga0207674_10124852 | 3300026116 | Bacteria | 2540 |
| 537 | Ga0207675_100044794 | 3300026118 | Unclassified | 4134 |
| 538 | Ga0207675_100487967 | 3300026118 | Bacteria | 1225 |
| 539 | Ga0207683_10221923 | 3300026121 | Bacteria | 1722 |
| 540 | Ga0207698_10610651 | 3300026142 | Bacteria | 1076 |
| 541 | Ga0207698_10874448 | 3300026142 | Bacteria | 905 |
| 542 | Ga0209813_10039490 | 3300027866 | Bacteria | 1431 |
| 543 | Ga0265356_1001311 | 3300028017 | Bacteria | 3733 |
| 544 | Ga0268266_10047429 | 3300028379 | Bacteria | 3680 |
| 545 | Ga0268266_10171856 | 3300028379 | Bacteria | 1967 |
| 546 | Ga0268265_10039285 | 3300028380 | Unclassified | 3487 |
| 547 | Ga0268264_10030574 | 3300028381 | Bacteria | 4414 |
| 548 | Ga0268264_10034688 | 3300028381 | Bacteria | 4152 |
| 549 | Ga0268264_10065925 | 3300028381 | Bacteria | 3052 |
| 550 | Ga0268264_10087408 | 3300028381 | Unclassified | 2680 |
| 551 | Ga0268264_10434691 | 3300028381 | Bacteria | 1268 |
| 552 | Ga0265338_10021209 | 3300028800 | Bacteria | 6785 |
| 553 | Ga0265338_10151941 | 3300028800 | Bacteria | 1798 |
| 554 | Ga0265762_1000668 | 3300030760 | Bacteria | 6038 |
| 555 | Ga0265762_1003454 | 3300030760 | Unclassified | 2831 |
| 556 | Ga0265770_1001315 | 3300030878 | Bacteria | 3435 |
| 557 | Ga0265770_1019314 | 3300030878 | Bacteria | 1068 |
| 558 | Ga0265765_1000051 | 3300030879 | Bacteria | 5894 |
| 559 | Ga0265760_10000020 | 3300031090 | Bacteria | 71420 |
| 560 | Ga0265760_10000664 | 3300031090 | Bacteria | 9769 |
| 561 | Ga0265760_10000741 | 3300031090 | Bacteria | 9325 |
| 562 | Ga0265760_10006543 | 3300031090 | Bacteria | 3333 |
| 563 | Ga0265760_10007699 | 3300031090 | Bacteria | 3078 |
| 564 | Ga0265760_10075506 | 3300031090 | Bacteria | 1039 |
| 565 | Ga0265760_10082693 | 3300031090 | Bacteria | 996 |
| 566 | Ga0265330_10001607 | 3300031235 | Bacteria | 12916 |
| 567 | Ga0265340_10168715 | 3300031247 | Unclassified | 992 |
| 568 | Ga0265339_10048893 | 3300031249 | Bacteria | 2317 |
| 569 | Ga0265339_10199481 | 3300031249 | Bacteria | 988 |
| 570 | Ga0265316_10005890 | 3300031344 | Bacteria | 11814 |
| 571 | Ga0265316_10181639 | 3300031344 | Bacteria | 1566 |
| 572 | Ga0307408_100016365 | 3300031548 | Bacteria | 4949 |
| 573 | Ga0307408_100151187 | 3300031548 | Bacteria | 1833 |
| 574 | Ga0265314_10000920 | 3300031711 | Bacteria | 34667 |
| 575 | Ga0265314_10036249 | 3300031711 | Bacteria | 3586 |
| 576 | Ga0265314_10043074 | 3300031711 | Unclassified | 3213 |
| 577 | Ga0265314_10302743 | 3300031711 | Bacteria | 896 |
| 578 | Ga0307413_10825923 | 3300031824 | Bacteria | 781 |
| 579 | Ga0307410_10144096 | 3300031852 | Bacteria | 1766 |
| 580 | Ga0307409_100004397 | 3300031995 | Bacteria | 7912 |
| 581 | Ga0307416_100271600 | 3300032002 | Bacteria | 1665 |
| 582 | Ga0307416_100433875 | 3300032002 | Bacteria | 1362 |
| 583 | Ga0307414_10591877 | 3300032004 | Bacteria | 994 |
| 584 | Ga0307411_10014175 | 3300032005 | Unclassified | 4427 |
| 585 | Ga0307415_100001749 | 3300032126 | Bacteria | 10589 |
| 586 | Ga0373930_0094866 | 3300034816 | Bacteria | 703 |
| 587 | Ga0373934_0004450 | 3300035086 | Bacteria | 5178 |
| 588 | Ga0373934_0055310 | 3300035086 | Bacteria | 1577 |
| 589 | Ga0373951_0084832 | 3300035091 | Bacteria | 824 |
| 590 | Ga0373923_0010879 | 3300035111 | Unclassified | 3323 |
| 591 | Ga0373923_0098120 | 3300035111 | Bacteria | 1289 |
| 592 | Ga0373923_0108802 | 3300035111 | Unclassified | 1229 |
| 593 | Ga0373936_0037405 | 3300035113 | Bacteria | 1938 |
| 594 | Ga0373936_0078030 | 3300035113 | Bacteria | 1374 |
| 595 | Ga0373939_0039784 | 3300035114 | Bacteria | 1409 |
| 596 | Ga0373941_0197642 | 3300035115 | Bacteria | 763 |
| 597 | Ga0373945_0001902 | 3300035116 | Bacteria | 6477 |
| 598 | Ga0373956_0041590 | 3300035119 | Bacteria | 2041 |
| 599 | Ga0373957_0040371 | 3300035120 | Bacteria | 1754 |
| 600 | Ga0373960_0028999 | 3300035121 | Bacteria | 1531 |
| 601 | Ga0373943_0000480 | 3300035170 | Bacteria | 17033 |
| 602 | Ga0373943_0007718 | 3300035170 | Bacteria | 4832 |
| 603 | Ga0373943_0225384 | 3300035170 | Bacteria | 1045 |
| 604 | Ga0373943_0300394 | 3300035170 | Bacteria | 911 |
| 605 | Ga0373943_0359292 | 3300035170 | Bacteria | 836 |
| 606 | Ga0373946_0006365 | 3300035171 | Bacteria | 4279 |
| 607 | Ga0373955_0014880 | 3300035172 | Bacteria | 3796 |
| 608 | Ga0373955_0217433 | 3300035172 | Unclassified | 1140 |
| 609 | Ga0373955_0314133 | 3300035172 | Bacteria | 946 |
| 610 | Ga0373955_0417008 | 3300035172 | Unclassified | 816 |
| 611 | Ga0373942_0095978 | 3300035207 | Bacteria | 900 |
| 612 | Ga0373924_0005123 | 3300035410 | Bacteria | 4624 |
| 613 | Ga0373924_0099101 | 3300035410 | Bacteria | 1252 |
| 614 | Ga0373931_0015153 | 3300035691 | Bacteria | 3778 |
| 615 | Ga0373931_0129277 | 3300035691 | Bacteria | 1452 |
| 616 | Ga0373931_0232630 | 3300035691 | Bacteria | 1114 |
| 617 | Ga0373935_0000474 | 3300035692 | Bacteria | 20860 |
| 618 | Ga0373935_0003560 | 3300035692 | Bacteria | 9075 |
| 619 | Ga0373935_0089675 | 3300035692 | Bacteria | 2011 |
| 620 | Ga0373935_0167236 | 3300035692 | Bacteria | 1502 |
| 621 | Ga0373927_0000433 | 3300035695 | Bacteria | 32099 |
| 622 | Ga0373927_0006915 | 3300035695 | Bacteria | 7707 |
| 623 | Ga0373927_0070326 | 3300035695 | Bacteria | 2265 |
| 624 | Ga0373927_0442217 | 3300035695 | Bacteria | 858 |
| 625 | Ga0373933_0001863 | 3300035724 | Bacteria | 12192 |
| 626 | Ga0373933_0021611 | 3300035724 | Unclassified | 3657 |
| 627 | Ga0373933_0022965 | 3300035724 | Unclassified | 3558 |
| 628 | Ga0373933_0038036 | 3300035724 | Bacteria | 2826 |
| 629 | Ga0373933_0082901 | 3300035724 | Bacteria | 1969 |
| 630 | Ga0373947_0000115 | 3300035725 | Bacteria | 40107 |
| 631 | Ga0373947_0231523 | 3300035725 | Bacteria | 1217 |
| 632 | Ga0373947_0265658 | 3300035725 | Bacteria | 1138 |
| 633 | Ga0373937_0000001 | 3300036401 | Bacteria | 478903 |
| 634 | Ga0373937_0020629 | 3300036401 | Bacteria | 5908 |
| 635 | Ga0373937_0034114 | 3300036401 | Bacteria | 4628 |
| 636 | Ga0373937_0122911 | 3300036401 | Bacteria | 2420 |
| 637 | Ga0373937_0408020 | 3300036401 | Bacteria | 1289 |
| 638 | Ga0373937_0564829 | 3300036401 | Bacteria | 1081 |
| 639 | Ga0373925_0001531 | 3300037068 | Bacteria | 19721 |
| 640 | Ga0373925_0172517 | 3300037068 | Bacteria | 1708 |
| 641 | Ga0373925_0261921 | 3300037068 | Bacteria | 1389 |
| 642 | Ga0373925_0367561 | 3300037068 | Unclassified | 1170 |
| 643 | Ga0395900_0356038 | 3300037418 | Bacteria | 1436 |
| 644 | Ga0395900_0558442 | 3300037418 | Bacteria | 1089 |
| 645 | Ga0395905_0020273 | 3300037471 | Bacteria | 6300 |
| 646 | Ga0395905_0027208 | 3300037471 | Bacteria | 5393 |
| 647 | Ga0395905_0106925 | 3300037471 | Bacteria | 2627 |
| 648 | Ga0395901_0594669 | 3300038443 | Bacteria | 1116 |
| 649 | Ga0436365_0979910 | 3300039437 | Bacteria | 1880 |
| 650 | Ga0436365_1144293 | 3300039437 | Bacteria | 3892 |
| 651 | Ga0436363_0695341 | 3300039450 | Unclassified | 803 |
| 652 | Ga0436363_1227896 | 3300039450 | Bacteria | 1064 |
| 653 | Ga0436363_1324681 | 3300039450 | Bacteria | 2100 |
| 654 | Ga0451577_0000331 | 3300042876 | Bacteria | 88029 |
| 655 | Ga0453683_0009319 | 3300044673 | Bacteria | 6560 |
| 656 | Ga0453683_0202049 | 3300044673 | Bacteria | 1262 |
| 657 | Ga0466961_0497421 | 3300044693 | Bacteria | 736 |
| 658 | Ga0466963_0411409 | 3300044694 | Bacteria | 954 |
| 659 | Ga0466963_0679471 | 3300044694 | Bacteria | 727 |
| 660 | Ga0453684_0000429 | 3300044712 | Bacteria | 171513 |
| 661 | Ga0453684_1033931 | 3300044712 | Bacteria | 872 |
| 662 | Ga0451576_0002208 | 3300045051 | Bacteria | 29964 |
| 663 | Ga0451576_0168278 | 3300045051 | Bacteria | 2287 |
| 664 | Ga0451576_0331805 | 3300045051 | Unclassified | 1592 |
| 665 | Ga0451576_1016494 | 3300045051 | Bacteria | 869 |
| 666 | Ga0451576_1577157 | 3300045051 | Bacteria | 681 |
| 667 | Ga0466967_0269293 | 3300045976 | Bacteria | 1632 |
| 668 | Ga0466967_0312528 | 3300045976 | Bacteria | 1514 |
| 669 | Ga0495653_0060335 | 3300046463 | Bacteria | 2874 |
| 670 | Ga0495653_0125339 | 3300046463 | Bacteria | 1825 |
| 671 | Ga0495653_0524393 | 3300046463 | Unclassified | 736 |
| 672 | Ga0495580_0001849 | 3300046472 | Bacteria | 18621 |
| 673 | Ga0495580_0001939 | 3300046472 | Bacteria | 18188 |
| 674 | Ga0495580_0007136 | 3300046472 | Bacteria | 9000 |
| 675 | Ga0495580_0007791 | 3300046472 | Bacteria | 8583 |
| 676 | Ga0495580_0009328 | 3300046472 | Bacteria | 7721 |
| 677 | Ga0495580_0019097 | 3300046472 | Bacteria | 5096 |
| 678 | Ga0495580_0020786 | 3300046472 | Bacteria | 4852 |
| 679 | Ga0495580_0038482 | 3300046472 | Bacteria | 3425 |
| 680 | Ga0495580_0039958 | 3300046472 | Unclassified | 3355 |
| 681 | Ga0495580_0145825 | 3300046472 | Bacteria | 1641 |
| 682 | Ga0495582_0000976 | 3300046473 | Bacteria | 15993 |
| 683 | Ga0495664_0581525 | 3300046477 | Unclassified | 666 |
| 684 | Ga0495594_0007613 | 3300046499 | Bacteria | 5574 |
| 685 | Ga0495628_0050370 | 3300046516 | Bacteria | 3294 |
| 686 | Ga0495630_0023613 | 3300046517 | Bacteria | 4546 |
| 687 | Ga0495630_0148197 | 3300046517 | Bacteria | 1785 |
| 688 | Ga0495630_0424309 | 3300046517 | Bacteria | 1019 |
| 689 | Ga0495666_0147946 | 3300046526 | Bacteria | 1093 |
| 690 | Ga0495642_0118539 | 3300046528 | Bacteria | 1135 |
| 691 | Ga0495652_0022463 | 3300046529 | Bacteria | 5598 |
| 692 | Ga0495652_0193542 | 3300046529 | Bacteria | 1550 |
| 693 | Ga0495652_0407074 | 3300046529 | Unclassified | 962 |
| 694 | Ga0495665_0003216 | 3300046531 | Bacteria | 8837 |
| 695 | Ga0495586_0016780 | 3300046535 | Unclassified | 3897 |
| 696 | Ga0495587_0000433 | 3300046536 | Bacteria | 29356 |
| 697 | Ga0495587_0038455 | 3300046536 | Bacteria | 2868 |
| 698 | Ga0495587_0065189 | 3300046536 | Bacteria | 2127 |
| 699 | Ga0495645_0013243 | 3300046543 | Bacteria | 5830 |
| 700 | Ga0495667_0098922 | 3300046559 | Bacteria | 1889 |
| 701 | Ga0495668_0072291 | 3300046616 | Bacteria | 1895 |
| 702 | Ga0495588_0074714 | 3300046674 | Bacteria | 1765 |
| 703 | Ga0495657_0197083 | 3300046675 | Bacteria | 1229 |
| 704 | Ga0495657_0317663 | 3300046675 | Bacteria | 926 |
| 705 | Ga0495623_0043021 | 3300046679 | Bacteria | 2875 |
| 706 | Ga0495623_0110870 | 3300046679 | Unclassified | 1663 |
| 707 | Ga0495623_0186837 | 3300046679 | Bacteria | 1200 |
| 708 | Ga0495623_0302552 | 3300046679 | Unclassified | 883 |
| 709 | Ga0495646_0343968 | 3300046680 | Unclassified | 782 |
| 710 | Ga0495669_0046424 | 3300046684 | Bacteria | 1939 |
| 711 | Ga0495669_0085838 | 3300046684 | Bacteria | 1449 |
| 712 | Ga0495669_0115617 | 3300046684 | Bacteria | 1255 |
| 713 | Ga0495613_0291765 | 3300046689 | Unclassified | 1131 |
| 714 | Ga0495613_0394597 | 3300046689 | Unclassified | 945 |
| 715 | Ga0495624_0016490 | 3300046690 | Bacteria | 4973 |
| 716 | Ga0495600_0537537 | 3300046809 | Unclassified | 715 |
| 717 | Ga0495581_0032535 | 3300047315 | Bacteria | 3020 |
| 718 | Ga0495604_0010097 | 3300047317 | Bacteria | 7478 |
| 719 | Ga0495674_0009335 | 3300047319 | Bacteria | 9327 |
| 720 | Ga0495674_0676253 | 3300047319 | Bacteria | 812 |
| 721 | Ga0495675_0023972 | 3300047444 | Unclassified | 3888 |
| 722 | Ga0495675_0035585 | 3300047444 | Bacteria | 3179 |
| 723 | Ga0495675_0068352 | 3300047444 | Bacteria | 2244 |
| 724 | Ga0495602_0000056 | 3300048088 | Bacteria | 109741 |
| 725 | Ga0495602_0021528 | 3300048088 | Bacteria | 6343 |
| 726 | Ga0495602_0054926 | 3300048088 | Bacteria | 3512 |
| 727 | Ga0495602_0143881 | 3300048088 | Bacteria | 1884 |
| 728 | Ga0495602_0281477 | 3300048088 | Unclassified | 1225 |
| 729 | Ga0496100_0208809 | 3300048903 | Bacteria | 1427 |
| 730 | Ga0496101_0099388 | 3300048904 | Bacteria | 2175 |
| 731 | Ga0496101_0270422 | 3300048904 | Bacteria | 1327 |
| 732 | Ga0496102_0001511 | 3300048905 | Bacteria | 20524 |
| 733 | Ga0496102_0135493 | 3300048905 | Bacteria | 2307 |
| 734 | Ga0496102_0212551 | 3300048905 | Bacteria | 1823 |
| 735 | Ga0496103_0001097 | 3300048906 | Bacteria | 18843 |
| 736 | Ga0496103_0036085 | 3300048906 | Bacteria | 3027 |
| 737 | Ga0496104_0083719 | 3300048907 | Bacteria | 3042 |
| 738 | Ga0496104_0169064 | 3300048907 | Bacteria | 2097 |
| 739 | Ga0496104_0199351 | 3300048907 | Bacteria | 1914 |
| 740 | Ga0496104_0202299 | 3300048907 | Unclassified | 1898 |
| 741 | Ga0496104_0790134 | 3300048907 | Bacteria | 855 |
| 742 | Ga0496105_0047541 | 3300048908 | Bacteria | 3541 |
| 743 | Ga0496105_0421188 | 3300048908 | Bacteria | 1057 |
| 744 | Ga0496105_0552234 | 3300048908 | Unclassified | 899 |
| 745 | Ga0496106_0065595 | 3300048909 | Bacteria | 2764 |
| 746 | Ga0496106_0073362 | 3300048909 | Bacteria | 2618 |
| 747 | Ga0496107_0067487 | 3300048910 | Bacteria | 2595 |
| 748 | Ga0496108_0000051 | 3300048911 | Bacteria | 131546 |
| 749 | Ga0496109_0000105 | 3300048912 | Bacteria | 87116 |
| 750 | Ga0496109_1024050 | 3300048912 | Bacteria | 763 |
| 751 | Ga0496110_0000138 | 3300048913 | Bacteria | 42078 |
| 752 | Ga0496111_0128235 | 3300048914 | Bacteria | 1876 |
| 753 | Ga0496112_0000688 | 3300048915 | Bacteria | 23567 |
| 754 | Ga0496112_0003243 | 3300048915 | Bacteria | 13407 |
| 755 | Ga0496112_0040162 | 3300048915 | Bacteria | 4575 |
| 756 | Ga0496112_0168721 | 3300048915 | Bacteria | 2154 |
| 757 | Ga0496112_0456429 | 3300048915 | Bacteria | 1215 |
| 758 | Ga0496112_0785955 | 3300048915 | Unclassified | 877 |
| 759 | Ga0496113_0000499 | 3300048916 | Bacteria | 19290 |
| 760 | Ga0496113_0086343 | 3300048916 | Bacteria | 2411 |
| 761 | Ga0496113_0191418 | 3300048916 | Bacteria | 1624 |
| 762 | Ga0496114_0197514 | 3300048917 | Bacteria | 1761 |
| 763 | Ga0496114_0441930 | 3300048917 | Bacteria | 1152 |
| 764 | Ga0496115_0685988 | 3300048918 | Unclassified | 807 |
| 765 | Ga0501033_0619943 | 3300049570 | Bacteria | 741 |
| 766 | Ga0501034_0145316 | 3300049571 | Bacteria | 2349 |
| 767 | Ga0501037_0085974 | 3300049573 | Bacteria | 2277 |
| 768 | Ga0501038_0857562 | 3300049574 | Unclassified | 672 |
| 769 | Ga0501047_0067889 | 3300049581 | Bacteria | 3435 |
| 770 | Ga0501067_0503958 | 3300049583 | Bacteria | 677 |
| 771 | Ga0501070_0353266 | 3300049586 | Bacteria | 1193 |
| 772 | Ga0501071_0299034 | 3300049587 | Bacteria | 1220 |
| 773 | Ga0501072_0387631 | 3300049588 | Bacteria | 1109 |
| 774 | Ga0501073_0008916 | 3300049589 | Bacteria | 7414 |
| 775 | Ga0501076_0419644 | 3300049592 | Unclassified | 1101 |
| 776 | Ga0501235_010391 | 3300049669 | Bacteria | 2034 |
| 777 | Ga0501225_0031666 | 3300049705 | Bacteria | 1455 |
| 778 | Ga0501079_0276447 | 3300049741 | Bacteria | 1313 |
| 779 | Ga0501083_0448779 | 3300049744 | Unclassified | 839 |
| 780 | Ga0501270_010597 | 3300049767 | Unclassified | 1218 |
| 781 | nmdc:mga03683_230672_c1 | 3300050489 | Bacteria | 856 |
| 782 | nmdc:mga03n38_48078_c1 | 3300050490 | Bacteria | 1891 |
| 783 | nmdc:mga0k408_25943_c1 | 3300050493 | Bacteria | 3321 |
| 784 | nmdc:mga04h51_12514_c1 | 3300050495 | Bacteria | 2383 |
| 785 | nmdc:mga07m45_12720_c1 | 3300050496 | Bacteria | 4451 |
| 786 | nmdc:mga05p37_292254_c1 | 3300050507 | Bacteria | 1939 |
| 787 | nmdc:mga0n895_103_c1 | 3300050512 | Bacteria | 49967 |
| 788 | nmdc:mga0n895_366171_c1 | 3300050512 | Bacteria | 1459 |
| 789 | nmdc:mga0n895_507085_c1 | 3300050512 | Bacteria | 1215 |
| 790 | nmdc:mga0n895_7372_c1 | 3300050512 | Bacteria | 9433 |
| 791 | nmdc:mga0rr50_27742_c1 | 3300050513 | Bacteria | 3970 |
| 792 | nmdc:mga0rr50_52330_c1 | 3300050513 | Bacteria | 3034 |
| 793 | nmdc:mga0rr50_71074_c1 | 3300050513 | Unclassified | 2654 |
| 794 | nmdc:mga0rr50_881_c1 | 3300050513 | Bacteria | 16224 |
| 795 | nmdc:mga08x19_139092_c1 | 3300050514 | Bacteria | 1639 |
| 796 | nmdc:mga08x19_3200_c1 | 3300050514 | Bacteria | 9819 |
| 797 | nmdc:mga08x19_49976_c1 | 3300050514 | Unclassified | 2682 |
| 798 | nmdc:mga08x19_7511_c1 | 3300050514 | Bacteria | 6476 |
| 799 | nmdc:mga08x19_9557_c1 | 3300050514 | Bacteria | 5807 |
| 800 | nmdc:mga0a205_835528_c1 | 3300050515 | Bacteria | 768 |
| 801 | Ga0495612_0145317 | 3300053078 | Bacteria | 1030 |
| 802 | Ga0501084_0042105 | 3300054114 | Bacteria | 3820 |
| 803 | Ga0501084_1141688 | 3300054114 | Bacteria | 654 |
| 804 | Ga0501082_0467300 | 3300060353 | Bacteria | 1102 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_1141688 | Ga0501084_1141688_20_559 | 173 |
| 2 | 3300026078 | Ga0207702_11323065 | Ga0207702_113230651 | 182 |
| 3 | 3300005468 | Ga0070707_100148036 | Ga0070707_1001480362 | 185 |
| 4 | 3300049574 | Ga0501038_0857562 | Ga0501038_0857562_76_651 | 185 |
| 5 | 3300005328 | Ga0070676_10008222 | Ga0070676_100082222 | 186 |
| 6 | 3300005330 | Ga0070690_100120734 | Ga0070690_1001207342 | 186 |
| 7 | 3300005335 | Ga0070666_10100199 | Ga0070666_101001992 | 186 |
| 8 | 3300005336 | Ga0070680_100164109 | Ga0070680_1001641091 | 186 |
| 9 | 3300005338 | Ga0068868_100020227 | Ga0068868_1000202272 | 186 |
| 10 | 3300005339 | Ga0070660_100112287 | Ga0070660_1001122872 | 186 |
| 11 | 3300005344 | Ga0070661_100170097 | Ga0070661_1001700971 | 186 |
| 12 | 3300005347 | Ga0070668_100102469 | Ga0070668_1001024693 | 186 |
| 13 | 3300005366 | Ga0070659_100084160 | Ga0070659_1000841603 | 186 |
| 14 | 3300005367 | Ga0070667_100120440 | Ga0070667_1001204403 | 186 |
| 15 | 3300005437 | Ga0070710_10418170 | Ga0070710_104181702 | 186 |
| 16 | 3300005440 | Ga0070705_100263388 | Ga0070705_1002633882 | 186 |
| 17 | 3300005441 | Ga0070700_100092015 | Ga0070700_1000920152 | 186 |
| 18 | 3300005455 | Ga0070663_100006657 | Ga0070663_1000066578 | 186 |
| 19 | 3300005457 | Ga0070662_100001840 | Ga0070662_1000018406 | 186 |
| 20 | 3300005459 | Ga0068867_100027341 | Ga0068867_1000273411 | 186 |
| 21 | 3300005530 | Ga0070679_100107507 | Ga0070679_1001075073 | 186 |
| 22 | 3300005535 | Ga0070684_100003777 | Ga0070684_1000037773 | 186 |
| 23 | 3300005539 | Ga0068853_100274324 | Ga0068853_1002743241 | 186 |
| 24 | 3300005544 | Ga0070686_100015652 | Ga0070686_1000156523 | 186 |
| 25 | 3300005547 | Ga0070693_100157563 | Ga0070693_1001575632 | 186 |
| 26 | 3300005548 | Ga0070665_100004447 | Ga0070665_1000044477 | 186 |
| 27 | 3300005563 | Ga0068855_100153482 | Ga0068855_1001534823 | 186 |
| 28 | 3300005564 | Ga0070664_100007016 | Ga0070664_1000070162 | 186 |
| 29 | 3300005577 | Ga0068857_100167457 | Ga0068857_1001674572 | 186 |
| 30 | 3300005578 | Ga0068854_100015075 | Ga0068854_1000150753 | 186 |
| 31 | 3300005614 | Ga0068856_100071560 | Ga0068856_1000715604 | 186 |
| 32 | 3300005617 | Ga0068859_100022181 | Ga0068859_1000221814 | 186 |
| 33 | 3300005618 | Ga0068864_100130421 | Ga0068864_1001304212 | 186 |
| 34 | 3300005718 | Ga0068866_10072406 | Ga0068866_100724062 | 186 |
| 35 | 3300005834 | Ga0068851_10033133 | Ga0068851_100331332 | 186 |
| 36 | 3300005840 | Ga0068870_10174904 | Ga0068870_101749042 | 186 |
| 37 | 3300005842 | Ga0068858_100446202 | Ga0068858_1004462021 | 186 |
| 38 | 3300005843 | Ga0068860_100332493 | Ga0068860_1003324931 | 186 |
| 39 | 3300005844 | Ga0068862_100008956 | Ga0068862_1000089565 | 186 |
| 40 | 3300006358 | Ga0068871_100157662 | Ga0068871_1001576622 | 186 |
| 41 | 3300006881 | Ga0068865_100079240 | Ga0068865_1000792402 | 186 |
| 42 | 3300006931 | Ga0097620_100022179 | Ga0097620_1000221795 | 186 |
| 43 | 3300009093 | Ga0105240_10066126 | Ga0105240_100661262 | 186 |
| 44 | 3300009098 | Ga0105245_10742145 | Ga0105245_107421452 | 186 |
| 45 | 3300009148 | Ga0105243_10085335 | Ga0105243_100853353 | 186 |
| 46 | 3300009177 | Ga0105248_10011199 | Ga0105248_100111992 | 186 |
| 47 | 3300009545 | Ga0105237_10643988 | Ga0105237_106439881 | 186 |
| 48 | 3300010375 | Ga0105239_10351876 | Ga0105239_103518761 | 186 |
| 49 | 3300011119 | Ga0105246_10038994 | Ga0105246_100389943 | 186 |
| 50 | 3300013100 | Ga0157373_10051692 | Ga0157373_100516923 | 186 |
| 51 | 3300013102 | Ga0157371_10130659 | Ga0157371_101306592 | 186 |
| 52 | 3300013104 | Ga0157370_10053910 | Ga0157370_100539102 | 186 |
| 53 | 3300013105 | Ga0157369_10434871 | Ga0157369_104348712 | 186 |
| 54 | 3300013296 | Ga0157374_10022672 | Ga0157374_100226724 | 186 |
| 55 | 3300013297 | Ga0157378_10079130 | Ga0157378_100791302 | 186 |
| 56 | 3300013306 | Ga0163162_10253681 | Ga0163162_102536812 | 186 |
| 57 | 3300013307 | Ga0157372_10018474 | Ga0157372_100184744 | 186 |
| 58 | 3300013308 | Ga0157375_10039540 | Ga0157375_100395402 | 186 |
| 59 | 3300014968 | Ga0157379_10033116 | Ga0157379_100331163 | 186 |
| 60 | 3300014969 | Ga0157376_10026292 | Ga0157376_100262922 | 186 |
| 61 | 3300031090 | Ga0265760_10000020 | Ga0265760_1000002017 | 186 |
| 62 | 3300005435 | Ga0070714_100420624 | Ga0070714_1004206241 | 187 |
| 63 | 3300005439 | Ga0070711_100496406 | Ga0070711_1004964062 | 187 |
| 64 | 3300006028 | Ga0070717_10444175 | Ga0070717_104441752 | 187 |
| 65 | 3300013307 | Ga0157372_11035565 | Ga0157372_110355652 | 187 |
| 66 | 3300025906 | Ga0207699_10245404 | Ga0207699_102454042 | 187 |
| 67 | 3300025913 | Ga0207695_10381741 | Ga0207695_103817411 | 187 |
| 68 | 3300025928 | Ga0207700_10936253 | Ga0207700_109362531 | 187 |
| 69 | 3300025939 | Ga0207665_10847135 | Ga0207665_108471351 | 187 |
| 70 | 3300031090 | Ga0265760_10075506 | Ga0265760_100755062 | 187 |
| 71 | 3300035086 | Ga0373934_0055310 | Ga0373934_0055310_352_969 | 187 |
| 72 | 3300035120 | Ga0373957_0040371 | Ga0373957_0040371_891_1508 | 187 |
| 73 | 3300035172 | Ga0373955_0014880 | Ga0373955_0014880_1861_2478 | 187 |
| 74 | 3300035724 | Ga0373933_0001863 | Ga0373933_0001863_9704_10321 | 187 |
| 75 | 3300036401 | Ga0373937_0000001 | Ga0373937_0000001_343329_343946 | 187 |
| 76 | 3300046463 | Ga0495653_0060335 | Ga0495653_0060335_79_696 | 187 |
| 77 | 3300046529 | Ga0495652_0022463 | Ga0495652_0022463_2552_3169 | 187 |
| 78 | 3300046536 | Ga0495587_0000433 | Ga0495587_0000433_9406_10023 | 187 |
| 79 | 3300046679 | Ga0495623_0043021 | Ga0495623_0043021_964_1581 | 187 |
| 80 | 3300047317 | Ga0495604_0010097 | Ga0495604_0010097_1938_2555 | 187 |
| 81 | 3300047444 | Ga0495675_0035585 | Ga0495675_0035585_2168_2785 | 187 |
| 82 | 3300048088 | Ga0495602_0000056 | Ga0495602_0000056_9390_10007 | 187 |
| 83 | iso_pu_bacteria | 2884215851 | 2884218631 | 189 |
| 84 | 3300031548 | Ga0307408_100151187 | Ga0307408_1001511872 | 191 |
| 85 | 3300032002 | Ga0307416_100433875 | Ga0307416_1004338752 | 191 |
| 86 | 3300034816 | Ga0373930_0094866 | Ga0373930_0094866_46_627 | 191 |
| 87 | 3300037418 | Ga0395900_0356038 | Ga0395900_0356038_482_1063 | 191 |
| 88 | 3300037418 | Ga0395900_0558442 | Ga0395900_0558442_169_750 | 191 |
| 89 | 3300037471 | Ga0395905_0020273 | Ga0395905_0020273_2043_2624 | 191 |
| 90 | 3300037471 | Ga0395905_0027208 | Ga0395905_0027208_4629_5210 | 191 |
| 91 | 3300037471 | Ga0395905_0106925 | Ga0395905_0106925_2012_2593 | 191 |
| 92 | 3300038443 | Ga0395901_0594669 | Ga0395901_0594669_22_603 | 191 |
| 93 | 3300046684 | Ga0495669_0115617 | Ga0495669_0115617_165_746 | 191 |
| 94 | 3300049705 | Ga0501225_0031666 | Ga0501225_0031666_290_871 | 191 |
| 95 | 3300005435 | Ga0070714_100937253 | Ga0070714_1009372531 | 192 |
| 96 | 3300005436 | Ga0070713_100005398 | Ga0070713_1000053985 | 192 |
| 97 | 3300005436 | Ga0070713_100021670 | Ga0070713_1000216704 | 192 |
| 98 | 3300005436 | Ga0070713_100405881 | Ga0070713_1004058812 | 192 |
| 99 | 3300005518 | Ga0070699_100292263 | Ga0070699_1002922632 | 192 |
| 100 | 3300005530 | Ga0070679_100756834 | Ga0070679_1007568341 | 192 |
| 101 | 3300006914 | Ga0075436_100000175 | Ga0075436_1000001755 | 192 |
| 102 | 3300006914 | Ga0075436_100090155 | Ga0075436_1000901552 | 192 |
| 103 | 3300009093 | Ga0105240_10290921 | Ga0105240_102909211 | 192 |
| 104 | 3300009094 | Ga0111539_10747887 | Ga0111539_107478872 | 192 |
| 105 | 3300009147 | Ga0114129_10248700 | Ga0114129_102487003 | 192 |
| 106 | 3300009174 | Ga0105241_10067844 | Ga0105241_100678442 | 192 |
| 107 | 3300013105 | Ga0157369_10038801 | Ga0157369_100388015 | 192 |
| 108 | 3300013296 | Ga0157374_10869705 | Ga0157374_108697051 | 192 |
| 109 | 3300013307 | Ga0157372_10098762 | Ga0157372_100987622 | 192 |
| 110 | 3300014325 | Ga0163163_10429703 | Ga0163163_104297032 | 192 |
| 111 | 3300014968 | Ga0157379_11429221 | Ga0157379_114292211 | 192 |
| 112 | 3300025898 | Ga0207692_10031221 | Ga0207692_100312212 | 192 |
| 113 | 3300025912 | Ga0207707_10257922 | Ga0207707_102579222 | 192 |
| 114 | 3300025949 | Ga0207667_10146997 | Ga0207667_101469972 | 192 |
| 115 | 3300026078 | Ga0207702_10026955 | Ga0207702_100269552 | 192 |
| 116 | 3300031548 | Ga0307408_100016365 | Ga0307408_1000163656 | 192 |
| 117 | 3300031824 | Ga0307413_10825923 | Ga0307413_108259231 | 192 |
| 118 | 3300031852 | Ga0307410_10144096 | Ga0307410_101440961 | 192 |
| 119 | 3300031995 | Ga0307409_100004397 | Ga0307409_1000043971 | 192 |
| 120 | 3300032002 | Ga0307416_100271600 | Ga0307416_1002716003 | 192 |
| 121 | 3300032004 | Ga0307414_10591877 | Ga0307414_105918771 | 192 |
| 122 | 3300032005 | Ga0307411_10014175 | Ga0307411_100141753 | 192 |
| 123 | 3300032126 | Ga0307415_100001749 | Ga0307415_1000017494 | 192 |
| 124 | 3300035172 | Ga0373955_0314133 | Ga0373955_0314133_256_849 | 192 |
| 125 | 3300044673 | Ga0453683_0202049 | Ga0453683_0202049_114_698 | 192 |
| 126 | 3300044694 | Ga0466963_0679471 | Ga0466963_0679471_134_715 | 192 |
| 127 | 3300045051 | Ga0451576_0168278 | Ga0451576_0168278_1056_1640 | 192 |
| 128 | 3300045976 | Ga0466967_0269293 | Ga0466967_0269293_873_1454 | 192 |
| 129 | 3300046463 | Ga0495653_0524393 | Ga0495653_0524393_86_673 | 192 |
| 130 | 3300046499 | Ga0495594_0007613 | Ga0495594_0007613_1994_2581 | 192 |
| 131 | 3300046528 | Ga0495642_0118539 | Ga0495642_0118539_445_1032 | 192 |
| 132 | 3300046529 | Ga0495652_0407074 | Ga0495652_0407074_158_745 | 192 |
| 133 | 3300046535 | Ga0495586_0016780 | Ga0495586_0016780_2290_2877 | 192 |
| 134 | 3300046536 | Ga0495587_0038455 | Ga0495587_0038455_466_1053 | 192 |
| 135 | 3300046543 | Ga0495645_0013243 | Ga0495645_0013243_2660_3247 | 192 |
| 136 | 3300046616 | Ga0495668_0072291 | Ga0495668_0072291_291_878 | 192 |
| 137 | 3300046674 | Ga0495588_0074714 | Ga0495588_0074714_1131_1718 | 192 |
| 138 | 3300046675 | Ga0495657_0197083 | Ga0495657_0197083_165_752 | 192 |
| 139 | 3300046675 | Ga0495657_0317663 | Ga0495657_0317663_14_772 | 192 |
| 140 | 3300046679 | Ga0495623_0302552 | Ga0495623_0302552_199_786 | 192 |
| 141 | 3300046684 | Ga0495669_0046424 | Ga0495669_0046424_667_1254 | 192 |
| 142 | 3300046689 | Ga0495613_0291765 | Ga0495613_0291765_66_653 | 192 |
| 143 | 3300046689 | Ga0495613_0394597 | Ga0495613_0394597_282_869 | 192 |
| 144 | 3300046809 | Ga0495600_0537537 | Ga0495600_0537537_26_613 | 192 |
| 145 | 3300047444 | Ga0495675_0023972 | Ga0495675_0023972_610_1197 | 192 |
| 146 | 3300048088 | Ga0495602_0281477 | Ga0495602_0281477_613_1200 | 192 |
| 147 | 3300048908 | Ga0496105_0421188 | Ga0496105_0421188_399_986 | 192 |
| 148 | 3300048908 | Ga0496105_0552234 | Ga0496105_0552234_28_615 | 192 |
| 149 | 3300048915 | Ga0496112_0456429 | Ga0496112_0456429_448_1035 | 192 |
| 150 | 3300048916 | Ga0496113_0086343 | Ga0496113_0086343_1317_1904 | 192 |
| 151 | 3300048916 | Ga0496113_0191418 | Ga0496113_0191418_451_1038 | 192 |
| 152 | 3300048918 | Ga0496115_0685988 | Ga0496115_0685988_34_621 | 192 |
| 153 | 3300049571 | Ga0501034_0145316 | Ga0501034_0145316_1579_2166 | 192 |
| 154 | 3300049669 | Ga0501235_010391 | Ga0501235_010391_809_1393 | 192 |
| 155 | 3300049767 | Ga0501270_010597 | Ga0501270_010597_618_1202 | 192 |
| 156 | 3300050507 | nmdc:mga05p37_292254_c1 | nmdc:mga05p37_292254_c1_1083_1667 | 192 |
| 157 | 3300050514 | nmdc:mga08x19_139092_c1 | nmdc:mga08x19_139092_c1_296_877 | 192 |
| 158 | 3300050514 | nmdc:mga08x19_3200_c1 | nmdc:mga08x19_3200_c1_572_1153 | 192 |
| 159 | 3300005293 | Ga0065715_10240193 | Ga0065715_102401931 | 193 |
| 160 | 3300005327 | Ga0070658_10463608 | Ga0070658_104636082 | 193 |
| 161 | 3300005329 | Ga0070683_100017534 | Ga0070683_1000175348 | 193 |
| 162 | 3300005329 | Ga0070683_100018333 | Ga0070683_1000183337 | 193 |
| 163 | 3300005336 | Ga0070680_100005837 | Ga0070680_10000583713 | 193 |
| 164 | 3300005336 | Ga0070680_100497083 | Ga0070680_1004970831 | 193 |
| 165 | 3300005338 | Ga0068868_100002614 | Ga0068868_1000026143 | 193 |
| 166 | 3300005339 | Ga0070660_100002180 | Ga0070660_1000021802 | 193 |
| 167 | 3300005339 | Ga0070660_100355809 | Ga0070660_1003558091 | 193 |
| 168 | 3300005340 | Ga0070689_100268710 | Ga0070689_1002687103 | 193 |
| 169 | 3300005344 | Ga0070661_100067305 | Ga0070661_1000673052 | 193 |
| 170 | 3300005344 | Ga0070661_100197107 | Ga0070661_1001971071 | 193 |
| 171 | 3300005347 | Ga0070668_100486100 | Ga0070668_1004861002 | 193 |
| 172 | 3300005364 | Ga0070673_100026626 | Ga0070673_1000266262 | 193 |
| 173 | 3300005366 | Ga0070659_100034279 | Ga0070659_1000342795 | 193 |
| 174 | 3300005367 | Ga0070667_100747966 | Ga0070667_1007479662 | 193 |
| 175 | 3300005434 | Ga0070709_10045030 | Ga0070709_100450304 | 193 |
| 176 | 3300005434 | Ga0070709_10359932 | Ga0070709_103599322 | 193 |
| 177 | 3300005435 | Ga0070714_100044948 | Ga0070714_1000449482 | 193 |
| 178 | 3300005435 | Ga0070714_100264948 | Ga0070714_1002649482 | 193 |
| 179 | 3300005435 | Ga0070714_100297966 | Ga0070714_1002979663 | 193 |
| 180 | 3300005435 | Ga0070714_100819582 | Ga0070714_1008195822 | 193 |
| 181 | 3300005436 | Ga0070713_100017385 | Ga0070713_1000173858 | 193 |
| 182 | 3300005436 | Ga0070713_100093786 | Ga0070713_1000937862 | 193 |
| 183 | 3300005436 | Ga0070713_101018833 | Ga0070713_1010188331 | 193 |
| 184 | 3300005440 | Ga0070705_100277750 | Ga0070705_1002777502 | 193 |
| 185 | 3300005445 | Ga0070708_100002478 | Ga0070708_10000247813 | 193 |
| 186 | 3300005457 | Ga0070662_100090027 | Ga0070662_1000900273 | 193 |
| 187 | 3300005458 | Ga0070681_10014865 | Ga0070681_100148651 | 193 |
| 188 | 3300005458 | Ga0070681_10020326 | Ga0070681_100203263 | 193 |
| 189 | 3300005458 | Ga0070681_10022144 | Ga0070681_100221447 | 193 |
| 190 | 3300005459 | Ga0068867_100003948 | Ga0068867_1000039483 | 193 |
| 191 | 3300005530 | Ga0070679_100042315 | Ga0070679_1000423151 | 193 |
| 192 | 3300005530 | Ga0070679_100341082 | Ga0070679_1003410821 | 193 |
| 193 | 3300005535 | Ga0070684_100617637 | Ga0070684_1006176371 | 193 |
| 194 | 3300005536 | Ga0070697_100179896 | Ga0070697_1001798962 | 193 |
| 195 | 3300005539 | Ga0068853_100359177 | Ga0068853_1003591772 | 193 |
| 196 | 3300005547 | Ga0070693_100160501 | Ga0070693_1001605011 | 193 |
| 197 | 3300005548 | Ga0070665_100248502 | Ga0070665_1002485022 | 193 |
| 198 | 3300005548 | Ga0070665_100891979 | Ga0070665_1008919792 | 193 |
| 199 | 3300005563 | Ga0068855_100009456 | Ga0068855_1000094563 | 193 |
| 200 | 3300005563 | Ga0068855_100333063 | Ga0068855_1003330632 | 193 |
| 201 | 3300005564 | Ga0070664_100002061 | Ga0070664_10000206114 | 193 |
| 202 | 3300005577 | Ga0068857_100001890 | Ga0068857_1000018903 | 193 |
| 203 | 3300005577 | Ga0068857_100139948 | Ga0068857_1001399484 | 193 |
| 204 | 3300005577 | Ga0068857_100179572 | Ga0068857_1001795722 | 193 |
| 205 | 3300005578 | Ga0068854_100000866 | Ga0068854_10000086619 | 193 |
| 206 | 3300005578 | Ga0068854_100005607 | Ga0068854_1000056078 | 193 |
| 207 | 3300005614 | Ga0068856_100111870 | Ga0068856_1001118704 | 193 |
| 208 | 3300005614 | Ga0068856_100166773 | Ga0068856_1001667731 | 193 |
| 209 | 3300005617 | Ga0068859_100000418 | Ga0068859_10000041811 | 193 |
| 210 | 3300005617 | Ga0068859_100126142 | Ga0068859_1001261424 | 193 |
| 211 | 3300005618 | Ga0068864_100006714 | Ga0068864_1000067144 | 193 |
| 212 | 3300005718 | Ga0068866_10027896 | Ga0068866_100278963 | 193 |
| 213 | 3300005840 | Ga0068870_10109236 | Ga0068870_101092363 | 193 |
| 214 | 3300005841 | Ga0068863_100874231 | Ga0068863_1008742311 | 193 |
| 215 | 3300005843 | Ga0068860_100019413 | Ga0068860_1000194137 | 193 |
| 216 | 3300005843 | Ga0068860_100219507 | Ga0068860_1002195072 | 193 |
| 217 | 3300006028 | Ga0070717_10002404 | Ga0070717_1000240411 | 193 |
| 218 | 3300006028 | Ga0070717_10005064 | Ga0070717_100050644 | 193 |
| 219 | 3300006028 | Ga0070717_10010992 | Ga0070717_100109927 | 193 |
| 220 | 3300006028 | Ga0070717_10407630 | Ga0070717_104076302 | 193 |
| 221 | 3300006042 | Ga0075368_10008321 | Ga0075368_100083214 | 193 |
| 222 | 3300006042 | Ga0075368_10039209 | Ga0075368_100392092 | 193 |
| 223 | 3300006042 | Ga0075368_10067901 | Ga0075368_100679012 | 193 |
| 224 | 3300006163 | Ga0070715_10104633 | Ga0070715_101046332 | 193 |
| 225 | 3300006173 | Ga0070716_100352858 | Ga0070716_1003528582 | 193 |
| 226 | 3300006177 | Ga0075362_10160609 | Ga0075362_101606092 | 193 |
| 227 | 3300006178 | Ga0075367_10580233 | Ga0075367_105802331 | 193 |
| 228 | 3300006195 | Ga0075366_10003527 | Ga0075366_100035278 | 193 |
| 229 | 3300006237 | Ga0097621_100053049 | Ga0097621_1000530494 | 193 |
| 230 | 3300006237 | Ga0097621_100125479 | Ga0097621_1001254792 | 193 |
| 231 | 3300006237 | Ga0097621_100227312 | Ga0097621_1002273121 | 193 |
| 232 | 3300006358 | Ga0068871_100026092 | Ga0068871_1000260928 | 193 |
| 233 | 3300006852 | Ga0075433_10004588 | Ga0075433_100045881 | 193 |
| 234 | 3300006871 | Ga0075434_100000295 | Ga0075434_10000029530 | 193 |
| 235 | 3300006871 | Ga0075434_100032828 | Ga0075434_1000328283 | 193 |
| 236 | 3300006871 | Ga0075434_100342823 | Ga0075434_1003428233 | 193 |
| 237 | 3300006914 | Ga0075436_100001101 | Ga0075436_10000110117 | 193 |
| 238 | 3300006914 | Ga0075436_100005310 | Ga0075436_1000053109 | 193 |
| 239 | 3300006914 | Ga0075436_100057607 | Ga0075436_1000576072 | 193 |
| 240 | 3300006931 | Ga0097620_100000418 | Ga0097620_10000041811 | 193 |
| 241 | 3300006931 | Ga0097620_100126141 | Ga0097620_1001261412 | 193 |
| 242 | 3300007076 | Ga0075435_100000025 | Ga0075435_10000002546 | 193 |
| 243 | 3300007076 | Ga0075435_100036040 | Ga0075435_1000360403 | 193 |
| 244 | 3300007076 | Ga0075435_100039758 | Ga0075435_1000397584 | 193 |
| 245 | 3300009093 | Ga0105240_10041278 | Ga0105240_100412781 | 193 |
| 246 | 3300009093 | Ga0105240_10076981 | Ga0105240_100769813 | 193 |
| 247 | 3300009093 | Ga0105240_10108353 | Ga0105240_101083533 | 193 |
| 248 | 3300009101 | Ga0105247_10009654 | Ga0105247_100096544 | 193 |
| 249 | 3300009174 | Ga0105241_10063394 | Ga0105241_100633942 | 193 |
| 250 | 3300009176 | Ga0105242_10037701 | Ga0105242_100377011 | 193 |
| 251 | 3300009177 | Ga0105248_10078291 | Ga0105248_100782912 | 193 |
| 252 | 3300009545 | Ga0105237_10176019 | Ga0105237_101760193 | 193 |
| 253 | 3300009545 | Ga0105237_10664704 | Ga0105237_106647042 | 193 |
| 254 | 3300009551 | Ga0105238_10285501 | Ga0105238_102855011 | 193 |
| 255 | 3300009551 | Ga0105238_10411322 | Ga0105238_104113222 | 193 |
| 256 | 3300013105 | Ga0157369_10350128 | Ga0157369_103501282 | 193 |
| 257 | 3300013105 | Ga0157369_10495862 | Ga0157369_104958622 | 193 |
| 258 | 3300013105 | Ga0157369_10722062 | Ga0157369_107220622 | 193 |
| 259 | 3300013296 | Ga0157374_10000254 | Ga0157374_1000025431 | 193 |
| 260 | 3300013297 | Ga0157378_10000554 | Ga0157378_1000055415 | 193 |
| 261 | 3300013297 | Ga0157378_11524281 | Ga0157378_115242812 | 193 |
| 262 | 3300013307 | Ga0157372_10001984 | Ga0157372_1000198415 | 193 |
| 263 | 3300013307 | Ga0157372_10003830 | Ga0157372_100038303 | 193 |
| 264 | 3300013307 | Ga0157372_10015279 | Ga0157372_100152794 | 193 |
| 265 | 3300013307 | Ga0157372_10176433 | Ga0157372_101764332 | 193 |
| 266 | 3300025898 | Ga0207692_10478098 | Ga0207692_104780982 | 193 |
| 267 | 3300025898 | Ga0207692_10507679 | Ga0207692_105076791 | 193 |
| 268 | 3300025899 | Ga0207642_10008671 | Ga0207642_100086713 | 193 |
| 269 | 3300025900 | Ga0207710_10006090 | Ga0207710_100060904 | 193 |
| 270 | 3300025903 | Ga0207680_10126470 | Ga0207680_101264702 | 193 |
| 271 | 3300025904 | Ga0207647_10028240 | Ga0207647_100282404 | 193 |
| 272 | 3300025904 | Ga0207647_10189962 | Ga0207647_101899622 | 193 |
| 273 | 3300025905 | Ga0207685_10205557 | Ga0207685_102055572 | 193 |
| 274 | 3300025906 | Ga0207699_10061687 | Ga0207699_100616872 | 193 |
| 275 | 3300025907 | Ga0207645_10299494 | Ga0207645_102994942 | 193 |
| 276 | 3300025908 | Ga0207643_10087426 | Ga0207643_100874262 | 193 |
| 277 | 3300025909 | Ga0207705_10000723 | Ga0207705_1000072320 | 193 |
| 278 | 3300025911 | Ga0207654_10010946 | Ga0207654_100109464 | 193 |
| 279 | 3300025911 | Ga0207654_10042598 | Ga0207654_100425982 | 193 |
| 280 | 3300025912 | Ga0207707_10008797 | Ga0207707_100087972 | 193 |
| 281 | 3300025912 | Ga0207707_10012850 | Ga0207707_100128508 | 193 |
| 282 | 3300025913 | Ga0207695_10091543 | Ga0207695_100915432 | 193 |
| 283 | 3300025913 | Ga0207695_10154217 | Ga0207695_101542174 | 193 |
| 284 | 3300025913 | Ga0207695_10223414 | Ga0207695_102234143 | 193 |
| 285 | 3300025914 | Ga0207671_10004535 | Ga0207671_100045354 | 193 |
| 286 | 3300025914 | Ga0207671_10088142 | Ga0207671_100881421 | 193 |
| 287 | 3300025915 | Ga0207693_10009131 | Ga0207693_100091318 | 193 |
| 288 | 3300025917 | Ga0207660_10024966 | Ga0207660_100249661 | 193 |
| 289 | 3300025917 | Ga0207660_10105062 | Ga0207660_101050622 | 193 |
| 290 | 3300025919 | Ga0207657_10003667 | Ga0207657_100036674 | 193 |
| 291 | 3300025919 | Ga0207657_10012925 | Ga0207657_100129258 | 193 |
| 292 | 3300025920 | Ga0207649_10425202 | Ga0207649_104252021 | 193 |
| 293 | 3300025921 | Ga0207652_10045172 | Ga0207652_100451723 | 193 |
| 294 | 3300025921 | Ga0207652_10088087 | Ga0207652_100880872 | 193 |
| 295 | 3300025921 | Ga0207652_10118218 | Ga0207652_101182182 | 193 |
| 296 | 3300025922 | Ga0207646_10215745 | Ga0207646_102157452 | 193 |
| 297 | 3300025923 | Ga0207681_10134550 | Ga0207681_101345502 | 193 |
| 298 | 3300025924 | Ga0207694_10177493 | Ga0207694_101774932 | 193 |
| 299 | 3300025924 | Ga0207694_10391812 | Ga0207694_103918122 | 193 |
| 300 | 3300025925 | Ga0207650_10005500 | Ga0207650_100055007 | 193 |
| 301 | 3300025927 | Ga0207687_10001100 | Ga0207687_100011003 | 193 |
| 302 | 3300025928 | Ga0207700_10019942 | Ga0207700_100199426 | 193 |
| 303 | 3300025928 | Ga0207700_10136536 | Ga0207700_101365362 | 193 |
| 304 | 3300025929 | Ga0207664_10041519 | Ga0207664_100415192 | 193 |
| 305 | 3300025929 | Ga0207664_10141429 | Ga0207664_101414292 | 193 |
| 306 | 3300025929 | Ga0207664_10281554 | Ga0207664_102815543 | 193 |
| 307 | 3300025929 | Ga0207664_10917805 | Ga0207664_109178051 | 193 |
| 308 | 3300025932 | Ga0207690_10296121 | Ga0207690_102961211 | 193 |
| 309 | 3300025933 | Ga0207706_10000880 | Ga0207706_1000088025 | 193 |
| 310 | 3300025933 | Ga0207706_10094879 | Ga0207706_100948792 | 193 |
| 311 | 3300025936 | Ga0207670_10047313 | Ga0207670_100473133 | 193 |
| 312 | 3300025936 | Ga0207670_10180636 | Ga0207670_101806362 | 193 |
| 313 | 3300025937 | Ga0207669_10322540 | Ga0207669_103225401 | 193 |
| 314 | 3300025938 | Ga0207704_10204765 | Ga0207704_102047652 | 193 |
| 315 | 3300025939 | Ga0207665_10381303 | Ga0207665_103813032 | 193 |
| 316 | 3300025941 | Ga0207711_10001004 | Ga0207711_100010045 | 193 |
| 317 | 3300025942 | Ga0207689_10051957 | Ga0207689_100519571 | 193 |
| 318 | 3300025944 | Ga0207661_10193967 | Ga0207661_101939672 | 193 |
| 319 | 3300025945 | Ga0207679_10008269 | Ga0207679_100082691 | 193 |
| 320 | 3300025945 | Ga0207679_10148014 | Ga0207679_101480142 | 193 |
| 321 | 3300025949 | Ga0207667_10008905 | Ga0207667_100089053 | 193 |
| 322 | 3300025949 | Ga0207667_10012807 | Ga0207667_100128078 | 193 |
| 323 | 3300025949 | Ga0207667_10046283 | Ga0207667_100462832 | 193 |
| 324 | 3300025972 | Ga0207668_10016324 | Ga0207668_100163243 | 193 |
| 325 | 3300025981 | Ga0207640_10009050 | Ga0207640_100090506 | 193 |
| 326 | 3300025981 | Ga0207640_10010511 | Ga0207640_100105112 | 193 |
| 327 | 3300025986 | Ga0207658_10194809 | Ga0207658_101948092 | 193 |
| 328 | 3300026023 | Ga0207677_10008642 | Ga0207677_100086425 | 193 |
| 329 | 3300026023 | Ga0207677_10039324 | Ga0207677_100393241 | 193 |
| 330 | 3300026041 | Ga0207639_10887305 | Ga0207639_108873051 | 193 |
| 331 | 3300026067 | Ga0207678_10008712 | Ga0207678_100087125 | 193 |
| 332 | 3300026067 | Ga0207678_10009433 | Ga0207678_100094334 | 193 |
| 333 | 3300026075 | Ga0207708_10120793 | Ga0207708_101207932 | 193 |
| 334 | 3300026078 | Ga0207702_10118623 | Ga0207702_101186232 | 193 |
| 335 | 3300026078 | Ga0207702_10323709 | Ga0207702_103237092 | 193 |
| 336 | 3300026089 | Ga0207648_10002663 | Ga0207648_100026631 | 193 |
| 337 | 3300026089 | Ga0207648_10005754 | Ga0207648_100057544 | 193 |
| 338 | 3300026095 | Ga0207676_10098771 | Ga0207676_100987711 | 193 |
| 339 | 3300026095 | Ga0207676_10758061 | Ga0207676_107580611 | 193 |
| 340 | 3300026116 | Ga0207674_10000514 | Ga0207674_1000051425 | 193 |
| 341 | 3300026116 | Ga0207674_10002218 | Ga0207674_100022189 | 193 |
| 342 | 3300026116 | Ga0207674_10124852 | Ga0207674_101248522 | 193 |
| 343 | 3300026121 | Ga0207683_10221923 | Ga0207683_102219233 | 193 |
| 344 | 3300026142 | Ga0207698_10610651 | Ga0207698_106106512 | 193 |
| 345 | 3300027866 | Ga0209813_10039490 | Ga0209813_100394902 | 193 |
| 346 | 3300028379 | Ga0268266_10047429 | Ga0268266_100474293 | 193 |
| 347 | 3300028379 | Ga0268266_10171856 | Ga0268266_101718563 | 193 |
| 348 | 3300028381 | Ga0268264_10030574 | Ga0268264_100305742 | 193 |
| 349 | 3300028381 | Ga0268264_10434691 | Ga0268264_104346912 | 193 |
| 350 | 3300031235 | Ga0265330_10001607 | Ga0265330_100016077 | 193 |
| 351 | 3300031247 | Ga0265340_10168715 | Ga0265340_101687151 | 193 |
| 352 | 3300031711 | Ga0265314_10000920 | Ga0265314_1000092015 | 193 |
| 353 | 3300031711 | Ga0265314_10036249 | Ga0265314_100362492 | 193 |
| 354 | 3300031711 | Ga0265314_10302743 | Ga0265314_103027431 | 193 |
| 355 | 3300035091 | Ga0373951_0084832 | Ga0373951_0084832_128_709 | 193 |
| 356 | 3300035111 | Ga0373923_0098120 | Ga0373923_0098120_521_1102 | 193 |
| 357 | 3300035113 | Ga0373936_0037405 | Ga0373936_0037405_867_1448 | 193 |
| 358 | 3300035114 | Ga0373939_0039784 | Ga0373939_0039784_688_1269 | 193 |
| 359 | 3300035115 | Ga0373941_0197642 | Ga0373941_0197642_140_721 | 193 |
| 360 | 3300035121 | Ga0373960_0028999 | Ga0373960_0028999_534_1115 | 193 |
| 361 | 3300035170 | Ga0373943_0007718 | Ga0373943_0007718_2352_2933 | 193 |
| 362 | 3300035170 | Ga0373943_0225384 | Ga0373943_0225384_230_811 | 193 |
| 363 | 3300035207 | Ga0373942_0095978 | Ga0373942_0095978_23_604 | 193 |
| 364 | 3300035691 | Ga0373931_0015153 | Ga0373931_0015153_2533_3114 | 193 |
| 365 | 3300035691 | Ga0373931_0129277 | Ga0373931_0129277_391_972 | 193 |
| 366 | 3300035692 | Ga0373935_0003560 | Ga0373935_0003560_6774_7355 | 193 |
| 367 | 3300035692 | Ga0373935_0167236 | Ga0373935_0167236_64_645 | 193 |
| 368 | 3300035695 | Ga0373927_0006915 | Ga0373927_0006915_6821_7402 | 193 |
| 369 | 3300035695 | Ga0373927_0070326 | Ga0373927_0070326_476_1057 | 193 |
| 370 | 3300035724 | Ga0373933_0082901 | Ga0373933_0082901_506_1087 | 193 |
| 371 | 3300036401 | Ga0373937_0122911 | Ga0373937_0122911_1210_1791 | 193 |
| 372 | 3300037068 | Ga0373925_0261921 | Ga0373925_0261921_416_997 | 193 |
| 373 | 3300039450 | Ga0436363_0695341 | Ga0436363_0695341_38_625 | 193 |
| 374 | 3300042876 | Ga0451577_0000331 | Ga0451577_0000331_12941_13525 | 193 |
| 375 | 3300044673 | Ga0453683_0009319 | Ga0453683_0009319_4763_5347 | 193 |
| 376 | 3300044693 | Ga0466961_0497421 | Ga0466961_0497421_36_617 | 193 |
| 377 | 3300044694 | Ga0466963_0411409 | Ga0466963_0411409_273_854 | 193 |
| 378 | 3300044712 | Ga0453684_0000429 | Ga0453684_0000429_56215_56799 | 193 |
| 379 | 3300044712 | Ga0453684_1033931 | Ga0453684_1033931_59_640 | 193 |
| 380 | 3300045051 | Ga0451576_0002208 | Ga0451576_0002208_20620_21204 | 193 |
| 381 | 3300045051 | Ga0451576_0331805 | Ga0451576_0331805_919_1512 | 193 |
| 382 | 3300045051 | Ga0451576_1016494 | Ga0451576_1016494_113_694 | 193 |
| 383 | 3300045051 | Ga0451576_1577157 | Ga0451576_1577157_28_609 | 193 |
| 384 | 3300046472 | Ga0495580_0001939 | Ga0495580_0001939_3961_4542 | 193 |
| 385 | 3300046472 | Ga0495580_0007136 | Ga0495580_0007136_6981_7562 | 193 |
| 386 | 3300046472 | Ga0495580_0019097 | Ga0495580_0019097_4161_4742 | 193 |
| 387 | 3300046472 | Ga0495580_0038482 | Ga0495580_0038482_217_798 | 193 |
| 388 | 3300046473 | Ga0495582_0000976 | Ga0495582_0000976_2808_3389 | 193 |
| 389 | 3300046477 | Ga0495664_0581525 | Ga0495664_0581525_47_628 | 193 |
| 390 | 3300046517 | Ga0495630_0023613 | Ga0495630_0023613_2256_2837 | 193 |
| 391 | 3300046517 | Ga0495630_0148197 | Ga0495630_0148197_645_1226 | 193 |
| 392 | 3300046526 | Ga0495666_0147946 | Ga0495666_0147946_479_1060 | 193 |
| 393 | 3300046529 | Ga0495652_0193542 | Ga0495652_0193542_372_953 | 193 |
| 394 | 3300046531 | Ga0495665_0003216 | Ga0495665_0003216_2336_2917 | 193 |
| 395 | 3300046536 | Ga0495587_0065189 | Ga0495587_0065189_809_1390 | 193 |
| 396 | 3300046559 | Ga0495667_0098922 | Ga0495667_0098922_733_1314 | 193 |
| 397 | 3300046679 | Ga0495623_0110870 | Ga0495623_0110870_21_602 | 193 |
| 398 | 3300046679 | Ga0495623_0186837 | Ga0495623_0186837_484_1065 | 193 |
| 399 | 3300046680 | Ga0495646_0343968 | Ga0495646_0343968_117_698 | 193 |
| 400 | 3300047315 | Ga0495581_0032535 | Ga0495581_0032535_1407_1988 | 193 |
| 401 | 3300047319 | Ga0495674_0676253 | Ga0495674_0676253_58_639 | 193 |
| 402 | 3300047444 | Ga0495675_0068352 | Ga0495675_0068352_732_1313 | 193 |
| 403 | 3300048088 | Ga0495602_0021528 | Ga0495602_0021528_1852_2433 | 193 |
| 404 | 3300048088 | Ga0495602_0054926 | Ga0495602_0054926_1309_1890 | 193 |
| 405 | 3300048905 | Ga0496102_0135493 | Ga0496102_0135493_1228_1809 | 193 |
| 406 | 3300048906 | Ga0496103_0036085 | Ga0496103_0036085_550_1131 | 193 |
| 407 | 3300048907 | Ga0496104_0169064 | Ga0496104_0169064_445_1026 | 193 |
| 408 | 3300048907 | Ga0496104_0199351 | Ga0496104_0199351_186_854 | 193 |
| 409 | 3300048909 | Ga0496106_0073362 | Ga0496106_0073362_1812_2393 | 193 |
| 410 | 3300048912 | Ga0496109_1024050 | Ga0496109_1024050_13_594 | 193 |
| 411 | 3300048915 | Ga0496112_0040162 | Ga0496112_0040162_2382_2963 | 193 |
| 412 | 3300048915 | Ga0496112_0168721 | Ga0496112_0168721_1544_2125 | 193 |
| 413 | 3300048915 | Ga0496112_0785955 | Ga0496112_0785955_236_817 | 193 |
| 414 | 3300049570 | Ga0501033_0619943 | Ga0501033_0619943_89_685 | 193 |
| 415 | 3300049573 | Ga0501037_0085974 | Ga0501037_0085974_298_894 | 193 |
| 416 | 3300049581 | Ga0501047_0067889 | Ga0501047_0067889_350_946 | 193 |
| 417 | 3300049586 | Ga0501070_0353266 | Ga0501070_0353266_519_1115 | 193 |
| 418 | 3300049587 | Ga0501071_0299034 | Ga0501071_0299034_178_777 | 193 |
| 419 | 3300049589 | Ga0501073_0008916 | Ga0501073_0008916_2082_2666 | 193 |
| 420 | 3300049741 | Ga0501079_0276447 | Ga0501079_0276447_317_916 | 193 |
| 421 | 3300050489 | nmdc:mga03683_230672_c1 | nmdc:mga03683_230672_c1_161_751 | 193 |
| 422 | 3300050490 | nmdc:mga03n38_48078_c1 | nmdc:mga03n38_48078_c1_696_1286 | 193 |
| 423 | 3300050493 | nmdc:mga0k408_25943_c1 | nmdc:mga0k408_25943_c1_1250_1840 | 193 |
| 424 | 3300050495 | nmdc:mga04h51_12514_c1 | nmdc:mga04h51_12514_c1_798_1388 | 193 |
| 425 | 3300050496 | nmdc:mga07m45_12720_c1 | nmdc:mga07m45_12720_c1_3254_3844 | 193 |
| 426 | 3300050512 | nmdc:mga0n895_103_c1 | nmdc:mga0n895_103_c1_17174_17758 | 193 |
| 427 | 3300050512 | nmdc:mga0n895_366171_c1 | nmdc:mga0n895_366171_c1_392_973 | 193 |
| 428 | 3300050512 | nmdc:mga0n895_507085_c1 | nmdc:mga0n895_507085_c1_426_1007 | 193 |
| 429 | 3300050513 | nmdc:mga0rr50_27742_c1 | nmdc:mga0rr50_27742_c1_1386_1967 | 193 |
| 430 | 3300050513 | nmdc:mga0rr50_52330_c1 | nmdc:mga0rr50_52330_c1_2065_2646 | 193 |
| 431 | 3300050513 | nmdc:mga0rr50_881_c1 | nmdc:mga0rr50_881_c1_7464_8048 | 193 |
| 432 | 3300050514 | nmdc:mga08x19_49976_c1 | nmdc:mga08x19_49976_c1_833_1414 | 193 |
| 433 | 3300050514 | nmdc:mga08x19_7511_c1 | nmdc:mga08x19_7511_c1_1474_2058 | 193 |
| 434 | 3300050514 | nmdc:mga08x19_9557_c1 | nmdc:mga08x19_9557_c1_2172_2753 | 193 |
| 435 | 3300053078 | Ga0495612_0145317 | Ga0495612_0145317_28_609 | 193 |
| 436 | 3300054114 | Ga0501084_0042105 | Ga0501084_0042105_122_706 | 193 |
| 437 | 3300060353 | Ga0501082_0467300 | Ga0501082_0467300_442_1026 | 193 |
| 438 | 3300005434 | Ga0070709_10782961 | Ga0070709_107829611 | 194 |
| 439 | 3300005445 | Ga0070708_100027906 | Ga0070708_1000279064 | 194 |
| 440 | 3300005455 | Ga0070663_100102325 | Ga0070663_1001023252 | 194 |
| 441 | 3300005468 | Ga0070707_100274541 | Ga0070707_1002745413 | 194 |
| 442 | 3300005530 | Ga0070679_100473447 | Ga0070679_1004734471 | 194 |
| 443 | 3300005563 | Ga0068855_100147526 | Ga0068855_1001475263 | 194 |
| 444 | 3300005616 | Ga0068852_100127510 | Ga0068852_1001275102 | 194 |
| 445 | 3300007265 | Ga0099794_10362801 | Ga0099794_103628011 | 194 |
| 446 | 3300013105 | Ga0157369_10062504 | Ga0157369_100625042 | 194 |
| 447 | 3300014325 | Ga0163163_10223800 | Ga0163163_102238002 | 194 |
| 448 | 3300014969 | Ga0157376_10087658 | Ga0157376_100876582 | 194 |
| 449 | 3300025909 | Ga0207705_10657420 | Ga0207705_106574201 | 194 |
| 450 | 3300025922 | Ga0207646_10654400 | Ga0207646_106544001 | 194 |
| 451 | 3300025949 | Ga0207667_10072845 | Ga0207667_100728451 | 194 |
| 452 | 3300026067 | Ga0207678_10001010 | Ga0207678_100010109 | 194 |
| 453 | 3300048907 | Ga0496104_0790134 | Ga0496104_0790134_29_619 | 194 |
| 454 | 3300048917 | Ga0496114_0197514 | Ga0496114_0197514_113_703 | 194 |
| 455 | 3300049588 | Ga0501072_0387631 | Ga0501072_0387631_205_813 | 194 |
| 456 | 3300049592 | Ga0501076_0419644 | Ga0501076_0419644_449_1057 | 194 |
| 457 | 3300005293 | Ga0065715_10184495 | Ga0065715_101844952 | 195 |
| 458 | 3300005334 | Ga0068869_100002537 | Ga0068869_1000025371 | 195 |
| 459 | 3300005338 | Ga0068868_100072644 | Ga0068868_1000726442 | 195 |
| 460 | 3300005435 | Ga0070714_100059829 | Ga0070714_1000598293 | 195 |
| 461 | 3300005445 | Ga0070708_100081593 | Ga0070708_1000815932 | 195 |
| 462 | 3300005467 | Ga0070706_100025488 | Ga0070706_1000254885 | 195 |
| 463 | 3300005467 | Ga0070706_100046337 | Ga0070706_1000463372 | 195 |
| 464 | 3300005468 | Ga0070707_100207310 | Ga0070707_1002073101 | 195 |
| 465 | 3300005468 | Ga0070707_100462659 | Ga0070707_1004626591 | 195 |
| 466 | 3300005543 | Ga0070672_100158642 | Ga0070672_1001586422 | 195 |
| 467 | 3300005563 | Ga0068855_100203147 | Ga0068855_1002031472 | 195 |
| 468 | 3300005616 | Ga0068852_100164463 | Ga0068852_1001644632 | 195 |
| 469 | 3300005617 | Ga0068859_100016871 | Ga0068859_1000168713 | 195 |
| 470 | 3300005719 | Ga0068861_100083767 | Ga0068861_1000837672 | 195 |
| 471 | 3300005841 | Ga0068863_100026510 | Ga0068863_1000265102 | 195 |
| 472 | 3300005841 | Ga0068863_100099134 | Ga0068863_1000991342 | 195 |
| 473 | 3300005842 | Ga0068858_100001025 | Ga0068858_1000010254 | 195 |
| 474 | 3300005983 | Ga0081540_1140573 | Ga0081540_11405732 | 195 |
| 475 | 3300006028 | Ga0070717_10070371 | Ga0070717_100703713 | 195 |
| 476 | 3300006881 | Ga0068865_100005849 | Ga0068865_1000058494 | 195 |
| 477 | 3300006931 | Ga0097620_100016871 | Ga0097620_1000168713 | 195 |
| 478 | 3300009093 | Ga0105240_10214715 | Ga0105240_102147152 | 195 |
| 479 | 3300009098 | Ga0105245_10093699 | Ga0105245_100936992 | 195 |
| 480 | 3300009176 | Ga0105242_10139623 | Ga0105242_101396232 | 195 |
| 481 | 3300009545 | Ga0105237_10045385 | Ga0105237_100453852 | 195 |
| 482 | 3300010375 | Ga0105239_10012609 | Ga0105239_100126092 | 195 |
| 483 | 3300011119 | Ga0105246_10297511 | Ga0105246_102975112 | 195 |
| 484 | 3300013105 | Ga0157369_11267596 | Ga0157369_112675961 | 195 |
| 485 | 3300013296 | Ga0157374_10058425 | Ga0157374_100584252 | 195 |
| 486 | 3300013306 | Ga0163162_10001180 | Ga0163162_1000118023 | 195 |
| 487 | 3300013306 | Ga0163162_10499787 | Ga0163162_104997872 | 195 |
| 488 | 3300013308 | Ga0157375_10015800 | Ga0157375_100158003 | 195 |
| 489 | 3300014326 | Ga0157380_10800762 | Ga0157380_108007622 | 195 |
| 490 | 3300014968 | Ga0157379_10123908 | Ga0157379_101239083 | 195 |
| 491 | 3300014968 | Ga0157379_10136581 | Ga0157379_101365812 | 195 |
| 492 | 3300021384 | Ga0213876_10200798 | Ga0213876_102007982 | 195 |
| 493 | 3300024225 | Ga0224572_1000076 | Ga0224572_10000762 | 195 |
| 494 | 3300024227 | Ga0228598_1000540 | Ga0228598_10005402 | 195 |
| 495 | 3300025904 | Ga0207647_10006190 | Ga0207647_100061902 | 195 |
| 496 | 3300025910 | Ga0207684_10107417 | Ga0207684_101074172 | 195 |
| 497 | 3300025927 | Ga0207687_10122411 | Ga0207687_101224112 | 195 |
| 498 | 3300025929 | Ga0207664_10176617 | Ga0207664_101766172 | 195 |
| 499 | 3300025933 | Ga0207706_10336593 | Ga0207706_103365932 | 195 |
| 500 | 3300025942 | Ga0207689_10000300 | Ga0207689_1000030029 | 195 |
| 501 | 3300026023 | Ga0207677_10068035 | Ga0207677_100680352 | 195 |
| 502 | 3300026035 | Ga0207703_10003668 | Ga0207703_100036684 | 195 |
| 503 | 3300026088 | Ga0207641_10084058 | Ga0207641_100840582 | 195 |
| 504 | 3300026089 | Ga0207648_10311104 | Ga0207648_103111042 | 195 |
| 505 | 3300026118 | Ga0207675_100487967 | Ga0207675_1004879672 | 195 |
| 506 | 3300028381 | Ga0268264_10065925 | Ga0268264_100659252 | 195 |
| 507 | 3300028800 | Ga0265338_10151941 | Ga0265338_101519412 | 195 |
| 508 | 3300030878 | Ga0265770_1019314 | Ga0265770_10193142 | 195 |
| 509 | 3300031090 | Ga0265760_10000664 | Ga0265760_100006646 | 195 |
| 510 | 3300031090 | Ga0265760_10000741 | Ga0265760_100007417 | 195 |
| 511 | 3300035170 | Ga0373943_0300394 | Ga0373943_0300394_288_875 | 195 |
| 512 | 3300035725 | Ga0373947_0265658 | Ga0373947_0265658_236_823 | 195 |
| 513 | 3300039437 | Ga0436365_0979910 | Ga0436365_0979910_742_1335 | 195 |
| 514 | 3300039437 | Ga0436365_1144293 | Ga0436365_1144293_1331_1924 | 195 |
| 515 | 3300039450 | Ga0436363_1324681 | Ga0436363_1324681_1317_1913 | 195 |
| 516 | 3300045976 | Ga0466967_0312528 | Ga0466967_0312528_175_762 | 195 |
| 517 | 3300046472 | Ga0495580_0009328 | Ga0495580_0009328_3926_4513 | 195 |
| 518 | 3300048915 | Ga0496112_0000688 | Ga0496112_0000688_14798_15385 | 195 |
| 519 | 3300048917 | Ga0496114_0441930 | Ga0496114_0441930_391_978 | 195 |
| 520 | 3300049583 | Ga0501067_0503958 | Ga0501067_0503958_55_642 | 195 |
| 521 | 3300049744 | Ga0501083_0448779 | Ga0501083_0448779_195_785 | 195 |
| 522 | 3300000546 | LJNas_1000342 | LJNas_10003423 | 196 |
| 523 | 3300001976 | JGI24752J21851_1000910 | JGI24752J21851_10009104 | 196 |
| 524 | 3300002239 | JGI24034J26672_10030077 | JGI24034J26672_100300772 | 196 |
| 525 | 3300005290 | Ga0065712_10155690 | Ga0065712_101556902 | 196 |
| 526 | 3300005327 | Ga0070658_10539358 | Ga0070658_105393582 | 196 |
| 527 | 3300005328 | Ga0070676_10004984 | Ga0070676_100049843 | 196 |
| 528 | 3300005329 | Ga0070683_100000704 | Ga0070683_1000007046 | 196 |
| 529 | 3300005330 | Ga0070690_100024489 | Ga0070690_1000244892 | 196 |
| 530 | 3300005333 | Ga0070677_10053135 | Ga0070677_100531352 | 196 |
| 531 | 3300005335 | Ga0070666_10180028 | Ga0070666_101800282 | 196 |
| 532 | 3300005336 | Ga0070680_100282941 | Ga0070680_1002829411 | 196 |
| 533 | 3300005338 | Ga0068868_100129068 | Ga0068868_1001290682 | 196 |
| 534 | 3300005338 | Ga0068868_100187907 | Ga0068868_1001879072 | 196 |
| 535 | 3300005338 | Ga0068868_100430568 | Ga0068868_1004305682 | 196 |
| 536 | 3300005339 | Ga0070660_100014667 | Ga0070660_1000146673 | 196 |
| 537 | 3300005340 | Ga0070689_100013990 | Ga0070689_1000139904 | 196 |
| 538 | 3300005343 | Ga0070687_100005205 | Ga0070687_1000052054 | 196 |
| 539 | 3300005344 | Ga0070661_100045393 | Ga0070661_1000453934 | 196 |
| 540 | 3300005347 | Ga0070668_100007418 | Ga0070668_1000074184 | 196 |
| 541 | 3300005353 | Ga0070669_100064364 | Ga0070669_1000643642 | 196 |
| 542 | 3300005353 | Ga0070669_100997533 | Ga0070669_1009975331 | 196 |
| 543 | 3300005354 | Ga0070675_100043128 | Ga0070675_1000431284 | 196 |
| 544 | 3300005364 | Ga0070673_100137611 | Ga0070673_1001376113 | 196 |
| 545 | 3300005365 | Ga0070688_100008741 | Ga0070688_1000087413 | 196 |
| 546 | 3300005366 | Ga0070659_100116782 | Ga0070659_1001167823 | 196 |
| 547 | 3300005366 | Ga0070659_100181936 | Ga0070659_1001819362 | 196 |
| 548 | 3300005367 | Ga0070667_100069184 | Ga0070667_1000691842 | 196 |
| 549 | 3300005435 | Ga0070714_100000047 | Ga0070714_10000004743 | 196 |
| 550 | 3300005435 | Ga0070714_100256355 | Ga0070714_1002563553 | 196 |
| 551 | 3300005435 | Ga0070714_100588692 | Ga0070714_1005886922 | 196 |
| 552 | 3300005437 | Ga0070710_10010881 | Ga0070710_100108814 | 196 |
| 553 | 3300005439 | Ga0070711_100003811 | Ga0070711_1000038117 | 196 |
| 554 | 3300005439 | Ga0070711_100055759 | Ga0070711_1000557594 | 196 |
| 555 | 3300005439 | Ga0070711_100057805 | Ga0070711_1000578052 | 196 |
| 556 | 3300005445 | Ga0070708_100001160 | Ga0070708_1000011607 | 196 |
| 557 | 3300005445 | Ga0070708_100004782 | Ga0070708_1000047823 | 196 |
| 558 | 3300005445 | Ga0070708_100043931 | Ga0070708_1000439312 | 196 |
| 559 | 3300005455 | Ga0070663_100062577 | Ga0070663_1000625772 | 196 |
| 560 | 3300005458 | Ga0070681_10045959 | Ga0070681_100459592 | 196 |
| 561 | 3300005459 | Ga0068867_100345427 | Ga0068867_1003454272 | 196 |
| 562 | 3300005466 | Ga0070685_10069247 | Ga0070685_100692473 | 196 |
| 563 | 3300005467 | Ga0070706_100000430 | Ga0070706_10000043049 | 196 |
| 564 | 3300005467 | Ga0070706_100000710 | Ga0070706_10000071020 | 196 |
| 565 | 3300005467 | Ga0070706_100020174 | Ga0070706_1000201742 | 196 |
| 566 | 3300005468 | Ga0070707_100000607 | Ga0070707_1000006077 | 196 |
| 567 | 3300005468 | Ga0070707_100171160 | Ga0070707_1001711603 | 196 |
| 568 | 3300005468 | Ga0070707_100801266 | Ga0070707_1008012662 | 196 |
| 569 | 3300005471 | Ga0070698_100000091 | Ga0070698_10000009157 | 196 |
| 570 | 3300005471 | Ga0070698_100155391 | Ga0070698_1001553912 | 196 |
| 571 | 3300005518 | Ga0070699_100013395 | Ga0070699_1000133953 | 196 |
| 572 | 3300005518 | Ga0070699_100087304 | Ga0070699_1000873042 | 196 |
| 573 | 3300005530 | Ga0070679_100478762 | Ga0070679_1004787621 | 196 |
| 574 | 3300005530 | Ga0070679_100517902 | Ga0070679_1005179021 | 196 |
| 575 | 3300005535 | Ga0070684_100003207 | Ga0070684_1000032074 | 196 |
| 576 | 3300005535 | Ga0070684_100383253 | Ga0070684_1003832531 | 196 |
| 577 | 3300005536 | Ga0070697_100001219 | Ga0070697_10000121913 | 196 |
| 578 | 3300005536 | Ga0070697_100001461 | Ga0070697_1000014617 | 196 |
| 579 | 3300005536 | Ga0070697_100020940 | Ga0070697_1000209402 | 196 |
| 580 | 3300005536 | Ga0070697_100064481 | Ga0070697_1000644812 | 196 |
| 581 | 3300005536 | Ga0070697_100391018 | Ga0070697_1003910182 | 196 |
| 582 | 3300005536 | Ga0070697_100787639 | Ga0070697_1007876391 | 196 |
| 583 | 3300005539 | Ga0068853_100346819 | Ga0068853_1003468192 | 196 |
| 584 | 3300005543 | Ga0070672_100060922 | Ga0070672_1000609223 | 196 |
| 585 | 3300005544 | Ga0070686_100008501 | Ga0070686_1000085014 | 196 |
| 586 | 3300005547 | Ga0070693_100474877 | Ga0070693_1004748771 | 196 |
| 587 | 3300005563 | Ga0068855_100031927 | Ga0068855_1000319273 | 196 |
| 588 | 3300005578 | Ga0068854_100064803 | Ga0068854_1000648033 | 196 |
| 589 | 3300005578 | Ga0068854_100308735 | Ga0068854_1003087352 | 196 |
| 590 | 3300005614 | Ga0068856_100021283 | Ga0068856_1000212834 | 196 |
| 591 | 3300005616 | Ga0068852_100038418 | Ga0068852_1000384182 | 196 |
| 592 | 3300005617 | Ga0068859_100071137 | Ga0068859_1000711372 | 196 |
| 593 | 3300005718 | Ga0068866_10037368 | Ga0068866_100373683 | 196 |
| 594 | 3300005718 | Ga0068866_10201822 | Ga0068866_102018222 | 196 |
| 595 | 3300005719 | Ga0068861_100306472 | Ga0068861_1003064722 | 196 |
| 596 | 3300005719 | Ga0068861_100658232 | Ga0068861_1006582321 | 196 |
| 597 | 3300005834 | Ga0068851_10002042 | Ga0068851_100020425 | 196 |
| 598 | 3300005843 | Ga0068860_100054827 | Ga0068860_1000548274 | 196 |
| 599 | 3300006028 | Ga0070717_10000592 | Ga0070717_1000059222 | 196 |
| 600 | 3300006028 | Ga0070717_10211575 | Ga0070717_102115752 | 196 |
| 601 | 3300006028 | Ga0070717_10322499 | Ga0070717_103224992 | 196 |
| 602 | 3300006163 | Ga0070715_10033994 | Ga0070715_100339942 | 196 |
| 603 | 3300006163 | Ga0070715_10258998 | Ga0070715_102589981 | 196 |
| 604 | 3300006173 | Ga0070716_100004330 | Ga0070716_1000043304 | 196 |
| 605 | 3300006173 | Ga0070716_100020309 | Ga0070716_1000203094 | 196 |
| 606 | 3300006173 | Ga0070716_100377611 | Ga0070716_1003776111 | 196 |
| 607 | 3300006173 | Ga0070716_100407866 | Ga0070716_1004078661 | 196 |
| 608 | 3300006175 | Ga0070712_100000132 | Ga0070712_10000013234 | 196 |
| 609 | 3300006175 | Ga0070712_100012732 | Ga0070712_1000127325 | 196 |
| 610 | 3300006175 | Ga0070712_100064725 | Ga0070712_1000647254 | 196 |
| 611 | 3300006175 | Ga0070712_100124098 | Ga0070712_1001240982 | 196 |
| 612 | 3300006237 | Ga0097621_100000840 | Ga0097621_10000084017 | 196 |
| 613 | 3300006237 | Ga0097621_100030626 | Ga0097621_1000306263 | 196 |
| 614 | 3300006358 | Ga0068871_100017898 | Ga0068871_1000178984 | 196 |
| 615 | 3300006931 | Ga0097620_100071142 | Ga0097620_1000711422 | 196 |
| 616 | 3300007076 | Ga0075435_100046895 | Ga0075435_1000468952 | 196 |
| 617 | 3300007076 | Ga0075435_100444203 | Ga0075435_1004442031 | 196 |
| 618 | 3300009093 | Ga0105240_10020606 | Ga0105240_100206065 | 196 |
| 619 | 3300009093 | Ga0105240_10586626 | Ga0105240_105866262 | 196 |
| 620 | 3300009098 | Ga0105245_10000741 | Ga0105245_1000074123 | 196 |
| 621 | 3300009098 | Ga0105245_10012235 | Ga0105245_100122353 | 196 |
| 622 | 3300009101 | Ga0105247_10017244 | Ga0105247_100172442 | 196 |
| 623 | 3300009174 | Ga0105241_10139656 | Ga0105241_101396561 | 196 |
| 624 | 3300009176 | Ga0105242_10020694 | Ga0105242_100206944 | 196 |
| 625 | 3300009177 | Ga0105248_10022175 | Ga0105248_100221754 | 196 |
| 626 | 3300009177 | Ga0105248_10855439 | Ga0105248_108554392 | 196 |
| 627 | 3300009545 | Ga0105237_10110696 | Ga0105237_101106962 | 196 |
| 628 | 3300009545 | Ga0105237_10608632 | Ga0105237_106086322 | 196 |
| 629 | 3300010159 | Ga0099796_10023123 | Ga0099796_100231232 | 196 |
| 630 | 3300010375 | Ga0105239_10044133 | Ga0105239_100441332 | 196 |
| 631 | 3300013100 | Ga0157373_10009287 | Ga0157373_100092872 | 196 |
| 632 | 3300013102 | Ga0157371_10028747 | Ga0157371_100287473 | 196 |
| 633 | 3300013105 | Ga0157369_10542291 | Ga0157369_105422912 | 196 |
| 634 | 3300013296 | Ga0157374_10050911 | Ga0157374_100509114 | 196 |
| 635 | 3300013297 | Ga0157378_10003465 | Ga0157378_1000346510 | 196 |
| 636 | 3300013297 | Ga0157378_10238162 | Ga0157378_102381622 | 196 |
| 637 | 3300013307 | Ga0157372_10052817 | Ga0157372_100528174 | 196 |
| 638 | 3300013307 | Ga0157372_10119184 | Ga0157372_101191843 | 196 |
| 639 | 3300014326 | Ga0157380_10015217 | Ga0157380_100152172 | 196 |
| 640 | 3300014745 | Ga0157377_10002280 | Ga0157377_100022805 | 196 |
| 641 | 3300014968 | Ga0157379_10023584 | Ga0157379_100235843 | 196 |
| 642 | 3300014969 | Ga0157376_10022460 | Ga0157376_100224604 | 196 |
| 643 | 3300014969 | Ga0157376_10754716 | Ga0157376_107547162 | 196 |
| 644 | 3300015261 | Ga0182006_1116740 | Ga0182006_11167402 | 196 |
| 645 | 3300017792 | Ga0163161_10029760 | Ga0163161_100297603 | 196 |
| 646 | 3300022730 | Ga0224570_100839 | Ga0224570_1008392 | 196 |
| 647 | 3300024225 | Ga0224572_1010563 | Ga0224572_10105632 | 196 |
| 648 | 3300024225 | Ga0224572_1053580 | Ga0224572_10535801 | 196 |
| 649 | 3300024227 | Ga0228598_1030768 | Ga0228598_10307681 | 196 |
| 650 | 3300025321 | Ga0207656_10001134 | Ga0207656_100011342 | 196 |
| 651 | 3300025893 | Ga0207682_10046546 | Ga0207682_100465462 | 196 |
| 652 | 3300025898 | Ga0207692_10040352 | Ga0207692_100403522 | 196 |
| 653 | 3300025898 | Ga0207692_10056291 | Ga0207692_100562913 | 196 |
| 654 | 3300025899 | Ga0207642_10420757 | Ga0207642_104207571 | 196 |
| 655 | 3300025901 | Ga0207688_10006430 | Ga0207688_100064306 | 196 |
| 656 | 3300025903 | Ga0207680_10047873 | Ga0207680_100478732 | 196 |
| 657 | 3300025904 | Ga0207647_10015515 | Ga0207647_100155152 | 196 |
| 658 | 3300025905 | Ga0207685_10259791 | Ga0207685_102597911 | 196 |
| 659 | 3300025906 | Ga0207699_10035039 | Ga0207699_100350392 | 196 |
| 660 | 3300025907 | Ga0207645_10003011 | Ga0207645_100030119 | 196 |
| 661 | 3300025908 | Ga0207643_10104823 | Ga0207643_101048232 | 196 |
| 662 | 3300025910 | Ga0207684_10000383 | Ga0207684_100003836 | 196 |
| 663 | 3300025910 | Ga0207684_10003824 | Ga0207684_1000382411 | 196 |
| 664 | 3300025910 | Ga0207684_10032595 | Ga0207684_100325955 | 196 |
| 665 | 3300025912 | Ga0207707_10043693 | Ga0207707_100436931 | 196 |
| 666 | 3300025913 | Ga0207695_10081298 | Ga0207695_100812982 | 196 |
| 667 | 3300025915 | Ga0207693_10001889 | Ga0207693_100018893 | 196 |
| 668 | 3300025915 | Ga0207693_10004669 | Ga0207693_1000466912 | 196 |
| 669 | 3300025915 | Ga0207693_10013125 | Ga0207693_100131255 | 196 |
| 670 | 3300025915 | Ga0207693_10174255 | Ga0207693_101742552 | 196 |
| 671 | 3300025916 | Ga0207663_10043419 | Ga0207663_100434194 | 196 |
| 672 | 3300025916 | Ga0207663_10056071 | Ga0207663_100560712 | 196 |
| 673 | 3300025916 | Ga0207663_10084573 | Ga0207663_100845732 | 196 |
| 674 | 3300025916 | Ga0207663_10097572 | Ga0207663_100975722 | 196 |
| 675 | 3300025916 | Ga0207663_10194318 | Ga0207663_101943183 | 196 |
| 676 | 3300025919 | Ga0207657_10007212 | Ga0207657_1000721210 | 196 |
| 677 | 3300025920 | Ga0207649_10002381 | Ga0207649_100023814 | 196 |
| 678 | 3300025921 | Ga0207652_10595484 | Ga0207652_105954842 | 196 |
| 679 | 3300025922 | Ga0207646_10000229 | Ga0207646_1000022921 | 196 |
| 680 | 3300025922 | Ga0207646_10177886 | Ga0207646_101778863 | 196 |
| 681 | 3300025923 | Ga0207681_10066782 | Ga0207681_100667822 | 196 |
| 682 | 3300025925 | Ga0207650_10001413 | Ga0207650_1000141311 | 196 |
| 683 | 3300025926 | Ga0207659_10018944 | Ga0207659_100189443 | 196 |
| 684 | 3300025927 | Ga0207687_10072265 | Ga0207687_100722652 | 196 |
| 685 | 3300025928 | Ga0207700_10160412 | Ga0207700_101604123 | 196 |
| 686 | 3300025929 | Ga0207664_10000076 | Ga0207664_1000007614 | 196 |
| 687 | 3300025929 | Ga0207664_10261413 | Ga0207664_102614132 | 196 |
| 688 | 3300025929 | Ga0207664_10641119 | Ga0207664_106411192 | 196 |
| 689 | 3300025929 | Ga0207664_10703356 | Ga0207664_107033562 | 196 |
| 690 | 3300025932 | Ga0207690_10020615 | Ga0207690_100206153 | 196 |
| 691 | 3300025933 | Ga0207706_10000790 | Ga0207706_1000079027 | 196 |
| 692 | 3300025934 | Ga0207686_10035930 | Ga0207686_100359302 | 196 |
| 693 | 3300025936 | Ga0207670_10005022 | Ga0207670_100050225 | 196 |
| 694 | 3300025939 | Ga0207665_10000085 | Ga0207665_1000008551 | 196 |
| 695 | 3300025939 | Ga0207665_10030051 | Ga0207665_100300512 | 196 |
| 696 | 3300025939 | Ga0207665_10050444 | Ga0207665_100504442 | 196 |
| 697 | 3300025939 | Ga0207665_10080110 | Ga0207665_100801101 | 196 |
| 698 | 3300025939 | Ga0207665_10091791 | Ga0207665_100917912 | 196 |
| 699 | 3300025939 | Ga0207665_10101498 | Ga0207665_101014982 | 196 |
| 700 | 3300025939 | Ga0207665_10192209 | Ga0207665_101922092 | 196 |
| 701 | 3300025939 | Ga0207665_10272479 | Ga0207665_102724792 | 196 |
| 702 | 3300025940 | Ga0207691_10001778 | Ga0207691_1000177811 | 196 |
| 703 | 3300025941 | Ga0207711_10089923 | Ga0207711_100899232 | 196 |
| 704 | 3300025941 | Ga0207711_10098663 | Ga0207711_100986632 | 196 |
| 705 | 3300025942 | Ga0207689_10006573 | Ga0207689_100065736 | 196 |
| 706 | 3300025944 | Ga0207661_10000720 | Ga0207661_100007202 | 196 |
| 707 | 3300025945 | Ga0207679_10000359 | Ga0207679_1000035911 | 196 |
| 708 | 3300025960 | Ga0207651_10060678 | Ga0207651_100606783 | 196 |
| 709 | 3300025960 | Ga0207651_10083894 | Ga0207651_100838942 | 196 |
| 710 | 3300025981 | Ga0207640_10067752 | Ga0207640_100677522 | 196 |
| 711 | 3300025986 | Ga0207658_10084780 | Ga0207658_100847802 | 196 |
| 712 | 3300025986 | Ga0207658_10231070 | Ga0207658_102310702 | 196 |
| 713 | 3300026023 | Ga0207677_10080754 | Ga0207677_100807542 | 196 |
| 714 | 3300026067 | Ga0207678_10000498 | Ga0207678_100004989 | 196 |
| 715 | 3300026075 | Ga0207708_10115810 | Ga0207708_101158102 | 196 |
| 716 | 3300026078 | Ga0207702_10014378 | Ga0207702_100143782 | 196 |
| 717 | 3300026078 | Ga0207702_10225798 | Ga0207702_102257982 | 196 |
| 718 | 3300026088 | Ga0207641_10000147 | Ga0207641_10000147100 | 196 |
| 719 | 3300026089 | Ga0207648_10001035 | Ga0207648_100010352 | 196 |
| 720 | 3300026089 | Ga0207648_10451093 | Ga0207648_104510932 | 196 |
| 721 | 3300026095 | Ga0207676_10001035 | Ga0207676_1000103510 | 196 |
| 722 | 3300026116 | Ga0207674_10000432 | Ga0207674_1000043243 | 196 |
| 723 | 3300026116 | Ga0207674_10046839 | Ga0207674_100468393 | 196 |
| 724 | 3300026118 | Ga0207675_100044794 | Ga0207675_1000447941 | 196 |
| 725 | 3300026142 | Ga0207698_10874448 | Ga0207698_108744481 | 196 |
| 726 | 3300028017 | Ga0265356_1001311 | Ga0265356_10013114 | 196 |
| 727 | 3300028380 | Ga0268265_10039285 | Ga0268265_100392854 | 196 |
| 728 | 3300028381 | Ga0268264_10034688 | Ga0268264_100346883 | 196 |
| 729 | 3300028381 | Ga0268264_10087408 | Ga0268264_100874082 | 196 |
| 730 | 3300028800 | Ga0265338_10021209 | Ga0265338_100212094 | 196 |
| 731 | 3300030760 | Ga0265762_1000668 | Ga0265762_10006682 | 196 |
| 732 | 3300030760 | Ga0265762_1003454 | Ga0265762_10034542 | 196 |
| 733 | 3300030878 | Ga0265770_1001315 | Ga0265770_10013152 | 196 |
| 734 | 3300030879 | Ga0265765_1000051 | Ga0265765_10000515 | 196 |
| 735 | 3300031090 | Ga0265760_10006543 | Ga0265760_100065433 | 196 |
| 736 | 3300031090 | Ga0265760_10007699 | Ga0265760_100076992 | 196 |
| 737 | 3300031090 | Ga0265760_10082693 | Ga0265760_100826932 | 196 |
| 738 | 3300031249 | Ga0265339_10048893 | Ga0265339_100488932 | 196 |
| 739 | 3300031249 | Ga0265339_10199481 | Ga0265339_101994811 | 196 |
| 740 | 3300031344 | Ga0265316_10005890 | Ga0265316_100058903 | 196 |
| 741 | 3300031344 | Ga0265316_10181639 | Ga0265316_101816391 | 196 |
| 742 | 3300031711 | Ga0265314_10043074 | Ga0265314_100430742 | 196 |
| 743 | 3300035086 | Ga0373934_0004450 | Ga0373934_0004450_129_719 | 196 |
| 744 | 3300035111 | Ga0373923_0010879 | Ga0373923_0010879_775_1365 | 196 |
| 745 | 3300035111 | Ga0373923_0108802 | Ga0373923_0108802_440_1030 | 196 |
| 746 | 3300035113 | Ga0373936_0078030 | Ga0373936_0078030_320_910 | 196 |
| 747 | 3300035116 | Ga0373945_0001902 | Ga0373945_0001902_1655_2245 | 196 |
| 748 | 3300035119 | Ga0373956_0041590 | Ga0373956_0041590_1262_1852 | 196 |
| 749 | 3300035170 | Ga0373943_0000480 | Ga0373943_0000480_12754_13344 | 196 |
| 750 | 3300035170 | Ga0373943_0359292 | Ga0373943_0359292_64_654 | 196 |
| 751 | 3300035171 | Ga0373946_0006365 | Ga0373946_0006365_3162_3752 | 196 |
| 752 | 3300035172 | Ga0373955_0217433 | Ga0373955_0217433_436_1026 | 196 |
| 753 | 3300035172 | Ga0373955_0417008 | Ga0373955_0417008_148_738 | 196 |
| 754 | 3300035410 | Ga0373924_0005123 | Ga0373924_0005123_2006_2596 | 196 |
| 755 | 3300035410 | Ga0373924_0099101 | Ga0373924_0099101_141_731 | 196 |
| 756 | 3300035691 | Ga0373931_0232630 | Ga0373931_0232630_265_855 | 196 |
| 757 | 3300035692 | Ga0373935_0000474 | Ga0373935_0000474_2101_2691 | 196 |
| 758 | 3300035692 | Ga0373935_0089675 | Ga0373935_0089675_842_1432 | 196 |
| 759 | 3300035695 | Ga0373927_0000433 | Ga0373927_0000433_29520_30110 | 196 |
| 760 | 3300035695 | Ga0373927_0442217 | Ga0373927_0442217_74_664 | 196 |
| 761 | 3300035724 | Ga0373933_0021611 | Ga0373933_0021611_701_1291 | 196 |
| 762 | 3300035724 | Ga0373933_0022965 | Ga0373933_0022965_2733_3323 | 196 |
| 763 | 3300035724 | Ga0373933_0038036 | Ga0373933_0038036_1997_2587 | 196 |
| 764 | 3300035725 | Ga0373947_0000115 | Ga0373947_0000115_37951_38541 | 196 |
| 765 | 3300035725 | Ga0373947_0231523 | Ga0373947_0231523_54_716 | 196 |
| 766 | 3300036401 | Ga0373937_0020629 | Ga0373937_0020629_1705_2295 | 196 |
| 767 | 3300036401 | Ga0373937_0034114 | Ga0373937_0034114_3842_4432 | 196 |
| 768 | 3300036401 | Ga0373937_0408020 | Ga0373937_0408020_629_1219 | 196 |
| 769 | 3300036401 | Ga0373937_0564829 | Ga0373937_0564829_444_1034 | 196 |
| 770 | 3300037068 | Ga0373925_0001531 | Ga0373925_0001531_11645_12235 | 196 |
| 771 | 3300037068 | Ga0373925_0172517 | Ga0373925_0172517_115_705 | 196 |
| 772 | 3300037068 | Ga0373925_0367561 | Ga0373925_0367561_83_676 | 196 |
| 773 | 3300039450 | Ga0436363_1227896 | Ga0436363_1227896_27_623 | 196 |
| 774 | 3300046463 | Ga0495653_0125339 | Ga0495653_0125339_828_1418 | 196 |
| 775 | 3300046472 | Ga0495580_0001849 | Ga0495580_0001849_14259_14849 | 196 |
| 776 | 3300046472 | Ga0495580_0007791 | Ga0495580_0007791_197_787 | 196 |
| 777 | 3300046472 | Ga0495580_0020786 | Ga0495580_0020786_62_652 | 196 |
| 778 | 3300046472 | Ga0495580_0039958 | Ga0495580_0039958_2002_2664 | 196 |
| 779 | 3300046472 | Ga0495580_0145825 | Ga0495580_0145825_148_738 | 196 |
| 780 | 3300046516 | Ga0495628_0050370 | Ga0495628_0050370_2172_2762 | 196 |
| 781 | 3300046517 | Ga0495630_0424309 | Ga0495630_0424309_305_895 | 196 |
| 782 | 3300046684 | Ga0495669_0085838 | Ga0495669_0085838_758_1348 | 196 |
| 783 | 3300046690 | Ga0495624_0016490 | Ga0495624_0016490_662_1252 | 196 |
| 784 | 3300047319 | Ga0495674_0009335 | Ga0495674_0009335_3018_3608 | 196 |
| 785 | 3300048088 | Ga0495602_0143881 | Ga0495602_0143881_42_632 | 196 |
| 786 | 3300048903 | Ga0496100_0208809 | Ga0496100_0208809_759_1349 | 196 |
| 787 | 3300048904 | Ga0496101_0099388 | Ga0496101_0099388_1448_2038 | 196 |
| 788 | 3300048904 | Ga0496101_0270422 | Ga0496101_0270422_571_1161 | 196 |
| 789 | 3300048905 | Ga0496102_0001511 | Ga0496102_0001511_9293_9883 | 196 |
| 790 | 3300048905 | Ga0496102_0212551 | Ga0496102_0212551_1177_1767 | 196 |
| 791 | 3300048906 | Ga0496103_0001097 | Ga0496103_0001097_148_738 | 196 |
| 792 | 3300048907 | Ga0496104_0083719 | Ga0496104_0083719_93_683 | 196 |
| 793 | 3300048907 | Ga0496104_0202299 | Ga0496104_0202299_1231_1824 | 196 |
| 794 | 3300048908 | Ga0496105_0047541 | Ga0496105_0047541_121_711 | 196 |
| 795 | 3300048909 | Ga0496106_0065595 | Ga0496106_0065595_960_1553 | 196 |
| 796 | 3300048910 | Ga0496107_0067487 | Ga0496107_0067487_1913_2503 | 196 |
| 797 | 3300048911 | Ga0496108_0000051 | Ga0496108_0000051_61042_61635 | 196 |
| 798 | 3300048912 | Ga0496109_0000105 | Ga0496109_0000105_8372_8965 | 196 |
| 799 | 3300048913 | Ga0496110_0000138 | Ga0496110_0000138_40932_41525 | 196 |
| 800 | 3300048914 | Ga0496111_0128235 | Ga0496111_0128235_1089_1682 | 196 |
| 801 | 3300048915 | Ga0496112_0003243 | Ga0496112_0003243_4439_5032 | 196 |
| 802 | 3300048916 | Ga0496113_0000499 | Ga0496113_0000499_10322_10915 | 196 |
| 803 | 3300050512 | nmdc:mga0n895_7372_c1 | nmdc:mga0n895_7372_c1_7047_7637 | 196 |
| 804 | 3300050513 | nmdc:mga0rr50_71074_c1 | nmdc:mga0rr50_71074_c1_1409_1999 | 196 |
| 805 | 3300050515 | nmdc:mga0a205_835528_c1 | nmdc:mga0a205_835528_c1_98_688 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zte-assembly1.cif.gz_A | mtruva form iv | 0.9772 | 1 | 132 |
| 1d8l-assembly1.cif.gz_A | e. coli holliday junction binding protein ruva nh2 region lacking domain iii | 0.976 | 1 | 131 |
| 7pbu-assembly1.cif.gz_F | ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] | 0.9663 | 1 | 131 |
| 7x7q-assembly1.cif.gz_G | cryoem structure of ruva-ruvb-holliday junction complex | 0.9613 | 1 | 132 |
| 2zte-assembly1.cif.gz_A | mtruva form iv | 0.9557 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1d8lB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9805 | 1 | 65 | 2.40.50.140 |
| 2h5xB02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9768 | 67 | 132 | 1.10.150.20 |
| 2zteA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9754 | 65 | 132 | 1.10.150.20 |
| 2h5xD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.972 | 67 | 133 | 1.10.150.20 |
| 1bvsA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9702 | 68 | 131 | 1.10.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9B6I0-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.995 | 1 | 86 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A7W1I2A7-F1-model_v4 | Holliday junction branch migration protein RuvA (EC 3.6.4.12) | 0.9922 | 1 | 120 |
GO:0003677
GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 GO:0016787 GO:0036121 GO:0061749 GO:1990518 |
| AF-A0A7V5H7S1-F1-model_v4 | deleted | 0.9899 | 1 | 101 |
|
| AF-A0A358XVD5-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.9898 | 1 | 62 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A7W1KT27-F1-model_v4 | Holliday junction branch migration protein RuvA | 0.9875 | 1 | 86 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar