F481600

General Info

Members Datasets Scaffolds Average Seq Length
805 313 804 196

Family's Representative Sequence

Representative Sequence 3300024225|Ga0224572_1000076|Ga0224572_10000762
Length 233
Sequence MQPTAQAMGKTHDNTLAPAGRKVIRETQLSSSSYNVRSMIAHLRGKLLAKHPNQAIVETAGVGYDVTITIPTFSDLPNPGNEVALHIHTHVREDQIALYGFLRPAEKQLFEKLITVSGIGPKLAITILSGMPADEMVGAIRHNDIARLTRIPGIGKKTAERMVLELRDKLPPAGAETPVAPTMTAMEEDVLSALVNLGYQRPAAERALAQAAKNGKEESFEALFRNTLAALAK

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
297 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.49
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 4.47
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000342 3300000546 Bacteria 8182
2 JGI24752J21851_1000910 3300001976 Bacteria 4026
3 JGI24034J26672_10030077 3300002239 Unclassified 881
4 Ga0065712_10155690 3300005290 Bacteria 1330
5 Ga0065715_10184495 3300005293 Bacteria 1454
6 Ga0065715_10240193 3300005293 Bacteria 1202
7 Ga0070658_10463608 3300005327 Bacteria 1092
8 Ga0070658_10539358 3300005327 Bacteria 1009
9 Ga0070676_10004984 3300005328 Bacteria 7030
10 Ga0070676_10008222 3300005328 Bacteria 5617
11 Ga0070683_100000704 3300005329 Bacteria 24281
12 Ga0070683_100017534 3300005329 Bacteria 6329
13 Ga0070683_100018333 3300005329 Bacteria 6197
14 Ga0070690_100024489 3300005330 Unclassified 3710
15 Ga0070690_100120734 3300005330 Bacteria 1759
16 Ga0070677_10053135 3300005333 Unclassified 1646
17 Ga0068869_100002537 3300005334 Bacteria 11022
18 Ga0070666_10100199 3300005335 Bacteria 1995
19 Ga0070666_10180028 3300005335 Unclassified 1482
20 Ga0070680_100005837 3300005336 Bacteria 9342
21 Ga0070680_100164109 3300005336 Bacteria 1867
22 Ga0070680_100282941 3300005336 Bacteria 1405
23 Ga0070680_100497083 3300005336 Bacteria 1043
24 Ga0068868_100002614 3300005338 Bacteria 12491
25 Ga0068868_100020227 3300005338 Bacteria 4997
26 Ga0068868_100072644 3300005338 Unclassified 2745
27 Ga0068868_100129068 3300005338 Unclassified 2067
28 Ga0068868_100187907 3300005338 Bacteria 1717
29 Ga0068868_100430568 3300005338 Bacteria 1144
30 Ga0070660_100002180 3300005339 Bacteria 13501
31 Ga0070660_100014667 3300005339 Bacteria 5653
32 Ga0070660_100112287 3300005339 Bacteria 2169
33 Ga0070660_100355809 3300005339 Bacteria 1206
34 Ga0070689_100013990 3300005340 Bacteria 5822
35 Ga0070689_100268710 3300005340 Bacteria 1411
36 Ga0070687_100005205 3300005343 Bacteria 5250
37 Ga0070661_100045393 3300005344 Bacteria 3212
38 Ga0070661_100067305 3300005344 Bacteria 2632
39 Ga0070661_100170097 3300005344 Bacteria 1654
40 Ga0070661_100197107 3300005344 Bacteria 1537
41 Ga0070668_100007418 3300005347 Bacteria 8138
42 Ga0070668_100102469 3300005347 Bacteria 2270
43 Ga0070668_100486100 3300005347 Bacteria 1067
44 Ga0070669_100064364 3300005353 Unclassified 2700
45 Ga0070669_100997533 3300005353 Bacteria 718
46 Ga0070675_100043128 3300005354 Unclassified 3685
47 Ga0070673_100026626 3300005364 Bacteria 4274
48 Ga0070673_100137611 3300005364 Bacteria 2057
49 Ga0070688_100008741 3300005365 Bacteria 5507
50 Ga0070659_100034279 3300005366 Bacteria 3948
51 Ga0070659_100084160 3300005366 Bacteria 2543
52 Ga0070659_100116782 3300005366 Unclassified 2157
53 Ga0070659_100181936 3300005366 Bacteria 1725
54 Ga0070667_100069184 3300005367 Unclassified 3004
55 Ga0070667_100120440 3300005367 Bacteria 2282
56 Ga0070667_100747966 3300005367 Bacteria 906
57 Ga0070709_10045030 3300005434 Viruses 2736
58 Ga0070709_10359932 3300005434 Bacteria 1077
59 Ga0070709_10782961 3300005434 Bacteria 747
60 Ga0070714_100000047 3300005435 Bacteria 112707
61 Ga0070714_100044948 3300005435 Bacteria 3741
62 Ga0070714_100059829 3300005435 Unclassified 3267
63 Ga0070714_100256355 3300005435 Bacteria 1619
64 Ga0070714_100264948 3300005435 Bacteria 1592
65 Ga0070714_100297966 3300005435 Bacteria 1502
66 Ga0070714_100420624 3300005435 Bacteria 1266
67 Ga0070714_100588692 3300005435 Unclassified 1067
68 Ga0070714_100819582 3300005435 Bacteria 902
69 Ga0070714_100937253 3300005435 Bacteria 841
70 Ga0070713_100005398 3300005436 Bacteria 8732
71 Ga0070713_100017385 3300005436 Bacteria 5437
72 Ga0070713_100021670 3300005436 Bacteria 4949
73 Ga0070713_100093786 3300005436 Bacteria 2587
74 Ga0070713_100405881 3300005436 Bacteria 1273
75 Ga0070713_101018833 3300005436 Bacteria 799
76 Ga0070710_10010881 3300005437 Unclassified 4480
77 Ga0070710_10418170 3300005437 Unclassified 902
78 Ga0070711_100003811 3300005439 Bacteria 8854
79 Ga0070711_100055759 3300005439 Unclassified 2731
80 Ga0070711_100057805 3300005439 Bacteria 2687
81 Ga0070711_100496406 3300005439 Unclassified 1006
82 Ga0070705_100263388 3300005440 Bacteria 1217
83 Ga0070705_100277750 3300005440 Bacteria 1189
84 Ga0070700_100092015 3300005441 Bacteria 1981
85 Ga0070708_100001160 3300005445 Bacteria 20288
86 Ga0070708_100002478 3300005445 Bacteria 14259
87 Ga0070708_100004782 3300005445 Bacteria 10675
88 Ga0070708_100027906 3300005445 Bacteria 4850
89 Ga0070708_100043931 3300005445 Bacteria 3928
90 Ga0070708_100081593 3300005445 Plasmid 2928
91 Ga0070663_100006657 3300005455 Bacteria 6967
92 Ga0070663_100062577 3300005455 Unclassified 2683
93 Ga0070663_100102325 3300005455 Bacteria 2139
94 Ga0070662_100001840 3300005457 Bacteria 12997
95 Ga0070662_100090027 3300005457 Bacteria 2302
96 Ga0070681_10014865 3300005458 Bacteria 7739
97 Ga0070681_10020326 3300005458 Bacteria 6654
98 Ga0070681_10022144 3300005458 Bacteria 6378
99 Ga0070681_10045959 3300005458 Bacteria 4366
100 Ga0068867_100003948 3300005459 Bacteria 10433
101 Ga0068867_100027341 3300005459 Bacteria 4098
102 Ga0068867_100345427 3300005459 Bacteria 1240
103 Ga0070685_10069247 3300005466 Unclassified 2086
104 Ga0070706_100000430 3300005467 Bacteria 50312
105 Ga0070706_100000710 3300005467 Bacteria 37432
106 Ga0070706_100020174 3300005467 Bacteria 6141
107 Ga0070706_100025488 3300005467 Bacteria 5443
108 Ga0070706_100046337 3300005467 Bacteria 4014
109 Ga0070707_100000607 3300005468 Bacteria 36047
110 Ga0070707_100148036 3300005468 Bacteria 2285
111 Ga0070707_100171160 3300005468 Bacteria 2116
112 Ga0070707_100207310 3300005468 Bacteria 1911
113 Ga0070707_100274541 3300005468 Bacteria 1639
114 Ga0070707_100462659 3300005468 Bacteria 1229
115 Ga0070707_100801266 3300005468 Bacteria 906
116 Ga0070698_100000091 3300005471 Bacteria 71604
117 Ga0070698_100155391 3300005471 Unclassified 2233
118 Ga0070699_100013395 3300005518 Bacteria 7066
119 Ga0070699_100087304 3300005518 Bacteria 2723
120 Ga0070699_100292263 3300005518 Bacteria 1461
121 Ga0070679_100042315 3300005530 Unclassified 4536
122 Ga0070679_100107507 3300005530 Bacteria 2775
123 Ga0070679_100341082 3300005530 Bacteria 1446
124 Ga0070679_100473447 3300005530 Bacteria 1197
125 Ga0070679_100478762 3300005530 Bacteria 1189
126 Ga0070679_100517902 3300005530 Unclassified 1137
127 Ga0070679_100756834 3300005530 Unclassified 914
128 Ga0070684_100003207 3300005535 Bacteria 12234
129 Ga0070684_100003777 3300005535 Bacteria 11430
130 Ga0070684_100383253 3300005535 Unclassified 1295
131 Ga0070684_100617637 3300005535 Bacteria 1008
132 Ga0070697_100001219 3300005536 Bacteria 19410
133 Ga0070697_100001461 3300005536 Bacteria 18005
134 Ga0070697_100020940 3300005536 Bacteria 5176
135 Ga0070697_100064481 3300005536 Bacteria 2992
136 Ga0070697_100179896 3300005536 Unclassified 1792
137 Ga0070697_100391018 3300005536 Bacteria 1206
138 Ga0070697_100787639 3300005536 Bacteria 841
139 Ga0068853_100274324 3300005539 Bacteria 1553
140 Ga0068853_100346819 3300005539 Bacteria 1380
141 Ga0068853_100359177 3300005539 Bacteria 1356
142 Ga0070672_100060922 3300005543 Unclassified 2973
143 Ga0070672_100158642 3300005543 Bacteria 1875
144 Ga0070686_100008501 3300005544 Bacteria 5749
145 Ga0070686_100015652 3300005544 Bacteria 4400
146 Ga0070693_100157563 3300005547 Bacteria 1443
147 Ga0070693_100160501 3300005547 Bacteria 1431
148 Ga0070693_100474877 3300005547 Bacteria 882
149 Ga0070665_100004447 3300005548 Bacteria 14722
150 Ga0070665_100248502 3300005548 Bacteria 1779
151 Ga0070665_100891979 3300005548 Bacteria 902
152 Ga0068855_100009456 3300005563 Bacteria 11778
153 Ga0068855_100031927 3300005563 Bacteria 6286
154 Ga0068855_100147526 3300005563 Bacteria 2677
155 Ga0068855_100153482 3300005563 Bacteria 2617
156 Ga0068855_100203147 3300005563 Bacteria 2230
157 Ga0068855_100333063 3300005563 Bacteria 1675
158 Ga0070664_100002061 3300005564 Bacteria 16056
159 Ga0070664_100007016 3300005564 Bacteria 9091
160 Ga0068857_100001890 3300005577 Bacteria 16879
161 Ga0068857_100139948 3300005577 Bacteria 2187
162 Ga0068857_100167457 3300005577 Bacteria 1996
163 Ga0068857_100179572 3300005577 Bacteria 1926
164 Ga0068854_100000866 3300005578 Bacteria 18145
165 Ga0068854_100005607 3300005578 Bacteria 7933
166 Ga0068854_100015075 3300005578 Bacteria 5110
167 Ga0068854_100064803 3300005578 Bacteria 2655
168 Ga0068854_100308735 3300005578 Bacteria 1282
169 Ga0068856_100021283 3300005614 Bacteria 6300
170 Ga0068856_100071560 3300005614 Bacteria 3433
171 Ga0068856_100111870 3300005614 Unclassified 2728
172 Ga0068856_100166773 3300005614 Unclassified 2213
173 Ga0068852_100038418 3300005616 Unclassified 4023
174 Ga0068852_100127510 3300005616 Bacteria 2339
175 Ga0068852_100164463 3300005616 Bacteria 2075
176 Ga0068859_100000418 3300005617 Bacteria 42477
177 Ga0068859_100016871 3300005617 Bacteria 7330
178 Ga0068859_100022181 3300005617 Bacteria 6366
179 Ga0068859_100071137 3300005617 Unclassified 3514
180 Ga0068859_100126142 3300005617 Bacteria 2629
181 Ga0068864_100006714 3300005618 Bacteria 9427
182 Ga0068864_100130421 3300005618 Bacteria 2257
183 Ga0068866_10027896 3300005718 Bacteria 2685
184 Ga0068866_10037368 3300005718 Bacteria 2384
185 Ga0068866_10072406 3300005718 Bacteria 1826
186 Ga0068866_10201822 3300005718 Bacteria 1189
187 Ga0068861_100083767 3300005719 Bacteria 2502
188 Ga0068861_100306472 3300005719 Bacteria 1378
189 Ga0068861_100658232 3300005719 Bacteria 968
190 Ga0068851_10002042 3300005834 Bacteria 8905
191 Ga0068851_10033133 3300005834 Bacteria 2574
192 Ga0068870_10109236 3300005840 Bacteria 1576
193 Ga0068870_10174904 3300005840 Bacteria 1284
194 Ga0068863_100026510 3300005841 Bacteria 5528
195 Ga0068863_100099134 3300005841 Bacteria 2768
196 Ga0068863_100874231 3300005841 Bacteria 898
197 Ga0068858_100001025 3300005842 Bacteria 28816
198 Ga0068858_100446202 3300005842 Bacteria 1246
199 Ga0068860_100019413 3300005843 Bacteria 6593
200 Ga0068860_100054827 3300005843 Bacteria 3789
201 Ga0068860_100219507 3300005843 Bacteria 1846
202 Ga0068860_100332493 3300005843 Bacteria 1492
203 Ga0068862_100008956 3300005844 Bacteria 8285
204 Ga0081540_1140573 3300005983 Unclassified 970
205 Ga0070717_10000592 3300006028 Bacteria 23200
206 Ga0070717_10002404 3300006028 Bacteria 13207
207 Ga0070717_10005064 3300006028 Bacteria 9608
208 Ga0070717_10010992 3300006028 Bacteria 6856
209 Ga0070717_10070371 3300006028 Bacteria 2915
210 Ga0070717_10211575 3300006028 Bacteria 1702
211 Ga0070717_10322499 3300006028 Unclassified 1376
212 Ga0070717_10407630 3300006028 Bacteria 1222
213 Ga0070717_10444175 3300006028 Unclassified 1168
214 Ga0075368_10008321 3300006042 Bacteria 3688
215 Ga0075368_10039209 3300006042 Bacteria 1856
216 Ga0075368_10067901 3300006042 Bacteria 1436
217 Ga0070715_10033994 3300006163 Bacteria 2087
218 Ga0070715_10104633 3300006163 Bacteria 1326
219 Ga0070715_10258998 3300006163 Unclassified 913
220 Ga0070716_100004330 3300006173 Bacteria 6769
221 Ga0070716_100020309 3300006173 Bacteria 3486
222 Ga0070716_100352858 3300006173 Unclassified 1042
223 Ga0070716_100377611 3300006173 Unclassified 1012
224 Ga0070716_100407866 3300006173 Bacteria 979
225 Ga0070712_100000132 3300006175 Bacteria 39155
226 Ga0070712_100012732 3300006175 Bacteria 5355
227 Ga0070712_100064725 3300006175 Bacteria 2593
228 Ga0070712_100124098 3300006175 Bacteria 1947
229 Ga0075362_10160609 3300006177 Bacteria 1082
230 Ga0075367_10580233 3300006178 Bacteria 712
231 Ga0075366_10003527 3300006195 Bacteria 8265
232 Ga0097621_100000840 3300006237 Bacteria 21630
233 Ga0097621_100030626 3300006237 Unclassified 4261
234 Ga0097621_100053049 3300006237 Bacteria 3304
235 Ga0097621_100125479 3300006237 Bacteria 2180
236 Ga0097621_100227312 3300006237 Unclassified 1628
237 Ga0068871_100017898 3300006358 Bacteria 5372
238 Ga0068871_100026092 3300006358 Bacteria 4555
239 Ga0068871_100157662 3300006358 Bacteria 1939
240 Ga0075433_10004588 3300006852 Bacteria 10778
241 Ga0075434_100000295 3300006871 Bacteria 35374
242 Ga0075434_100032828 3300006871 Bacteria 5121
243 Ga0075434_100342823 3300006871 Bacteria 1515
244 Ga0068865_100005849 3300006881 Bacteria 7481
245 Ga0068865_100079240 3300006881 Bacteria 2352
246 Ga0075436_100000175 3300006914 Bacteria 40019
247 Ga0075436_100001101 3300006914 Bacteria 18258
248 Ga0075436_100005310 3300006914 Bacteria 8859
249 Ga0075436_100057607 3300006914 Unclassified 2683
250 Ga0075436_100090155 3300006914 Bacteria 2131
251 Ga0097620_100000418 3300006931 Bacteria 42477
252 Ga0097620_100016871 3300006931 Bacteria 7330
253 Ga0097620_100022179 3300006931 Bacteria 6366
254 Ga0097620_100071142 3300006931 Unclassified 3514
255 Ga0097620_100126141 3300006931 Bacteria 2629
256 Ga0075435_100000025 3300007076 Bacteria 87314
257 Ga0075435_100036040 3300007076 Bacteria 3929
258 Ga0075435_100039758 3300007076 Bacteria 3754
259 Ga0075435_100046895 3300007076 Bacteria 3468
260 Ga0075435_100444203 3300007076 Bacteria 1118
261 Ga0099794_10362801 3300007265 Bacteria 754
262 Ga0105240_10020606 3300009093 Bacteria 8789
263 Ga0105240_10041278 3300009093 Bacteria 5891
264 Ga0105240_10066126 3300009093 Bacteria 4486
265 Ga0105240_10076981 3300009093 Bacteria 4111
266 Ga0105240_10108353 3300009093 Bacteria 3366
267 Ga0105240_10214715 3300009093 Bacteria 2245
268 Ga0105240_10290921 3300009093 Bacteria 1873
269 Ga0105240_10586626 3300009093 Bacteria 1229
270 Ga0111539_10747887 3300009094 Bacteria 1138
271 Ga0105245_10000741 3300009098 Bacteria 29480
272 Ga0105245_10012235 3300009098 Bacteria 7465
273 Ga0105245_10093699 3300009098 Bacteria 2768
274 Ga0105245_10742145 3300009098 Bacteria 1017
275 Ga0105247_10009654 3300009101 Bacteria 5853
276 Ga0105247_10017244 3300009101 Unclassified 4334
277 Ga0114129_10248700 3300009147 Bacteria 2388
278 Ga0105243_10085335 3300009148 Bacteria 2588
279 Ga0105241_10063394 3300009174 Bacteria 2851
280 Ga0105241_10067844 3300009174 Bacteria 2762
281 Ga0105241_10139656 3300009174 Bacteria 1971
282 Ga0105242_10020694 3300009176 Bacteria 5160
283 Ga0105242_10037701 3300009176 Bacteria 3884
284 Ga0105242_10139623 3300009176 Bacteria 2101
285 Ga0105248_10011199 3300009177 Bacteria 9892
286 Ga0105248_10022175 3300009177 Bacteria 7040
287 Ga0105248_10078291 3300009177 Bacteria 3716
288 Ga0105248_10855439 3300009177 Bacteria 1027
289 Ga0105237_10045385 3300009545 Unclassified 4423
290 Ga0105237_10110696 3300009545 Unclassified 2738
291 Ga0105237_10176019 3300009545 Bacteria 2140
292 Ga0105237_10608632 3300009545 Bacteria 1099
293 Ga0105237_10643988 3300009545 Bacteria 1067
294 Ga0105237_10664704 3300009545 Bacteria 1049
295 Ga0105238_10285501 3300009551 Bacteria 1632
296 Ga0105238_10411322 3300009551 Bacteria 1346
297 Ga0099796_10023123 3300010159 Bacteria 1937
298 Ga0105239_10012609 3300010375 Bacteria 9406
299 Ga0105239_10044133 3300010375 Bacteria 4887
300 Ga0105239_10351876 3300010375 Bacteria 1663
301 Ga0105246_10038994 3300011119 Bacteria 3198
302 Ga0105246_10297511 3300011119 Bacteria 1301
303 Ga0157373_10009287 3300013100 Bacteria 7270
304 Ga0157373_10051692 3300013100 Bacteria 2926
305 Ga0157371_10028747 3300013102 Unclassified 4024
306 Ga0157371_10130659 3300013102 Bacteria 1787
307 Ga0157370_10053910 3300013104 Bacteria 3834
308 Ga0157369_10038801 3300013105 Bacteria 5207
309 Ga0157369_10062504 3300013105 Bacteria 4012
310 Ga0157369_10350128 3300013105 Bacteria 1534
311 Ga0157369_10434871 3300013105 Bacteria 1359
312 Ga0157369_10495862 3300013105 Bacteria 1263
313 Ga0157369_10542291 3300013105 Bacteria 1202
314 Ga0157369_10722062 3300013105 Bacteria 1026
315 Ga0157369_11267596 3300013105 Bacteria 752
316 Ga0157374_10000254 3300013296 Bacteria 49194
317 Ga0157374_10022672 3300013296 Bacteria 5604
318 Ga0157374_10050911 3300013296 Unclassified 3852
319 Ga0157374_10058425 3300013296 Bacteria 3604
320 Ga0157374_10869705 3300013296 Unclassified 919
321 Ga0157378_10000554 3300013297 Bacteria 35545
322 Ga0157378_10003465 3300013297 Bacteria 13997
323 Ga0157378_10079130 3300013297 Bacteria 2967
324 Ga0157378_10238162 3300013297 Bacteria 1737
325 Ga0157378_11524281 3300013297 Bacteria 713
326 Ga0163162_10001180 3300013306 Bacteria 24381
327 Ga0163162_10253681 3300013306 Bacteria 1891
328 Ga0163162_10499787 3300013306 Bacteria 1346
329 Ga0157372_10001984 3300013307 Bacteria 22243
330 Ga0157372_10003830 3300013307 Bacteria 16171
331 Ga0157372_10015279 3300013307 Bacteria 8223
332 Ga0157372_10018474 3300013307 Bacteria 7495
333 Ga0157372_10052817 3300013307 Unclassified 4527
334 Ga0157372_10098762 3300013307 Bacteria 3331
335 Ga0157372_10119184 3300013307 Bacteria 3029
336 Ga0157372_10176433 3300013307 Bacteria 2473
337 Ga0157372_11035565 3300013307 Bacteria 950
338 Ga0157375_10015800 3300013308 Bacteria 6764
339 Ga0157375_10039540 3300013308 Bacteria 4541
340 Ga0163163_10223800 3300014325 Bacteria 1930
341 Ga0163163_10429703 3300014325 Bacteria 1380
342 Ga0157380_10015217 3300014326 Bacteria 5648
343 Ga0157380_10800762 3300014326 Bacteria 959
344 Ga0157377_10002280 3300014745 Bacteria 8432
345 Ga0157379_10023584 3300014968 Bacteria 5461
346 Ga0157379_10033116 3300014968 Bacteria 4608
347 Ga0157379_10123908 3300014968 Bacteria 2325
348 Ga0157379_10136581 3300014968 Bacteria 2209
349 Ga0157379_11429221 3300014968 Unclassified 671
350 Ga0157376_10022460 3300014969 Bacteria 4919
351 Ga0157376_10026292 3300014969 Bacteria 4597
352 Ga0157376_10087658 3300014969 Bacteria 2687
353 Ga0157376_10754716 3300014969 Bacteria 982
354 Ga0182006_1116740 3300015261 Unclassified 931
355 Ga0163161_10029760 3300017792 Unclassified 3882
356 Ga0213876_10200798 3300021384 Unclassified 1060
357 Ga0224570_100839 3300022730 Bacteria 2453
358 Ga0224572_1000076 3300024225 Bacteria 6856
359 Ga0224572_1010563 3300024225 Bacteria 1739
360 Ga0224572_1053580 3300024225 Bacteria 750
361 Ga0228598_1000540 3300024227 Bacteria 7878
362 Ga0228598_1030768 3300024227 Bacteria 1056
363 Ga0207656_10001134 3300025321 Bacteria 8757
364 Ga0207682_10046546 3300025893 Bacteria 1783
365 Ga0207692_10031221 3300025898 Bacteria 2549
366 Ga0207692_10040352 3300025898 Bacteria 2303
367 Ga0207692_10056291 3300025898 Bacteria 2016
368 Ga0207692_10478098 3300025898 Bacteria 788
369 Ga0207692_10507679 3300025898 Unclassified 766
370 Ga0207642_10008671 3300025899 Bacteria 3501
371 Ga0207642_10420757 3300025899 Bacteria 803
372 Ga0207710_10006090 3300025900 Bacteria 5166
373 Ga0207688_10006430 3300025901 Bacteria 6400
374 Ga0207680_10047873 3300025903 Bacteria 2536
375 Ga0207680_10126470 3300025903 Bacteria 1679
376 Ga0207647_10006190 3300025904 Bacteria 8718
377 Ga0207647_10015515 3300025904 Bacteria 5219
378 Ga0207647_10028240 3300025904 Bacteria 3647
379 Ga0207647_10189962 3300025904 Bacteria 1190
380 Ga0207685_10205557 3300025905 Bacteria 928
381 Ga0207685_10259791 3300025905 Unclassified 843
382 Ga0207699_10035039 3300025906 Bacteria 2853
383 Ga0207699_10061687 3300025906 Bacteria 2257
384 Ga0207699_10245404 3300025906 Unclassified 1232
385 Ga0207645_10003011 3300025907 Bacteria 13020
386 Ga0207645_10299494 3300025907 Bacteria 1070
387 Ga0207643_10087426 3300025908 Bacteria 1812
388 Ga0207643_10104823 3300025908 Bacteria 1661
389 Ga0207705_10000723 3300025909 Bacteria 27209
390 Ga0207705_10657420 3300025909 Unclassified 815
391 Ga0207684_10000383 3300025910 Bacteria 59620
392 Ga0207684_10003824 3300025910 Bacteria 14503
393 Ga0207684_10032595 3300025910 Bacteria 4429
394 Ga0207684_10107417 3300025910 Bacteria 2388
395 Ga0207654_10010946 3300025911 Bacteria 4619
396 Ga0207654_10042598 3300025911 Bacteria 2570
397 Ga0207707_10008797 3300025912 Bacteria 8762
398 Ga0207707_10012850 3300025912 Bacteria 7285
399 Ga0207707_10043693 3300025912 Bacteria 3907
400 Ga0207707_10257922 3300025912 Bacteria 1513
401 Ga0207695_10081298 3300025913 Bacteria 3279
402 Ga0207695_10091543 3300025913 Bacteria 3055
403 Ga0207695_10154217 3300025913 Bacteria 2233
404 Ga0207695_10223414 3300025913 Bacteria 1790
405 Ga0207695_10381741 3300025913 Bacteria 1295
406 Ga0207671_10004535 3300025914 Bacteria 13199
407 Ga0207671_10088142 3300025914 Bacteria 2334
408 Ga0207693_10001889 3300025915 Bacteria 18329
409 Ga0207693_10004669 3300025915 Bacteria 11542
410 Ga0207693_10009131 3300025915 Bacteria 8095
411 Ga0207693_10013125 3300025915 Bacteria 6683
412 Ga0207693_10174255 3300025915 Unclassified 1693
413 Ga0207663_10043419 3300025916 Unclassified 2752
414 Ga0207663_10056071 3300025916 Bacteria 2476
415 Ga0207663_10084573 3300025916 Unclassified 2087
416 Ga0207663_10097572 3300025916 Bacteria 1966
417 Ga0207663_10194318 3300025916 Unclassified 1459
418 Ga0207660_10024966 3300025917 Bacteria 4052
419 Ga0207660_10105062 3300025917 Bacteria 2116
420 Ga0207657_10003667 3300025919 Bacteria 16349
421 Ga0207657_10007212 3300025919 Bacteria 11414
422 Ga0207657_10012925 3300025919 Bacteria 8208
423 Ga0207649_10002381 3300025920 Bacteria 10544
424 Ga0207649_10425202 3300025920 Bacteria 998
425 Ga0207652_10045172 3300025921 Bacteria 3754
426 Ga0207652_10088087 3300025921 Bacteria 2723
427 Ga0207652_10118218 3300025921 Unclassified 2356
428 Ga0207652_10595484 3300025921 Unclassified 992
429 Ga0207646_10000229 3300025922 Bacteria 77035
430 Ga0207646_10177886 3300025922 Bacteria 1921
431 Ga0207646_10215745 3300025922 Bacteria 1733
432 Ga0207646_10654400 3300025922 Bacteria 941
433 Ga0207681_10066782 3300025923 Unclassified 2490
434 Ga0207681_10134550 3300025923 Bacteria 1832
435 Ga0207694_10177493 3300025924 Bacteria 1726
436 Ga0207694_10391812 3300025924 Bacteria 1154
437 Ga0207650_10001413 3300025925 Bacteria 17302
438 Ga0207650_10005500 3300025925 Bacteria 8646
439 Ga0207659_10018944 3300025926 Unclassified 4520
440 Ga0207687_10001100 3300025927 Bacteria 18374
441 Ga0207687_10072265 3300025927 Bacteria 2467
442 Ga0207687_10122411 3300025927 Bacteria 1947
443 Ga0207700_10019942 3300025928 Bacteria 4540
444 Ga0207700_10136536 3300025928 Unclassified 2010
445 Ga0207700_10160412 3300025928 Unclassified 1867
446 Ga0207700_10936253 3300025928 Unclassified 775
447 Ga0207664_10000076 3300025929 Bacteria 102019
448 Ga0207664_10041519 3300025929 Bacteria 3584
449 Ga0207664_10141429 3300025929 Bacteria 2036
450 Ga0207664_10176617 3300025929 Unclassified 1831
451 Ga0207664_10261413 3300025929 Bacteria 1514
452 Ga0207664_10281554 3300025929 Bacteria 1459
453 Ga0207664_10641119 3300025929 Unclassified 955
454 Ga0207664_10703356 3300025929 Bacteria 909
455 Ga0207664_10917805 3300025929 Unclassified 786
456 Ga0207690_10020615 3300025932 Unclassified 4076
457 Ga0207690_10296121 3300025932 Bacteria 1264
458 Ga0207706_10000790 3300025933 Bacteria 32752
459 Ga0207706_10000880 3300025933 Bacteria 30836
460 Ga0207706_10094879 3300025933 Bacteria 2624
461 Ga0207706_10336593 3300025933 Bacteria 1313
462 Ga0207686_10035930 3300025934 Bacteria 2978
463 Ga0207670_10005022 3300025936 Bacteria 7211
464 Ga0207670_10047313 3300025936 Bacteria 2864
465 Ga0207670_10180636 3300025936 Bacteria 1589
466 Ga0207669_10322540 3300025937 Bacteria 1183
467 Ga0207704_10204765 3300025938 Bacteria 1447
468 Ga0207665_10000085 3300025939 Bacteria 60799
469 Ga0207665_10030051 3300025939 Unclassified 3591
470 Ga0207665_10050444 3300025939 Bacteria 2798
471 Ga0207665_10080110 3300025939 Bacteria 2246
472 Ga0207665_10091791 3300025939 Unclassified 2106
473 Ga0207665_10101498 3300025939 Bacteria 2009
474 Ga0207665_10192209 3300025939 Unclassified 1484
475 Ga0207665_10272479 3300025939 Bacteria 1257
476 Ga0207665_10381303 3300025939 Unclassified 1070
477 Ga0207665_10847135 3300025939 Unclassified 724
478 Ga0207691_10001778 3300025940 Bacteria 21200
479 Ga0207711_10001004 3300025941 Bacteria 27059
480 Ga0207711_10089923 3300025941 Bacteria 2698
481 Ga0207711_10098663 3300025941 Unclassified 2581
482 Ga0207689_10000300 3300025942 Bacteria 45314
483 Ga0207689_10006573 3300025942 Bacteria 10251
484 Ga0207689_10051957 3300025942 Bacteria 3378
485 Ga0207661_10000720 3300025944 Bacteria 21511
486 Ga0207661_10193967 3300025944 Bacteria 1782
487 Ga0207679_10000359 3300025945 Bacteria 33269
488 Ga0207679_10008269 3300025945 Bacteria 6626
489 Ga0207679_10148014 3300025945 Bacteria 1907
490 Ga0207667_10008905 3300025949 Bacteria 11873
491 Ga0207667_10012807 3300025949 Bacteria 9635
492 Ga0207667_10046283 3300025949 Bacteria 4606
493 Ga0207667_10072845 3300025949 Bacteria 3570
494 Ga0207667_10146997 3300025949 Unclassified 2426
495 Ga0207651_10060678 3300025960 Unclassified 2626
496 Ga0207651_10083894 3300025960 Bacteria 2306
497 Ga0207668_10016324 3300025972 Bacteria 4632
498 Ga0207640_10009050 3300025981 Bacteria 5557
499 Ga0207640_10010511 3300025981 Bacteria 5216
500 Ga0207640_10067752 3300025981 Bacteria 2390
501 Ga0207658_10084780 3300025986 Bacteria 2439
502 Ga0207658_10194809 3300025986 Bacteria 1687
503 Ga0207658_10231070 3300025986 Bacteria 1561
504 Ga0207677_10008642 3300026023 Bacteria 5701
505 Ga0207677_10039324 3300026023 Bacteria 3110
506 Ga0207677_10068035 3300026023 Bacteria 2497
507 Ga0207677_10080754 3300026023 Bacteria 2331
508 Ga0207703_10003668 3300026035 Bacteria 12799
509 Ga0207639_10887305 3300026041 Bacteria 833
510 Ga0207678_10000498 3300026067 Bacteria 35724
511 Ga0207678_10001010 3300026067 Bacteria 25646
512 Ga0207678_10008712 3300026067 Bacteria 8932
513 Ga0207678_10009433 3300026067 Bacteria 8583
514 Ga0207708_10115810 3300026075 Bacteria 2085
515 Ga0207708_10120793 3300026075 Bacteria 2041
516 Ga0207702_10014378 3300026078 Bacteria 6571
517 Ga0207702_10026955 3300026078 Bacteria 4772
518 Ga0207702_10118623 3300026078 Unclassified 2364
519 Ga0207702_10225798 3300026078 Bacteria 1747
520 Ga0207702_10323709 3300026078 Unclassified 1469
521 Ga0207702_11323065 3300026078 Bacteria 715
522 Ga0207641_10000147 3300026088 Bacteria 99902
523 Ga0207641_10084058 3300026088 Bacteria 2770
524 Ga0207648_10001035 3300026089 Bacteria 31211
525 Ga0207648_10002663 3300026089 Bacteria 19026
526 Ga0207648_10005754 3300026089 Bacteria 12423
527 Ga0207648_10311104 3300026089 Bacteria 1414
528 Ga0207648_10451093 3300026089 Bacteria 1171
529 Ga0207676_10001035 3300026095 Bacteria 21311
530 Ga0207676_10098771 3300026095 Unclassified 2414
531 Ga0207676_10758061 3300026095 Bacteria 944
532 Ga0207674_10000432 3300026116 Bacteria 54683
533 Ga0207674_10000514 3300026116 Bacteria 50775
534 Ga0207674_10002218 3300026116 Bacteria 24590
535 Ga0207674_10046839 3300026116 Bacteria 4437
536 Ga0207674_10124852 3300026116 Bacteria 2540
537 Ga0207675_100044794 3300026118 Unclassified 4134
538 Ga0207675_100487967 3300026118 Bacteria 1225
539 Ga0207683_10221923 3300026121 Bacteria 1722
540 Ga0207698_10610651 3300026142 Bacteria 1076
541 Ga0207698_10874448 3300026142 Bacteria 905
542 Ga0209813_10039490 3300027866 Bacteria 1431
543 Ga0265356_1001311 3300028017 Bacteria 3733
544 Ga0268266_10047429 3300028379 Bacteria 3680
545 Ga0268266_10171856 3300028379 Bacteria 1967
546 Ga0268265_10039285 3300028380 Unclassified 3487
547 Ga0268264_10030574 3300028381 Bacteria 4414
548 Ga0268264_10034688 3300028381 Bacteria 4152
549 Ga0268264_10065925 3300028381 Bacteria 3052
550 Ga0268264_10087408 3300028381 Unclassified 2680
551 Ga0268264_10434691 3300028381 Bacteria 1268
552 Ga0265338_10021209 3300028800 Bacteria 6785
553 Ga0265338_10151941 3300028800 Bacteria 1798
554 Ga0265762_1000668 3300030760 Bacteria 6038
555 Ga0265762_1003454 3300030760 Unclassified 2831
556 Ga0265770_1001315 3300030878 Bacteria 3435
557 Ga0265770_1019314 3300030878 Bacteria 1068
558 Ga0265765_1000051 3300030879 Bacteria 5894
559 Ga0265760_10000020 3300031090 Bacteria 71420
560 Ga0265760_10000664 3300031090 Bacteria 9769
561 Ga0265760_10000741 3300031090 Bacteria 9325
562 Ga0265760_10006543 3300031090 Bacteria 3333
563 Ga0265760_10007699 3300031090 Bacteria 3078
564 Ga0265760_10075506 3300031090 Bacteria 1039
565 Ga0265760_10082693 3300031090 Bacteria 996
566 Ga0265330_10001607 3300031235 Bacteria 12916
567 Ga0265340_10168715 3300031247 Unclassified 992
568 Ga0265339_10048893 3300031249 Bacteria 2317
569 Ga0265339_10199481 3300031249 Bacteria 988
570 Ga0265316_10005890 3300031344 Bacteria 11814
571 Ga0265316_10181639 3300031344 Bacteria 1566
572 Ga0307408_100016365 3300031548 Bacteria 4949
573 Ga0307408_100151187 3300031548 Bacteria 1833
574 Ga0265314_10000920 3300031711 Bacteria 34667
575 Ga0265314_10036249 3300031711 Bacteria 3586
576 Ga0265314_10043074 3300031711 Unclassified 3213
577 Ga0265314_10302743 3300031711 Bacteria 896
578 Ga0307413_10825923 3300031824 Bacteria 781
579 Ga0307410_10144096 3300031852 Bacteria 1766
580 Ga0307409_100004397 3300031995 Bacteria 7912
581 Ga0307416_100271600 3300032002 Bacteria 1665
582 Ga0307416_100433875 3300032002 Bacteria 1362
583 Ga0307414_10591877 3300032004 Bacteria 994
584 Ga0307411_10014175 3300032005 Unclassified 4427
585 Ga0307415_100001749 3300032126 Bacteria 10589
586 Ga0373930_0094866 3300034816 Bacteria 703
587 Ga0373934_0004450 3300035086 Bacteria 5178
588 Ga0373934_0055310 3300035086 Bacteria 1577
589 Ga0373951_0084832 3300035091 Bacteria 824
590 Ga0373923_0010879 3300035111 Unclassified 3323
591 Ga0373923_0098120 3300035111 Bacteria 1289
592 Ga0373923_0108802 3300035111 Unclassified 1229
593 Ga0373936_0037405 3300035113 Bacteria 1938
594 Ga0373936_0078030 3300035113 Bacteria 1374
595 Ga0373939_0039784 3300035114 Bacteria 1409
596 Ga0373941_0197642 3300035115 Bacteria 763
597 Ga0373945_0001902 3300035116 Bacteria 6477
598 Ga0373956_0041590 3300035119 Bacteria 2041
599 Ga0373957_0040371 3300035120 Bacteria 1754
600 Ga0373960_0028999 3300035121 Bacteria 1531
601 Ga0373943_0000480 3300035170 Bacteria 17033
602 Ga0373943_0007718 3300035170 Bacteria 4832
603 Ga0373943_0225384 3300035170 Bacteria 1045
604 Ga0373943_0300394 3300035170 Bacteria 911
605 Ga0373943_0359292 3300035170 Bacteria 836
606 Ga0373946_0006365 3300035171 Bacteria 4279
607 Ga0373955_0014880 3300035172 Bacteria 3796
608 Ga0373955_0217433 3300035172 Unclassified 1140
609 Ga0373955_0314133 3300035172 Bacteria 946
610 Ga0373955_0417008 3300035172 Unclassified 816
611 Ga0373942_0095978 3300035207 Bacteria 900
612 Ga0373924_0005123 3300035410 Bacteria 4624
613 Ga0373924_0099101 3300035410 Bacteria 1252
614 Ga0373931_0015153 3300035691 Bacteria 3778
615 Ga0373931_0129277 3300035691 Bacteria 1452
616 Ga0373931_0232630 3300035691 Bacteria 1114
617 Ga0373935_0000474 3300035692 Bacteria 20860
618 Ga0373935_0003560 3300035692 Bacteria 9075
619 Ga0373935_0089675 3300035692 Bacteria 2011
620 Ga0373935_0167236 3300035692 Bacteria 1502
621 Ga0373927_0000433 3300035695 Bacteria 32099
622 Ga0373927_0006915 3300035695 Bacteria 7707
623 Ga0373927_0070326 3300035695 Bacteria 2265
624 Ga0373927_0442217 3300035695 Bacteria 858
625 Ga0373933_0001863 3300035724 Bacteria 12192
626 Ga0373933_0021611 3300035724 Unclassified 3657
627 Ga0373933_0022965 3300035724 Unclassified 3558
628 Ga0373933_0038036 3300035724 Bacteria 2826
629 Ga0373933_0082901 3300035724 Bacteria 1969
630 Ga0373947_0000115 3300035725 Bacteria 40107
631 Ga0373947_0231523 3300035725 Bacteria 1217
632 Ga0373947_0265658 3300035725 Bacteria 1138
633 Ga0373937_0000001 3300036401 Bacteria 478903
634 Ga0373937_0020629 3300036401 Bacteria 5908
635 Ga0373937_0034114 3300036401 Bacteria 4628
636 Ga0373937_0122911 3300036401 Bacteria 2420
637 Ga0373937_0408020 3300036401 Bacteria 1289
638 Ga0373937_0564829 3300036401 Bacteria 1081
639 Ga0373925_0001531 3300037068 Bacteria 19721
640 Ga0373925_0172517 3300037068 Bacteria 1708
641 Ga0373925_0261921 3300037068 Bacteria 1389
642 Ga0373925_0367561 3300037068 Unclassified 1170
643 Ga0395900_0356038 3300037418 Bacteria 1436
644 Ga0395900_0558442 3300037418 Bacteria 1089
645 Ga0395905_0020273 3300037471 Bacteria 6300
646 Ga0395905_0027208 3300037471 Bacteria 5393
647 Ga0395905_0106925 3300037471 Bacteria 2627
648 Ga0395901_0594669 3300038443 Bacteria 1116
649 Ga0436365_0979910 3300039437 Bacteria 1880
650 Ga0436365_1144293 3300039437 Bacteria 3892
651 Ga0436363_0695341 3300039450 Unclassified 803
652 Ga0436363_1227896 3300039450 Bacteria 1064
653 Ga0436363_1324681 3300039450 Bacteria 2100
654 Ga0451577_0000331 3300042876 Bacteria 88029
655 Ga0453683_0009319 3300044673 Bacteria 6560
656 Ga0453683_0202049 3300044673 Bacteria 1262
657 Ga0466961_0497421 3300044693 Bacteria 736
658 Ga0466963_0411409 3300044694 Bacteria 954
659 Ga0466963_0679471 3300044694 Bacteria 727
660 Ga0453684_0000429 3300044712 Bacteria 171513
661 Ga0453684_1033931 3300044712 Bacteria 872
662 Ga0451576_0002208 3300045051 Bacteria 29964
663 Ga0451576_0168278 3300045051 Bacteria 2287
664 Ga0451576_0331805 3300045051 Unclassified 1592
665 Ga0451576_1016494 3300045051 Bacteria 869
666 Ga0451576_1577157 3300045051 Bacteria 681
667 Ga0466967_0269293 3300045976 Bacteria 1632
668 Ga0466967_0312528 3300045976 Bacteria 1514
669 Ga0495653_0060335 3300046463 Bacteria 2874
670 Ga0495653_0125339 3300046463 Bacteria 1825
671 Ga0495653_0524393 3300046463 Unclassified 736
672 Ga0495580_0001849 3300046472 Bacteria 18621
673 Ga0495580_0001939 3300046472 Bacteria 18188
674 Ga0495580_0007136 3300046472 Bacteria 9000
675 Ga0495580_0007791 3300046472 Bacteria 8583
676 Ga0495580_0009328 3300046472 Bacteria 7721
677 Ga0495580_0019097 3300046472 Bacteria 5096
678 Ga0495580_0020786 3300046472 Bacteria 4852
679 Ga0495580_0038482 3300046472 Bacteria 3425
680 Ga0495580_0039958 3300046472 Unclassified 3355
681 Ga0495580_0145825 3300046472 Bacteria 1641
682 Ga0495582_0000976 3300046473 Bacteria 15993
683 Ga0495664_0581525 3300046477 Unclassified 666
684 Ga0495594_0007613 3300046499 Bacteria 5574
685 Ga0495628_0050370 3300046516 Bacteria 3294
686 Ga0495630_0023613 3300046517 Bacteria 4546
687 Ga0495630_0148197 3300046517 Bacteria 1785
688 Ga0495630_0424309 3300046517 Bacteria 1019
689 Ga0495666_0147946 3300046526 Bacteria 1093
690 Ga0495642_0118539 3300046528 Bacteria 1135
691 Ga0495652_0022463 3300046529 Bacteria 5598
692 Ga0495652_0193542 3300046529 Bacteria 1550
693 Ga0495652_0407074 3300046529 Unclassified 962
694 Ga0495665_0003216 3300046531 Bacteria 8837
695 Ga0495586_0016780 3300046535 Unclassified 3897
696 Ga0495587_0000433 3300046536 Bacteria 29356
697 Ga0495587_0038455 3300046536 Bacteria 2868
698 Ga0495587_0065189 3300046536 Bacteria 2127
699 Ga0495645_0013243 3300046543 Bacteria 5830
700 Ga0495667_0098922 3300046559 Bacteria 1889
701 Ga0495668_0072291 3300046616 Bacteria 1895
702 Ga0495588_0074714 3300046674 Bacteria 1765
703 Ga0495657_0197083 3300046675 Bacteria 1229
704 Ga0495657_0317663 3300046675 Bacteria 926
705 Ga0495623_0043021 3300046679 Bacteria 2875
706 Ga0495623_0110870 3300046679 Unclassified 1663
707 Ga0495623_0186837 3300046679 Bacteria 1200
708 Ga0495623_0302552 3300046679 Unclassified 883
709 Ga0495646_0343968 3300046680 Unclassified 782
710 Ga0495669_0046424 3300046684 Bacteria 1939
711 Ga0495669_0085838 3300046684 Bacteria 1449
712 Ga0495669_0115617 3300046684 Bacteria 1255
713 Ga0495613_0291765 3300046689 Unclassified 1131
714 Ga0495613_0394597 3300046689 Unclassified 945
715 Ga0495624_0016490 3300046690 Bacteria 4973
716 Ga0495600_0537537 3300046809 Unclassified 715
717 Ga0495581_0032535 3300047315 Bacteria 3020
718 Ga0495604_0010097 3300047317 Bacteria 7478
719 Ga0495674_0009335 3300047319 Bacteria 9327
720 Ga0495674_0676253 3300047319 Bacteria 812
721 Ga0495675_0023972 3300047444 Unclassified 3888
722 Ga0495675_0035585 3300047444 Bacteria 3179
723 Ga0495675_0068352 3300047444 Bacteria 2244
724 Ga0495602_0000056 3300048088 Bacteria 109741
725 Ga0495602_0021528 3300048088 Bacteria 6343
726 Ga0495602_0054926 3300048088 Bacteria 3512
727 Ga0495602_0143881 3300048088 Bacteria 1884
728 Ga0495602_0281477 3300048088 Unclassified 1225
729 Ga0496100_0208809 3300048903 Bacteria 1427
730 Ga0496101_0099388 3300048904 Bacteria 2175
731 Ga0496101_0270422 3300048904 Bacteria 1327
732 Ga0496102_0001511 3300048905 Bacteria 20524
733 Ga0496102_0135493 3300048905 Bacteria 2307
734 Ga0496102_0212551 3300048905 Bacteria 1823
735 Ga0496103_0001097 3300048906 Bacteria 18843
736 Ga0496103_0036085 3300048906 Bacteria 3027
737 Ga0496104_0083719 3300048907 Bacteria 3042
738 Ga0496104_0169064 3300048907 Bacteria 2097
739 Ga0496104_0199351 3300048907 Bacteria 1914
740 Ga0496104_0202299 3300048907 Unclassified 1898
741 Ga0496104_0790134 3300048907 Bacteria 855
742 Ga0496105_0047541 3300048908 Bacteria 3541
743 Ga0496105_0421188 3300048908 Bacteria 1057
744 Ga0496105_0552234 3300048908 Unclassified 899
745 Ga0496106_0065595 3300048909 Bacteria 2764
746 Ga0496106_0073362 3300048909 Bacteria 2618
747 Ga0496107_0067487 3300048910 Bacteria 2595
748 Ga0496108_0000051 3300048911 Bacteria 131546
749 Ga0496109_0000105 3300048912 Bacteria 87116
750 Ga0496109_1024050 3300048912 Bacteria 763
751 Ga0496110_0000138 3300048913 Bacteria 42078
752 Ga0496111_0128235 3300048914 Bacteria 1876
753 Ga0496112_0000688 3300048915 Bacteria 23567
754 Ga0496112_0003243 3300048915 Bacteria 13407
755 Ga0496112_0040162 3300048915 Bacteria 4575
756 Ga0496112_0168721 3300048915 Bacteria 2154
757 Ga0496112_0456429 3300048915 Bacteria 1215
758 Ga0496112_0785955 3300048915 Unclassified 877
759 Ga0496113_0000499 3300048916 Bacteria 19290
760 Ga0496113_0086343 3300048916 Bacteria 2411
761 Ga0496113_0191418 3300048916 Bacteria 1624
762 Ga0496114_0197514 3300048917 Bacteria 1761
763 Ga0496114_0441930 3300048917 Bacteria 1152
764 Ga0496115_0685988 3300048918 Unclassified 807
765 Ga0501033_0619943 3300049570 Bacteria 741
766 Ga0501034_0145316 3300049571 Bacteria 2349
767 Ga0501037_0085974 3300049573 Bacteria 2277
768 Ga0501038_0857562 3300049574 Unclassified 672
769 Ga0501047_0067889 3300049581 Bacteria 3435
770 Ga0501067_0503958 3300049583 Bacteria 677
771 Ga0501070_0353266 3300049586 Bacteria 1193
772 Ga0501071_0299034 3300049587 Bacteria 1220
773 Ga0501072_0387631 3300049588 Bacteria 1109
774 Ga0501073_0008916 3300049589 Bacteria 7414
775 Ga0501076_0419644 3300049592 Unclassified 1101
776 Ga0501235_010391 3300049669 Bacteria 2034
777 Ga0501225_0031666 3300049705 Bacteria 1455
778 Ga0501079_0276447 3300049741 Bacteria 1313
779 Ga0501083_0448779 3300049744 Unclassified 839
780 Ga0501270_010597 3300049767 Unclassified 1218
781 nmdc:mga03683_230672_c1 3300050489 Bacteria 856
782 nmdc:mga03n38_48078_c1 3300050490 Bacteria 1891
783 nmdc:mga0k408_25943_c1 3300050493 Bacteria 3321
784 nmdc:mga04h51_12514_c1 3300050495 Bacteria 2383
785 nmdc:mga07m45_12720_c1 3300050496 Bacteria 4451
786 nmdc:mga05p37_292254_c1 3300050507 Bacteria 1939
787 nmdc:mga0n895_103_c1 3300050512 Bacteria 49967
788 nmdc:mga0n895_366171_c1 3300050512 Bacteria 1459
789 nmdc:mga0n895_507085_c1 3300050512 Bacteria 1215
790 nmdc:mga0n895_7372_c1 3300050512 Bacteria 9433
791 nmdc:mga0rr50_27742_c1 3300050513 Bacteria 3970
792 nmdc:mga0rr50_52330_c1 3300050513 Bacteria 3034
793 nmdc:mga0rr50_71074_c1 3300050513 Unclassified 2654
794 nmdc:mga0rr50_881_c1 3300050513 Bacteria 16224
795 nmdc:mga08x19_139092_c1 3300050514 Bacteria 1639
796 nmdc:mga08x19_3200_c1 3300050514 Bacteria 9819
797 nmdc:mga08x19_49976_c1 3300050514 Unclassified 2682
798 nmdc:mga08x19_7511_c1 3300050514 Bacteria 6476
799 nmdc:mga08x19_9557_c1 3300050514 Bacteria 5807
800 nmdc:mga0a205_835528_c1 3300050515 Bacteria 768
801 Ga0495612_0145317 3300053078 Bacteria 1030
802 Ga0501084_0042105 3300054114 Bacteria 3820
803 Ga0501084_1141688 3300054114 Bacteria 654
804 Ga0501082_0467300 3300060353 Bacteria 1102

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_1141688 Ga0501084_1141688_20_559 173
2 3300026078 Ga0207702_11323065 Ga0207702_113230651 182
3 3300005468 Ga0070707_100148036 Ga0070707_1001480362 185
4 3300049574 Ga0501038_0857562 Ga0501038_0857562_76_651 185
5 3300005328 Ga0070676_10008222 Ga0070676_100082222 186
6 3300005330 Ga0070690_100120734 Ga0070690_1001207342 186
7 3300005335 Ga0070666_10100199 Ga0070666_101001992 186
8 3300005336 Ga0070680_100164109 Ga0070680_1001641091 186
9 3300005338 Ga0068868_100020227 Ga0068868_1000202272 186
10 3300005339 Ga0070660_100112287 Ga0070660_1001122872 186
11 3300005344 Ga0070661_100170097 Ga0070661_1001700971 186
12 3300005347 Ga0070668_100102469 Ga0070668_1001024693 186
13 3300005366 Ga0070659_100084160 Ga0070659_1000841603 186
14 3300005367 Ga0070667_100120440 Ga0070667_1001204403 186
15 3300005437 Ga0070710_10418170 Ga0070710_104181702 186
16 3300005440 Ga0070705_100263388 Ga0070705_1002633882 186
17 3300005441 Ga0070700_100092015 Ga0070700_1000920152 186
18 3300005455 Ga0070663_100006657 Ga0070663_1000066578 186
19 3300005457 Ga0070662_100001840 Ga0070662_1000018406 186
20 3300005459 Ga0068867_100027341 Ga0068867_1000273411 186
21 3300005530 Ga0070679_100107507 Ga0070679_1001075073 186
22 3300005535 Ga0070684_100003777 Ga0070684_1000037773 186
23 3300005539 Ga0068853_100274324 Ga0068853_1002743241 186
24 3300005544 Ga0070686_100015652 Ga0070686_1000156523 186
25 3300005547 Ga0070693_100157563 Ga0070693_1001575632 186
26 3300005548 Ga0070665_100004447 Ga0070665_1000044477 186
27 3300005563 Ga0068855_100153482 Ga0068855_1001534823 186
28 3300005564 Ga0070664_100007016 Ga0070664_1000070162 186
29 3300005577 Ga0068857_100167457 Ga0068857_1001674572 186
30 3300005578 Ga0068854_100015075 Ga0068854_1000150753 186
31 3300005614 Ga0068856_100071560 Ga0068856_1000715604 186
32 3300005617 Ga0068859_100022181 Ga0068859_1000221814 186
33 3300005618 Ga0068864_100130421 Ga0068864_1001304212 186
34 3300005718 Ga0068866_10072406 Ga0068866_100724062 186
35 3300005834 Ga0068851_10033133 Ga0068851_100331332 186
36 3300005840 Ga0068870_10174904 Ga0068870_101749042 186
37 3300005842 Ga0068858_100446202 Ga0068858_1004462021 186
38 3300005843 Ga0068860_100332493 Ga0068860_1003324931 186
39 3300005844 Ga0068862_100008956 Ga0068862_1000089565 186
40 3300006358 Ga0068871_100157662 Ga0068871_1001576622 186
41 3300006881 Ga0068865_100079240 Ga0068865_1000792402 186
42 3300006931 Ga0097620_100022179 Ga0097620_1000221795 186
43 3300009093 Ga0105240_10066126 Ga0105240_100661262 186
44 3300009098 Ga0105245_10742145 Ga0105245_107421452 186
45 3300009148 Ga0105243_10085335 Ga0105243_100853353 186
46 3300009177 Ga0105248_10011199 Ga0105248_100111992 186
47 3300009545 Ga0105237_10643988 Ga0105237_106439881 186
48 3300010375 Ga0105239_10351876 Ga0105239_103518761 186
49 3300011119 Ga0105246_10038994 Ga0105246_100389943 186
50 3300013100 Ga0157373_10051692 Ga0157373_100516923 186
51 3300013102 Ga0157371_10130659 Ga0157371_101306592 186
52 3300013104 Ga0157370_10053910 Ga0157370_100539102 186
53 3300013105 Ga0157369_10434871 Ga0157369_104348712 186
54 3300013296 Ga0157374_10022672 Ga0157374_100226724 186
55 3300013297 Ga0157378_10079130 Ga0157378_100791302 186
56 3300013306 Ga0163162_10253681 Ga0163162_102536812 186
57 3300013307 Ga0157372_10018474 Ga0157372_100184744 186
58 3300013308 Ga0157375_10039540 Ga0157375_100395402 186
59 3300014968 Ga0157379_10033116 Ga0157379_100331163 186
60 3300014969 Ga0157376_10026292 Ga0157376_100262922 186
61 3300031090 Ga0265760_10000020 Ga0265760_1000002017 186
62 3300005435 Ga0070714_100420624 Ga0070714_1004206241 187
63 3300005439 Ga0070711_100496406 Ga0070711_1004964062 187
64 3300006028 Ga0070717_10444175 Ga0070717_104441752 187
65 3300013307 Ga0157372_11035565 Ga0157372_110355652 187
66 3300025906 Ga0207699_10245404 Ga0207699_102454042 187
67 3300025913 Ga0207695_10381741 Ga0207695_103817411 187
68 3300025928 Ga0207700_10936253 Ga0207700_109362531 187
69 3300025939 Ga0207665_10847135 Ga0207665_108471351 187
70 3300031090 Ga0265760_10075506 Ga0265760_100755062 187
71 3300035086 Ga0373934_0055310 Ga0373934_0055310_352_969 187
72 3300035120 Ga0373957_0040371 Ga0373957_0040371_891_1508 187
73 3300035172 Ga0373955_0014880 Ga0373955_0014880_1861_2478 187
74 3300035724 Ga0373933_0001863 Ga0373933_0001863_9704_10321 187
75 3300036401 Ga0373937_0000001 Ga0373937_0000001_343329_343946 187
76 3300046463 Ga0495653_0060335 Ga0495653_0060335_79_696 187
77 3300046529 Ga0495652_0022463 Ga0495652_0022463_2552_3169 187
78 3300046536 Ga0495587_0000433 Ga0495587_0000433_9406_10023 187
79 3300046679 Ga0495623_0043021 Ga0495623_0043021_964_1581 187
80 3300047317 Ga0495604_0010097 Ga0495604_0010097_1938_2555 187
81 3300047444 Ga0495675_0035585 Ga0495675_0035585_2168_2785 187
82 3300048088 Ga0495602_0000056 Ga0495602_0000056_9390_10007 187
83 iso_pu_bacteria 2884215851 2884218631 189
84 3300031548 Ga0307408_100151187 Ga0307408_1001511872 191
85 3300032002 Ga0307416_100433875 Ga0307416_1004338752 191
86 3300034816 Ga0373930_0094866 Ga0373930_0094866_46_627 191
87 3300037418 Ga0395900_0356038 Ga0395900_0356038_482_1063 191
88 3300037418 Ga0395900_0558442 Ga0395900_0558442_169_750 191
89 3300037471 Ga0395905_0020273 Ga0395905_0020273_2043_2624 191
90 3300037471 Ga0395905_0027208 Ga0395905_0027208_4629_5210 191
91 3300037471 Ga0395905_0106925 Ga0395905_0106925_2012_2593 191
92 3300038443 Ga0395901_0594669 Ga0395901_0594669_22_603 191
93 3300046684 Ga0495669_0115617 Ga0495669_0115617_165_746 191
94 3300049705 Ga0501225_0031666 Ga0501225_0031666_290_871 191
95 3300005435 Ga0070714_100937253 Ga0070714_1009372531 192
96 3300005436 Ga0070713_100005398 Ga0070713_1000053985 192
97 3300005436 Ga0070713_100021670 Ga0070713_1000216704 192
98 3300005436 Ga0070713_100405881 Ga0070713_1004058812 192
99 3300005518 Ga0070699_100292263 Ga0070699_1002922632 192
100 3300005530 Ga0070679_100756834 Ga0070679_1007568341 192
101 3300006914 Ga0075436_100000175 Ga0075436_1000001755 192
102 3300006914 Ga0075436_100090155 Ga0075436_1000901552 192
103 3300009093 Ga0105240_10290921 Ga0105240_102909211 192
104 3300009094 Ga0111539_10747887 Ga0111539_107478872 192
105 3300009147 Ga0114129_10248700 Ga0114129_102487003 192
106 3300009174 Ga0105241_10067844 Ga0105241_100678442 192
107 3300013105 Ga0157369_10038801 Ga0157369_100388015 192
108 3300013296 Ga0157374_10869705 Ga0157374_108697051 192
109 3300013307 Ga0157372_10098762 Ga0157372_100987622 192
110 3300014325 Ga0163163_10429703 Ga0163163_104297032 192
111 3300014968 Ga0157379_11429221 Ga0157379_114292211 192
112 3300025898 Ga0207692_10031221 Ga0207692_100312212 192
113 3300025912 Ga0207707_10257922 Ga0207707_102579222 192
114 3300025949 Ga0207667_10146997 Ga0207667_101469972 192
115 3300026078 Ga0207702_10026955 Ga0207702_100269552 192
116 3300031548 Ga0307408_100016365 Ga0307408_1000163656 192
117 3300031824 Ga0307413_10825923 Ga0307413_108259231 192
118 3300031852 Ga0307410_10144096 Ga0307410_101440961 192
119 3300031995 Ga0307409_100004397 Ga0307409_1000043971 192
120 3300032002 Ga0307416_100271600 Ga0307416_1002716003 192
121 3300032004 Ga0307414_10591877 Ga0307414_105918771 192
122 3300032005 Ga0307411_10014175 Ga0307411_100141753 192
123 3300032126 Ga0307415_100001749 Ga0307415_1000017494 192
124 3300035172 Ga0373955_0314133 Ga0373955_0314133_256_849 192
125 3300044673 Ga0453683_0202049 Ga0453683_0202049_114_698 192
126 3300044694 Ga0466963_0679471 Ga0466963_0679471_134_715 192
127 3300045051 Ga0451576_0168278 Ga0451576_0168278_1056_1640 192
128 3300045976 Ga0466967_0269293 Ga0466967_0269293_873_1454 192
129 3300046463 Ga0495653_0524393 Ga0495653_0524393_86_673 192
130 3300046499 Ga0495594_0007613 Ga0495594_0007613_1994_2581 192
131 3300046528 Ga0495642_0118539 Ga0495642_0118539_445_1032 192
132 3300046529 Ga0495652_0407074 Ga0495652_0407074_158_745 192
133 3300046535 Ga0495586_0016780 Ga0495586_0016780_2290_2877 192
134 3300046536 Ga0495587_0038455 Ga0495587_0038455_466_1053 192
135 3300046543 Ga0495645_0013243 Ga0495645_0013243_2660_3247 192
136 3300046616 Ga0495668_0072291 Ga0495668_0072291_291_878 192
137 3300046674 Ga0495588_0074714 Ga0495588_0074714_1131_1718 192
138 3300046675 Ga0495657_0197083 Ga0495657_0197083_165_752 192
139 3300046675 Ga0495657_0317663 Ga0495657_0317663_14_772 192
140 3300046679 Ga0495623_0302552 Ga0495623_0302552_199_786 192
141 3300046684 Ga0495669_0046424 Ga0495669_0046424_667_1254 192
142 3300046689 Ga0495613_0291765 Ga0495613_0291765_66_653 192
143 3300046689 Ga0495613_0394597 Ga0495613_0394597_282_869 192
144 3300046809 Ga0495600_0537537 Ga0495600_0537537_26_613 192
145 3300047444 Ga0495675_0023972 Ga0495675_0023972_610_1197 192
146 3300048088 Ga0495602_0281477 Ga0495602_0281477_613_1200 192
147 3300048908 Ga0496105_0421188 Ga0496105_0421188_399_986 192
148 3300048908 Ga0496105_0552234 Ga0496105_0552234_28_615 192
149 3300048915 Ga0496112_0456429 Ga0496112_0456429_448_1035 192
150 3300048916 Ga0496113_0086343 Ga0496113_0086343_1317_1904 192
151 3300048916 Ga0496113_0191418 Ga0496113_0191418_451_1038 192
152 3300048918 Ga0496115_0685988 Ga0496115_0685988_34_621 192
153 3300049571 Ga0501034_0145316 Ga0501034_0145316_1579_2166 192
154 3300049669 Ga0501235_010391 Ga0501235_010391_809_1393 192
155 3300049767 Ga0501270_010597 Ga0501270_010597_618_1202 192
156 3300050507 nmdc:mga05p37_292254_c1 nmdc:mga05p37_292254_c1_1083_1667 192
157 3300050514 nmdc:mga08x19_139092_c1 nmdc:mga08x19_139092_c1_296_877 192
158 3300050514 nmdc:mga08x19_3200_c1 nmdc:mga08x19_3200_c1_572_1153 192
159 3300005293 Ga0065715_10240193 Ga0065715_102401931 193
160 3300005327 Ga0070658_10463608 Ga0070658_104636082 193
161 3300005329 Ga0070683_100017534 Ga0070683_1000175348 193
162 3300005329 Ga0070683_100018333 Ga0070683_1000183337 193
163 3300005336 Ga0070680_100005837 Ga0070680_10000583713 193
164 3300005336 Ga0070680_100497083 Ga0070680_1004970831 193
165 3300005338 Ga0068868_100002614 Ga0068868_1000026143 193
166 3300005339 Ga0070660_100002180 Ga0070660_1000021802 193
167 3300005339 Ga0070660_100355809 Ga0070660_1003558091 193
168 3300005340 Ga0070689_100268710 Ga0070689_1002687103 193
169 3300005344 Ga0070661_100067305 Ga0070661_1000673052 193
170 3300005344 Ga0070661_100197107 Ga0070661_1001971071 193
171 3300005347 Ga0070668_100486100 Ga0070668_1004861002 193
172 3300005364 Ga0070673_100026626 Ga0070673_1000266262 193
173 3300005366 Ga0070659_100034279 Ga0070659_1000342795 193
174 3300005367 Ga0070667_100747966 Ga0070667_1007479662 193
175 3300005434 Ga0070709_10045030 Ga0070709_100450304 193
176 3300005434 Ga0070709_10359932 Ga0070709_103599322 193
177 3300005435 Ga0070714_100044948 Ga0070714_1000449482 193
178 3300005435 Ga0070714_100264948 Ga0070714_1002649482 193
179 3300005435 Ga0070714_100297966 Ga0070714_1002979663 193
180 3300005435 Ga0070714_100819582 Ga0070714_1008195822 193
181 3300005436 Ga0070713_100017385 Ga0070713_1000173858 193
182 3300005436 Ga0070713_100093786 Ga0070713_1000937862 193
183 3300005436 Ga0070713_101018833 Ga0070713_1010188331 193
184 3300005440 Ga0070705_100277750 Ga0070705_1002777502 193
185 3300005445 Ga0070708_100002478 Ga0070708_10000247813 193
186 3300005457 Ga0070662_100090027 Ga0070662_1000900273 193
187 3300005458 Ga0070681_10014865 Ga0070681_100148651 193
188 3300005458 Ga0070681_10020326 Ga0070681_100203263 193
189 3300005458 Ga0070681_10022144 Ga0070681_100221447 193
190 3300005459 Ga0068867_100003948 Ga0068867_1000039483 193
191 3300005530 Ga0070679_100042315 Ga0070679_1000423151 193
192 3300005530 Ga0070679_100341082 Ga0070679_1003410821 193
193 3300005535 Ga0070684_100617637 Ga0070684_1006176371 193
194 3300005536 Ga0070697_100179896 Ga0070697_1001798962 193
195 3300005539 Ga0068853_100359177 Ga0068853_1003591772 193
196 3300005547 Ga0070693_100160501 Ga0070693_1001605011 193
197 3300005548 Ga0070665_100248502 Ga0070665_1002485022 193
198 3300005548 Ga0070665_100891979 Ga0070665_1008919792 193
199 3300005563 Ga0068855_100009456 Ga0068855_1000094563 193
200 3300005563 Ga0068855_100333063 Ga0068855_1003330632 193
201 3300005564 Ga0070664_100002061 Ga0070664_10000206114 193
202 3300005577 Ga0068857_100001890 Ga0068857_1000018903 193
203 3300005577 Ga0068857_100139948 Ga0068857_1001399484 193
204 3300005577 Ga0068857_100179572 Ga0068857_1001795722 193
205 3300005578 Ga0068854_100000866 Ga0068854_10000086619 193
206 3300005578 Ga0068854_100005607 Ga0068854_1000056078 193
207 3300005614 Ga0068856_100111870 Ga0068856_1001118704 193
208 3300005614 Ga0068856_100166773 Ga0068856_1001667731 193
209 3300005617 Ga0068859_100000418 Ga0068859_10000041811 193
210 3300005617 Ga0068859_100126142 Ga0068859_1001261424 193
211 3300005618 Ga0068864_100006714 Ga0068864_1000067144 193
212 3300005718 Ga0068866_10027896 Ga0068866_100278963 193
213 3300005840 Ga0068870_10109236 Ga0068870_101092363 193
214 3300005841 Ga0068863_100874231 Ga0068863_1008742311 193
215 3300005843 Ga0068860_100019413 Ga0068860_1000194137 193
216 3300005843 Ga0068860_100219507 Ga0068860_1002195072 193
217 3300006028 Ga0070717_10002404 Ga0070717_1000240411 193
218 3300006028 Ga0070717_10005064 Ga0070717_100050644 193
219 3300006028 Ga0070717_10010992 Ga0070717_100109927 193
220 3300006028 Ga0070717_10407630 Ga0070717_104076302 193
221 3300006042 Ga0075368_10008321 Ga0075368_100083214 193
222 3300006042 Ga0075368_10039209 Ga0075368_100392092 193
223 3300006042 Ga0075368_10067901 Ga0075368_100679012 193
224 3300006163 Ga0070715_10104633 Ga0070715_101046332 193
225 3300006173 Ga0070716_100352858 Ga0070716_1003528582 193
226 3300006177 Ga0075362_10160609 Ga0075362_101606092 193
227 3300006178 Ga0075367_10580233 Ga0075367_105802331 193
228 3300006195 Ga0075366_10003527 Ga0075366_100035278 193
229 3300006237 Ga0097621_100053049 Ga0097621_1000530494 193
230 3300006237 Ga0097621_100125479 Ga0097621_1001254792 193
231 3300006237 Ga0097621_100227312 Ga0097621_1002273121 193
232 3300006358 Ga0068871_100026092 Ga0068871_1000260928 193
233 3300006852 Ga0075433_10004588 Ga0075433_100045881 193
234 3300006871 Ga0075434_100000295 Ga0075434_10000029530 193
235 3300006871 Ga0075434_100032828 Ga0075434_1000328283 193
236 3300006871 Ga0075434_100342823 Ga0075434_1003428233 193
237 3300006914 Ga0075436_100001101 Ga0075436_10000110117 193
238 3300006914 Ga0075436_100005310 Ga0075436_1000053109 193
239 3300006914 Ga0075436_100057607 Ga0075436_1000576072 193
240 3300006931 Ga0097620_100000418 Ga0097620_10000041811 193
241 3300006931 Ga0097620_100126141 Ga0097620_1001261412 193
242 3300007076 Ga0075435_100000025 Ga0075435_10000002546 193
243 3300007076 Ga0075435_100036040 Ga0075435_1000360403 193
244 3300007076 Ga0075435_100039758 Ga0075435_1000397584 193
245 3300009093 Ga0105240_10041278 Ga0105240_100412781 193
246 3300009093 Ga0105240_10076981 Ga0105240_100769813 193
247 3300009093 Ga0105240_10108353 Ga0105240_101083533 193
248 3300009101 Ga0105247_10009654 Ga0105247_100096544 193
249 3300009174 Ga0105241_10063394 Ga0105241_100633942 193
250 3300009176 Ga0105242_10037701 Ga0105242_100377011 193
251 3300009177 Ga0105248_10078291 Ga0105248_100782912 193
252 3300009545 Ga0105237_10176019 Ga0105237_101760193 193
253 3300009545 Ga0105237_10664704 Ga0105237_106647042 193
254 3300009551 Ga0105238_10285501 Ga0105238_102855011 193
255 3300009551 Ga0105238_10411322 Ga0105238_104113222 193
256 3300013105 Ga0157369_10350128 Ga0157369_103501282 193
257 3300013105 Ga0157369_10495862 Ga0157369_104958622 193
258 3300013105 Ga0157369_10722062 Ga0157369_107220622 193
259 3300013296 Ga0157374_10000254 Ga0157374_1000025431 193
260 3300013297 Ga0157378_10000554 Ga0157378_1000055415 193
261 3300013297 Ga0157378_11524281 Ga0157378_115242812 193
262 3300013307 Ga0157372_10001984 Ga0157372_1000198415 193
263 3300013307 Ga0157372_10003830 Ga0157372_100038303 193
264 3300013307 Ga0157372_10015279 Ga0157372_100152794 193
265 3300013307 Ga0157372_10176433 Ga0157372_101764332 193
266 3300025898 Ga0207692_10478098 Ga0207692_104780982 193
267 3300025898 Ga0207692_10507679 Ga0207692_105076791 193
268 3300025899 Ga0207642_10008671 Ga0207642_100086713 193
269 3300025900 Ga0207710_10006090 Ga0207710_100060904 193
270 3300025903 Ga0207680_10126470 Ga0207680_101264702 193
271 3300025904 Ga0207647_10028240 Ga0207647_100282404 193
272 3300025904 Ga0207647_10189962 Ga0207647_101899622 193
273 3300025905 Ga0207685_10205557 Ga0207685_102055572 193
274 3300025906 Ga0207699_10061687 Ga0207699_100616872 193
275 3300025907 Ga0207645_10299494 Ga0207645_102994942 193
276 3300025908 Ga0207643_10087426 Ga0207643_100874262 193
277 3300025909 Ga0207705_10000723 Ga0207705_1000072320 193
278 3300025911 Ga0207654_10010946 Ga0207654_100109464 193
279 3300025911 Ga0207654_10042598 Ga0207654_100425982 193
280 3300025912 Ga0207707_10008797 Ga0207707_100087972 193
281 3300025912 Ga0207707_10012850 Ga0207707_100128508 193
282 3300025913 Ga0207695_10091543 Ga0207695_100915432 193
283 3300025913 Ga0207695_10154217 Ga0207695_101542174 193
284 3300025913 Ga0207695_10223414 Ga0207695_102234143 193
285 3300025914 Ga0207671_10004535 Ga0207671_100045354 193
286 3300025914 Ga0207671_10088142 Ga0207671_100881421 193
287 3300025915 Ga0207693_10009131 Ga0207693_100091318 193
288 3300025917 Ga0207660_10024966 Ga0207660_100249661 193
289 3300025917 Ga0207660_10105062 Ga0207660_101050622 193
290 3300025919 Ga0207657_10003667 Ga0207657_100036674 193
291 3300025919 Ga0207657_10012925 Ga0207657_100129258 193
292 3300025920 Ga0207649_10425202 Ga0207649_104252021 193
293 3300025921 Ga0207652_10045172 Ga0207652_100451723 193
294 3300025921 Ga0207652_10088087 Ga0207652_100880872 193
295 3300025921 Ga0207652_10118218 Ga0207652_101182182 193
296 3300025922 Ga0207646_10215745 Ga0207646_102157452 193
297 3300025923 Ga0207681_10134550 Ga0207681_101345502 193
298 3300025924 Ga0207694_10177493 Ga0207694_101774932 193
299 3300025924 Ga0207694_10391812 Ga0207694_103918122 193
300 3300025925 Ga0207650_10005500 Ga0207650_100055007 193
301 3300025927 Ga0207687_10001100 Ga0207687_100011003 193
302 3300025928 Ga0207700_10019942 Ga0207700_100199426 193
303 3300025928 Ga0207700_10136536 Ga0207700_101365362 193
304 3300025929 Ga0207664_10041519 Ga0207664_100415192 193
305 3300025929 Ga0207664_10141429 Ga0207664_101414292 193
306 3300025929 Ga0207664_10281554 Ga0207664_102815543 193
307 3300025929 Ga0207664_10917805 Ga0207664_109178051 193
308 3300025932 Ga0207690_10296121 Ga0207690_102961211 193
309 3300025933 Ga0207706_10000880 Ga0207706_1000088025 193
310 3300025933 Ga0207706_10094879 Ga0207706_100948792 193
311 3300025936 Ga0207670_10047313 Ga0207670_100473133 193
312 3300025936 Ga0207670_10180636 Ga0207670_101806362 193
313 3300025937 Ga0207669_10322540 Ga0207669_103225401 193
314 3300025938 Ga0207704_10204765 Ga0207704_102047652 193
315 3300025939 Ga0207665_10381303 Ga0207665_103813032 193
316 3300025941 Ga0207711_10001004 Ga0207711_100010045 193
317 3300025942 Ga0207689_10051957 Ga0207689_100519571 193
318 3300025944 Ga0207661_10193967 Ga0207661_101939672 193
319 3300025945 Ga0207679_10008269 Ga0207679_100082691 193
320 3300025945 Ga0207679_10148014 Ga0207679_101480142 193
321 3300025949 Ga0207667_10008905 Ga0207667_100089053 193
322 3300025949 Ga0207667_10012807 Ga0207667_100128078 193
323 3300025949 Ga0207667_10046283 Ga0207667_100462832 193
324 3300025972 Ga0207668_10016324 Ga0207668_100163243 193
325 3300025981 Ga0207640_10009050 Ga0207640_100090506 193
326 3300025981 Ga0207640_10010511 Ga0207640_100105112 193
327 3300025986 Ga0207658_10194809 Ga0207658_101948092 193
328 3300026023 Ga0207677_10008642 Ga0207677_100086425 193
329 3300026023 Ga0207677_10039324 Ga0207677_100393241 193
330 3300026041 Ga0207639_10887305 Ga0207639_108873051 193
331 3300026067 Ga0207678_10008712 Ga0207678_100087125 193
332 3300026067 Ga0207678_10009433 Ga0207678_100094334 193
333 3300026075 Ga0207708_10120793 Ga0207708_101207932 193
334 3300026078 Ga0207702_10118623 Ga0207702_101186232 193
335 3300026078 Ga0207702_10323709 Ga0207702_103237092 193
336 3300026089 Ga0207648_10002663 Ga0207648_100026631 193
337 3300026089 Ga0207648_10005754 Ga0207648_100057544 193
338 3300026095 Ga0207676_10098771 Ga0207676_100987711 193
339 3300026095 Ga0207676_10758061 Ga0207676_107580611 193
340 3300026116 Ga0207674_10000514 Ga0207674_1000051425 193
341 3300026116 Ga0207674_10002218 Ga0207674_100022189 193
342 3300026116 Ga0207674_10124852 Ga0207674_101248522 193
343 3300026121 Ga0207683_10221923 Ga0207683_102219233 193
344 3300026142 Ga0207698_10610651 Ga0207698_106106512 193
345 3300027866 Ga0209813_10039490 Ga0209813_100394902 193
346 3300028379 Ga0268266_10047429 Ga0268266_100474293 193
347 3300028379 Ga0268266_10171856 Ga0268266_101718563 193
348 3300028381 Ga0268264_10030574 Ga0268264_100305742 193
349 3300028381 Ga0268264_10434691 Ga0268264_104346912 193
350 3300031235 Ga0265330_10001607 Ga0265330_100016077 193
351 3300031247 Ga0265340_10168715 Ga0265340_101687151 193
352 3300031711 Ga0265314_10000920 Ga0265314_1000092015 193
353 3300031711 Ga0265314_10036249 Ga0265314_100362492 193
354 3300031711 Ga0265314_10302743 Ga0265314_103027431 193
355 3300035091 Ga0373951_0084832 Ga0373951_0084832_128_709 193
356 3300035111 Ga0373923_0098120 Ga0373923_0098120_521_1102 193
357 3300035113 Ga0373936_0037405 Ga0373936_0037405_867_1448 193
358 3300035114 Ga0373939_0039784 Ga0373939_0039784_688_1269 193
359 3300035115 Ga0373941_0197642 Ga0373941_0197642_140_721 193
360 3300035121 Ga0373960_0028999 Ga0373960_0028999_534_1115 193
361 3300035170 Ga0373943_0007718 Ga0373943_0007718_2352_2933 193
362 3300035170 Ga0373943_0225384 Ga0373943_0225384_230_811 193
363 3300035207 Ga0373942_0095978 Ga0373942_0095978_23_604 193
364 3300035691 Ga0373931_0015153 Ga0373931_0015153_2533_3114 193
365 3300035691 Ga0373931_0129277 Ga0373931_0129277_391_972 193
366 3300035692 Ga0373935_0003560 Ga0373935_0003560_6774_7355 193
367 3300035692 Ga0373935_0167236 Ga0373935_0167236_64_645 193
368 3300035695 Ga0373927_0006915 Ga0373927_0006915_6821_7402 193
369 3300035695 Ga0373927_0070326 Ga0373927_0070326_476_1057 193
370 3300035724 Ga0373933_0082901 Ga0373933_0082901_506_1087 193
371 3300036401 Ga0373937_0122911 Ga0373937_0122911_1210_1791 193
372 3300037068 Ga0373925_0261921 Ga0373925_0261921_416_997 193
373 3300039450 Ga0436363_0695341 Ga0436363_0695341_38_625 193
374 3300042876 Ga0451577_0000331 Ga0451577_0000331_12941_13525 193
375 3300044673 Ga0453683_0009319 Ga0453683_0009319_4763_5347 193
376 3300044693 Ga0466961_0497421 Ga0466961_0497421_36_617 193
377 3300044694 Ga0466963_0411409 Ga0466963_0411409_273_854 193
378 3300044712 Ga0453684_0000429 Ga0453684_0000429_56215_56799 193
379 3300044712 Ga0453684_1033931 Ga0453684_1033931_59_640 193
380 3300045051 Ga0451576_0002208 Ga0451576_0002208_20620_21204 193
381 3300045051 Ga0451576_0331805 Ga0451576_0331805_919_1512 193
382 3300045051 Ga0451576_1016494 Ga0451576_1016494_113_694 193
383 3300045051 Ga0451576_1577157 Ga0451576_1577157_28_609 193
384 3300046472 Ga0495580_0001939 Ga0495580_0001939_3961_4542 193
385 3300046472 Ga0495580_0007136 Ga0495580_0007136_6981_7562 193
386 3300046472 Ga0495580_0019097 Ga0495580_0019097_4161_4742 193
387 3300046472 Ga0495580_0038482 Ga0495580_0038482_217_798 193
388 3300046473 Ga0495582_0000976 Ga0495582_0000976_2808_3389 193
389 3300046477 Ga0495664_0581525 Ga0495664_0581525_47_628 193
390 3300046517 Ga0495630_0023613 Ga0495630_0023613_2256_2837 193
391 3300046517 Ga0495630_0148197 Ga0495630_0148197_645_1226 193
392 3300046526 Ga0495666_0147946 Ga0495666_0147946_479_1060 193
393 3300046529 Ga0495652_0193542 Ga0495652_0193542_372_953 193
394 3300046531 Ga0495665_0003216 Ga0495665_0003216_2336_2917 193
395 3300046536 Ga0495587_0065189 Ga0495587_0065189_809_1390 193
396 3300046559 Ga0495667_0098922 Ga0495667_0098922_733_1314 193
397 3300046679 Ga0495623_0110870 Ga0495623_0110870_21_602 193
398 3300046679 Ga0495623_0186837 Ga0495623_0186837_484_1065 193
399 3300046680 Ga0495646_0343968 Ga0495646_0343968_117_698 193
400 3300047315 Ga0495581_0032535 Ga0495581_0032535_1407_1988 193
401 3300047319 Ga0495674_0676253 Ga0495674_0676253_58_639 193
402 3300047444 Ga0495675_0068352 Ga0495675_0068352_732_1313 193
403 3300048088 Ga0495602_0021528 Ga0495602_0021528_1852_2433 193
404 3300048088 Ga0495602_0054926 Ga0495602_0054926_1309_1890 193
405 3300048905 Ga0496102_0135493 Ga0496102_0135493_1228_1809 193
406 3300048906 Ga0496103_0036085 Ga0496103_0036085_550_1131 193
407 3300048907 Ga0496104_0169064 Ga0496104_0169064_445_1026 193
408 3300048907 Ga0496104_0199351 Ga0496104_0199351_186_854 193
409 3300048909 Ga0496106_0073362 Ga0496106_0073362_1812_2393 193
410 3300048912 Ga0496109_1024050 Ga0496109_1024050_13_594 193
411 3300048915 Ga0496112_0040162 Ga0496112_0040162_2382_2963 193
412 3300048915 Ga0496112_0168721 Ga0496112_0168721_1544_2125 193
413 3300048915 Ga0496112_0785955 Ga0496112_0785955_236_817 193
414 3300049570 Ga0501033_0619943 Ga0501033_0619943_89_685 193
415 3300049573 Ga0501037_0085974 Ga0501037_0085974_298_894 193
416 3300049581 Ga0501047_0067889 Ga0501047_0067889_350_946 193
417 3300049586 Ga0501070_0353266 Ga0501070_0353266_519_1115 193
418 3300049587 Ga0501071_0299034 Ga0501071_0299034_178_777 193
419 3300049589 Ga0501073_0008916 Ga0501073_0008916_2082_2666 193
420 3300049741 Ga0501079_0276447 Ga0501079_0276447_317_916 193
421 3300050489 nmdc:mga03683_230672_c1 nmdc:mga03683_230672_c1_161_751 193
422 3300050490 nmdc:mga03n38_48078_c1 nmdc:mga03n38_48078_c1_696_1286 193
423 3300050493 nmdc:mga0k408_25943_c1 nmdc:mga0k408_25943_c1_1250_1840 193
424 3300050495 nmdc:mga04h51_12514_c1 nmdc:mga04h51_12514_c1_798_1388 193
425 3300050496 nmdc:mga07m45_12720_c1 nmdc:mga07m45_12720_c1_3254_3844 193
426 3300050512 nmdc:mga0n895_103_c1 nmdc:mga0n895_103_c1_17174_17758 193
427 3300050512 nmdc:mga0n895_366171_c1 nmdc:mga0n895_366171_c1_392_973 193
428 3300050512 nmdc:mga0n895_507085_c1 nmdc:mga0n895_507085_c1_426_1007 193
429 3300050513 nmdc:mga0rr50_27742_c1 nmdc:mga0rr50_27742_c1_1386_1967 193
430 3300050513 nmdc:mga0rr50_52330_c1 nmdc:mga0rr50_52330_c1_2065_2646 193
431 3300050513 nmdc:mga0rr50_881_c1 nmdc:mga0rr50_881_c1_7464_8048 193
432 3300050514 nmdc:mga08x19_49976_c1 nmdc:mga08x19_49976_c1_833_1414 193
433 3300050514 nmdc:mga08x19_7511_c1 nmdc:mga08x19_7511_c1_1474_2058 193
434 3300050514 nmdc:mga08x19_9557_c1 nmdc:mga08x19_9557_c1_2172_2753 193
435 3300053078 Ga0495612_0145317 Ga0495612_0145317_28_609 193
436 3300054114 Ga0501084_0042105 Ga0501084_0042105_122_706 193
437 3300060353 Ga0501082_0467300 Ga0501082_0467300_442_1026 193
438 3300005434 Ga0070709_10782961 Ga0070709_107829611 194
439 3300005445 Ga0070708_100027906 Ga0070708_1000279064 194
440 3300005455 Ga0070663_100102325 Ga0070663_1001023252 194
441 3300005468 Ga0070707_100274541 Ga0070707_1002745413 194
442 3300005530 Ga0070679_100473447 Ga0070679_1004734471 194
443 3300005563 Ga0068855_100147526 Ga0068855_1001475263 194
444 3300005616 Ga0068852_100127510 Ga0068852_1001275102 194
445 3300007265 Ga0099794_10362801 Ga0099794_103628011 194
446 3300013105 Ga0157369_10062504 Ga0157369_100625042 194
447 3300014325 Ga0163163_10223800 Ga0163163_102238002 194
448 3300014969 Ga0157376_10087658 Ga0157376_100876582 194
449 3300025909 Ga0207705_10657420 Ga0207705_106574201 194
450 3300025922 Ga0207646_10654400 Ga0207646_106544001 194
451 3300025949 Ga0207667_10072845 Ga0207667_100728451 194
452 3300026067 Ga0207678_10001010 Ga0207678_100010109 194
453 3300048907 Ga0496104_0790134 Ga0496104_0790134_29_619 194
454 3300048917 Ga0496114_0197514 Ga0496114_0197514_113_703 194
455 3300049588 Ga0501072_0387631 Ga0501072_0387631_205_813 194
456 3300049592 Ga0501076_0419644 Ga0501076_0419644_449_1057 194
457 3300005293 Ga0065715_10184495 Ga0065715_101844952 195
458 3300005334 Ga0068869_100002537 Ga0068869_1000025371 195
459 3300005338 Ga0068868_100072644 Ga0068868_1000726442 195
460 3300005435 Ga0070714_100059829 Ga0070714_1000598293 195
461 3300005445 Ga0070708_100081593 Ga0070708_1000815932 195
462 3300005467 Ga0070706_100025488 Ga0070706_1000254885 195
463 3300005467 Ga0070706_100046337 Ga0070706_1000463372 195
464 3300005468 Ga0070707_100207310 Ga0070707_1002073101 195
465 3300005468 Ga0070707_100462659 Ga0070707_1004626591 195
466 3300005543 Ga0070672_100158642 Ga0070672_1001586422 195
467 3300005563 Ga0068855_100203147 Ga0068855_1002031472 195
468 3300005616 Ga0068852_100164463 Ga0068852_1001644632 195
469 3300005617 Ga0068859_100016871 Ga0068859_1000168713 195
470 3300005719 Ga0068861_100083767 Ga0068861_1000837672 195
471 3300005841 Ga0068863_100026510 Ga0068863_1000265102 195
472 3300005841 Ga0068863_100099134 Ga0068863_1000991342 195
473 3300005842 Ga0068858_100001025 Ga0068858_1000010254 195
474 3300005983 Ga0081540_1140573 Ga0081540_11405732 195
475 3300006028 Ga0070717_10070371 Ga0070717_100703713 195
476 3300006881 Ga0068865_100005849 Ga0068865_1000058494 195
477 3300006931 Ga0097620_100016871 Ga0097620_1000168713 195
478 3300009093 Ga0105240_10214715 Ga0105240_102147152 195
479 3300009098 Ga0105245_10093699 Ga0105245_100936992 195
480 3300009176 Ga0105242_10139623 Ga0105242_101396232 195
481 3300009545 Ga0105237_10045385 Ga0105237_100453852 195
482 3300010375 Ga0105239_10012609 Ga0105239_100126092 195
483 3300011119 Ga0105246_10297511 Ga0105246_102975112 195
484 3300013105 Ga0157369_11267596 Ga0157369_112675961 195
485 3300013296 Ga0157374_10058425 Ga0157374_100584252 195
486 3300013306 Ga0163162_10001180 Ga0163162_1000118023 195
487 3300013306 Ga0163162_10499787 Ga0163162_104997872 195
488 3300013308 Ga0157375_10015800 Ga0157375_100158003 195
489 3300014326 Ga0157380_10800762 Ga0157380_108007622 195
490 3300014968 Ga0157379_10123908 Ga0157379_101239083 195
491 3300014968 Ga0157379_10136581 Ga0157379_101365812 195
492 3300021384 Ga0213876_10200798 Ga0213876_102007982 195
493 3300024225 Ga0224572_1000076 Ga0224572_10000762 195
494 3300024227 Ga0228598_1000540 Ga0228598_10005402 195
495 3300025904 Ga0207647_10006190 Ga0207647_100061902 195
496 3300025910 Ga0207684_10107417 Ga0207684_101074172 195
497 3300025927 Ga0207687_10122411 Ga0207687_101224112 195
498 3300025929 Ga0207664_10176617 Ga0207664_101766172 195
499 3300025933 Ga0207706_10336593 Ga0207706_103365932 195
500 3300025942 Ga0207689_10000300 Ga0207689_1000030029 195
501 3300026023 Ga0207677_10068035 Ga0207677_100680352 195
502 3300026035 Ga0207703_10003668 Ga0207703_100036684 195
503 3300026088 Ga0207641_10084058 Ga0207641_100840582 195
504 3300026089 Ga0207648_10311104 Ga0207648_103111042 195
505 3300026118 Ga0207675_100487967 Ga0207675_1004879672 195
506 3300028381 Ga0268264_10065925 Ga0268264_100659252 195
507 3300028800 Ga0265338_10151941 Ga0265338_101519412 195
508 3300030878 Ga0265770_1019314 Ga0265770_10193142 195
509 3300031090 Ga0265760_10000664 Ga0265760_100006646 195
510 3300031090 Ga0265760_10000741 Ga0265760_100007417 195
511 3300035170 Ga0373943_0300394 Ga0373943_0300394_288_875 195
512 3300035725 Ga0373947_0265658 Ga0373947_0265658_236_823 195
513 3300039437 Ga0436365_0979910 Ga0436365_0979910_742_1335 195
514 3300039437 Ga0436365_1144293 Ga0436365_1144293_1331_1924 195
515 3300039450 Ga0436363_1324681 Ga0436363_1324681_1317_1913 195
516 3300045976 Ga0466967_0312528 Ga0466967_0312528_175_762 195
517 3300046472 Ga0495580_0009328 Ga0495580_0009328_3926_4513 195
518 3300048915 Ga0496112_0000688 Ga0496112_0000688_14798_15385 195
519 3300048917 Ga0496114_0441930 Ga0496114_0441930_391_978 195
520 3300049583 Ga0501067_0503958 Ga0501067_0503958_55_642 195
521 3300049744 Ga0501083_0448779 Ga0501083_0448779_195_785 195
522 3300000546 LJNas_1000342 LJNas_10003423 196
523 3300001976 JGI24752J21851_1000910 JGI24752J21851_10009104 196
524 3300002239 JGI24034J26672_10030077 JGI24034J26672_100300772 196
525 3300005290 Ga0065712_10155690 Ga0065712_101556902 196
526 3300005327 Ga0070658_10539358 Ga0070658_105393582 196
527 3300005328 Ga0070676_10004984 Ga0070676_100049843 196
528 3300005329 Ga0070683_100000704 Ga0070683_1000007046 196
529 3300005330 Ga0070690_100024489 Ga0070690_1000244892 196
530 3300005333 Ga0070677_10053135 Ga0070677_100531352 196
531 3300005335 Ga0070666_10180028 Ga0070666_101800282 196
532 3300005336 Ga0070680_100282941 Ga0070680_1002829411 196
533 3300005338 Ga0068868_100129068 Ga0068868_1001290682 196
534 3300005338 Ga0068868_100187907 Ga0068868_1001879072 196
535 3300005338 Ga0068868_100430568 Ga0068868_1004305682 196
536 3300005339 Ga0070660_100014667 Ga0070660_1000146673 196
537 3300005340 Ga0070689_100013990 Ga0070689_1000139904 196
538 3300005343 Ga0070687_100005205 Ga0070687_1000052054 196
539 3300005344 Ga0070661_100045393 Ga0070661_1000453934 196
540 3300005347 Ga0070668_100007418 Ga0070668_1000074184 196
541 3300005353 Ga0070669_100064364 Ga0070669_1000643642 196
542 3300005353 Ga0070669_100997533 Ga0070669_1009975331 196
543 3300005354 Ga0070675_100043128 Ga0070675_1000431284 196
544 3300005364 Ga0070673_100137611 Ga0070673_1001376113 196
545 3300005365 Ga0070688_100008741 Ga0070688_1000087413 196
546 3300005366 Ga0070659_100116782 Ga0070659_1001167823 196
547 3300005366 Ga0070659_100181936 Ga0070659_1001819362 196
548 3300005367 Ga0070667_100069184 Ga0070667_1000691842 196
549 3300005435 Ga0070714_100000047 Ga0070714_10000004743 196
550 3300005435 Ga0070714_100256355 Ga0070714_1002563553 196
551 3300005435 Ga0070714_100588692 Ga0070714_1005886922 196
552 3300005437 Ga0070710_10010881 Ga0070710_100108814 196
553 3300005439 Ga0070711_100003811 Ga0070711_1000038117 196
554 3300005439 Ga0070711_100055759 Ga0070711_1000557594 196
555 3300005439 Ga0070711_100057805 Ga0070711_1000578052 196
556 3300005445 Ga0070708_100001160 Ga0070708_1000011607 196
557 3300005445 Ga0070708_100004782 Ga0070708_1000047823 196
558 3300005445 Ga0070708_100043931 Ga0070708_1000439312 196
559 3300005455 Ga0070663_100062577 Ga0070663_1000625772 196
560 3300005458 Ga0070681_10045959 Ga0070681_100459592 196
561 3300005459 Ga0068867_100345427 Ga0068867_1003454272 196
562 3300005466 Ga0070685_10069247 Ga0070685_100692473 196
563 3300005467 Ga0070706_100000430 Ga0070706_10000043049 196
564 3300005467 Ga0070706_100000710 Ga0070706_10000071020 196
565 3300005467 Ga0070706_100020174 Ga0070706_1000201742 196
566 3300005468 Ga0070707_100000607 Ga0070707_1000006077 196
567 3300005468 Ga0070707_100171160 Ga0070707_1001711603 196
568 3300005468 Ga0070707_100801266 Ga0070707_1008012662 196
569 3300005471 Ga0070698_100000091 Ga0070698_10000009157 196
570 3300005471 Ga0070698_100155391 Ga0070698_1001553912 196
571 3300005518 Ga0070699_100013395 Ga0070699_1000133953 196
572 3300005518 Ga0070699_100087304 Ga0070699_1000873042 196
573 3300005530 Ga0070679_100478762 Ga0070679_1004787621 196
574 3300005530 Ga0070679_100517902 Ga0070679_1005179021 196
575 3300005535 Ga0070684_100003207 Ga0070684_1000032074 196
576 3300005535 Ga0070684_100383253 Ga0070684_1003832531 196
577 3300005536 Ga0070697_100001219 Ga0070697_10000121913 196
578 3300005536 Ga0070697_100001461 Ga0070697_1000014617 196
579 3300005536 Ga0070697_100020940 Ga0070697_1000209402 196
580 3300005536 Ga0070697_100064481 Ga0070697_1000644812 196
581 3300005536 Ga0070697_100391018 Ga0070697_1003910182 196
582 3300005536 Ga0070697_100787639 Ga0070697_1007876391 196
583 3300005539 Ga0068853_100346819 Ga0068853_1003468192 196
584 3300005543 Ga0070672_100060922 Ga0070672_1000609223 196
585 3300005544 Ga0070686_100008501 Ga0070686_1000085014 196
586 3300005547 Ga0070693_100474877 Ga0070693_1004748771 196
587 3300005563 Ga0068855_100031927 Ga0068855_1000319273 196
588 3300005578 Ga0068854_100064803 Ga0068854_1000648033 196
589 3300005578 Ga0068854_100308735 Ga0068854_1003087352 196
590 3300005614 Ga0068856_100021283 Ga0068856_1000212834 196
591 3300005616 Ga0068852_100038418 Ga0068852_1000384182 196
592 3300005617 Ga0068859_100071137 Ga0068859_1000711372 196
593 3300005718 Ga0068866_10037368 Ga0068866_100373683 196
594 3300005718 Ga0068866_10201822 Ga0068866_102018222 196
595 3300005719 Ga0068861_100306472 Ga0068861_1003064722 196
596 3300005719 Ga0068861_100658232 Ga0068861_1006582321 196
597 3300005834 Ga0068851_10002042 Ga0068851_100020425 196
598 3300005843 Ga0068860_100054827 Ga0068860_1000548274 196
599 3300006028 Ga0070717_10000592 Ga0070717_1000059222 196
600 3300006028 Ga0070717_10211575 Ga0070717_102115752 196
601 3300006028 Ga0070717_10322499 Ga0070717_103224992 196
602 3300006163 Ga0070715_10033994 Ga0070715_100339942 196
603 3300006163 Ga0070715_10258998 Ga0070715_102589981 196
604 3300006173 Ga0070716_100004330 Ga0070716_1000043304 196
605 3300006173 Ga0070716_100020309 Ga0070716_1000203094 196
606 3300006173 Ga0070716_100377611 Ga0070716_1003776111 196
607 3300006173 Ga0070716_100407866 Ga0070716_1004078661 196
608 3300006175 Ga0070712_100000132 Ga0070712_10000013234 196
609 3300006175 Ga0070712_100012732 Ga0070712_1000127325 196
610 3300006175 Ga0070712_100064725 Ga0070712_1000647254 196
611 3300006175 Ga0070712_100124098 Ga0070712_1001240982 196
612 3300006237 Ga0097621_100000840 Ga0097621_10000084017 196
613 3300006237 Ga0097621_100030626 Ga0097621_1000306263 196
614 3300006358 Ga0068871_100017898 Ga0068871_1000178984 196
615 3300006931 Ga0097620_100071142 Ga0097620_1000711422 196
616 3300007076 Ga0075435_100046895 Ga0075435_1000468952 196
617 3300007076 Ga0075435_100444203 Ga0075435_1004442031 196
618 3300009093 Ga0105240_10020606 Ga0105240_100206065 196
619 3300009093 Ga0105240_10586626 Ga0105240_105866262 196
620 3300009098 Ga0105245_10000741 Ga0105245_1000074123 196
621 3300009098 Ga0105245_10012235 Ga0105245_100122353 196
622 3300009101 Ga0105247_10017244 Ga0105247_100172442 196
623 3300009174 Ga0105241_10139656 Ga0105241_101396561 196
624 3300009176 Ga0105242_10020694 Ga0105242_100206944 196
625 3300009177 Ga0105248_10022175 Ga0105248_100221754 196
626 3300009177 Ga0105248_10855439 Ga0105248_108554392 196
627 3300009545 Ga0105237_10110696 Ga0105237_101106962 196
628 3300009545 Ga0105237_10608632 Ga0105237_106086322 196
629 3300010159 Ga0099796_10023123 Ga0099796_100231232 196
630 3300010375 Ga0105239_10044133 Ga0105239_100441332 196
631 3300013100 Ga0157373_10009287 Ga0157373_100092872 196
632 3300013102 Ga0157371_10028747 Ga0157371_100287473 196
633 3300013105 Ga0157369_10542291 Ga0157369_105422912 196
634 3300013296 Ga0157374_10050911 Ga0157374_100509114 196
635 3300013297 Ga0157378_10003465 Ga0157378_1000346510 196
636 3300013297 Ga0157378_10238162 Ga0157378_102381622 196
637 3300013307 Ga0157372_10052817 Ga0157372_100528174 196
638 3300013307 Ga0157372_10119184 Ga0157372_101191843 196
639 3300014326 Ga0157380_10015217 Ga0157380_100152172 196
640 3300014745 Ga0157377_10002280 Ga0157377_100022805 196
641 3300014968 Ga0157379_10023584 Ga0157379_100235843 196
642 3300014969 Ga0157376_10022460 Ga0157376_100224604 196
643 3300014969 Ga0157376_10754716 Ga0157376_107547162 196
644 3300015261 Ga0182006_1116740 Ga0182006_11167402 196
645 3300017792 Ga0163161_10029760 Ga0163161_100297603 196
646 3300022730 Ga0224570_100839 Ga0224570_1008392 196
647 3300024225 Ga0224572_1010563 Ga0224572_10105632 196
648 3300024225 Ga0224572_1053580 Ga0224572_10535801 196
649 3300024227 Ga0228598_1030768 Ga0228598_10307681 196
650 3300025321 Ga0207656_10001134 Ga0207656_100011342 196
651 3300025893 Ga0207682_10046546 Ga0207682_100465462 196
652 3300025898 Ga0207692_10040352 Ga0207692_100403522 196
653 3300025898 Ga0207692_10056291 Ga0207692_100562913 196
654 3300025899 Ga0207642_10420757 Ga0207642_104207571 196
655 3300025901 Ga0207688_10006430 Ga0207688_100064306 196
656 3300025903 Ga0207680_10047873 Ga0207680_100478732 196
657 3300025904 Ga0207647_10015515 Ga0207647_100155152 196
658 3300025905 Ga0207685_10259791 Ga0207685_102597911 196
659 3300025906 Ga0207699_10035039 Ga0207699_100350392 196
660 3300025907 Ga0207645_10003011 Ga0207645_100030119 196
661 3300025908 Ga0207643_10104823 Ga0207643_101048232 196
662 3300025910 Ga0207684_10000383 Ga0207684_100003836 196
663 3300025910 Ga0207684_10003824 Ga0207684_1000382411 196
664 3300025910 Ga0207684_10032595 Ga0207684_100325955 196
665 3300025912 Ga0207707_10043693 Ga0207707_100436931 196
666 3300025913 Ga0207695_10081298 Ga0207695_100812982 196
667 3300025915 Ga0207693_10001889 Ga0207693_100018893 196
668 3300025915 Ga0207693_10004669 Ga0207693_1000466912 196
669 3300025915 Ga0207693_10013125 Ga0207693_100131255 196
670 3300025915 Ga0207693_10174255 Ga0207693_101742552 196
671 3300025916 Ga0207663_10043419 Ga0207663_100434194 196
672 3300025916 Ga0207663_10056071 Ga0207663_100560712 196
673 3300025916 Ga0207663_10084573 Ga0207663_100845732 196
674 3300025916 Ga0207663_10097572 Ga0207663_100975722 196
675 3300025916 Ga0207663_10194318 Ga0207663_101943183 196
676 3300025919 Ga0207657_10007212 Ga0207657_1000721210 196
677 3300025920 Ga0207649_10002381 Ga0207649_100023814 196
678 3300025921 Ga0207652_10595484 Ga0207652_105954842 196
679 3300025922 Ga0207646_10000229 Ga0207646_1000022921 196
680 3300025922 Ga0207646_10177886 Ga0207646_101778863 196
681 3300025923 Ga0207681_10066782 Ga0207681_100667822 196
682 3300025925 Ga0207650_10001413 Ga0207650_1000141311 196
683 3300025926 Ga0207659_10018944 Ga0207659_100189443 196
684 3300025927 Ga0207687_10072265 Ga0207687_100722652 196
685 3300025928 Ga0207700_10160412 Ga0207700_101604123 196
686 3300025929 Ga0207664_10000076 Ga0207664_1000007614 196
687 3300025929 Ga0207664_10261413 Ga0207664_102614132 196
688 3300025929 Ga0207664_10641119 Ga0207664_106411192 196
689 3300025929 Ga0207664_10703356 Ga0207664_107033562 196
690 3300025932 Ga0207690_10020615 Ga0207690_100206153 196
691 3300025933 Ga0207706_10000790 Ga0207706_1000079027 196
692 3300025934 Ga0207686_10035930 Ga0207686_100359302 196
693 3300025936 Ga0207670_10005022 Ga0207670_100050225 196
694 3300025939 Ga0207665_10000085 Ga0207665_1000008551 196
695 3300025939 Ga0207665_10030051 Ga0207665_100300512 196
696 3300025939 Ga0207665_10050444 Ga0207665_100504442 196
697 3300025939 Ga0207665_10080110 Ga0207665_100801101 196
698 3300025939 Ga0207665_10091791 Ga0207665_100917912 196
699 3300025939 Ga0207665_10101498 Ga0207665_101014982 196
700 3300025939 Ga0207665_10192209 Ga0207665_101922092 196
701 3300025939 Ga0207665_10272479 Ga0207665_102724792 196
702 3300025940 Ga0207691_10001778 Ga0207691_1000177811 196
703 3300025941 Ga0207711_10089923 Ga0207711_100899232 196
704 3300025941 Ga0207711_10098663 Ga0207711_100986632 196
705 3300025942 Ga0207689_10006573 Ga0207689_100065736 196
706 3300025944 Ga0207661_10000720 Ga0207661_100007202 196
707 3300025945 Ga0207679_10000359 Ga0207679_1000035911 196
708 3300025960 Ga0207651_10060678 Ga0207651_100606783 196
709 3300025960 Ga0207651_10083894 Ga0207651_100838942 196
710 3300025981 Ga0207640_10067752 Ga0207640_100677522 196
711 3300025986 Ga0207658_10084780 Ga0207658_100847802 196
712 3300025986 Ga0207658_10231070 Ga0207658_102310702 196
713 3300026023 Ga0207677_10080754 Ga0207677_100807542 196
714 3300026067 Ga0207678_10000498 Ga0207678_100004989 196
715 3300026075 Ga0207708_10115810 Ga0207708_101158102 196
716 3300026078 Ga0207702_10014378 Ga0207702_100143782 196
717 3300026078 Ga0207702_10225798 Ga0207702_102257982 196
718 3300026088 Ga0207641_10000147 Ga0207641_10000147100 196
719 3300026089 Ga0207648_10001035 Ga0207648_100010352 196
720 3300026089 Ga0207648_10451093 Ga0207648_104510932 196
721 3300026095 Ga0207676_10001035 Ga0207676_1000103510 196
722 3300026116 Ga0207674_10000432 Ga0207674_1000043243 196
723 3300026116 Ga0207674_10046839 Ga0207674_100468393 196
724 3300026118 Ga0207675_100044794 Ga0207675_1000447941 196
725 3300026142 Ga0207698_10874448 Ga0207698_108744481 196
726 3300028017 Ga0265356_1001311 Ga0265356_10013114 196
727 3300028380 Ga0268265_10039285 Ga0268265_100392854 196
728 3300028381 Ga0268264_10034688 Ga0268264_100346883 196
729 3300028381 Ga0268264_10087408 Ga0268264_100874082 196
730 3300028800 Ga0265338_10021209 Ga0265338_100212094 196
731 3300030760 Ga0265762_1000668 Ga0265762_10006682 196
732 3300030760 Ga0265762_1003454 Ga0265762_10034542 196
733 3300030878 Ga0265770_1001315 Ga0265770_10013152 196
734 3300030879 Ga0265765_1000051 Ga0265765_10000515 196
735 3300031090 Ga0265760_10006543 Ga0265760_100065433 196
736 3300031090 Ga0265760_10007699 Ga0265760_100076992 196
737 3300031090 Ga0265760_10082693 Ga0265760_100826932 196
738 3300031249 Ga0265339_10048893 Ga0265339_100488932 196
739 3300031249 Ga0265339_10199481 Ga0265339_101994811 196
740 3300031344 Ga0265316_10005890 Ga0265316_100058903 196
741 3300031344 Ga0265316_10181639 Ga0265316_101816391 196
742 3300031711 Ga0265314_10043074 Ga0265314_100430742 196
743 3300035086 Ga0373934_0004450 Ga0373934_0004450_129_719 196
744 3300035111 Ga0373923_0010879 Ga0373923_0010879_775_1365 196
745 3300035111 Ga0373923_0108802 Ga0373923_0108802_440_1030 196
746 3300035113 Ga0373936_0078030 Ga0373936_0078030_320_910 196
747 3300035116 Ga0373945_0001902 Ga0373945_0001902_1655_2245 196
748 3300035119 Ga0373956_0041590 Ga0373956_0041590_1262_1852 196
749 3300035170 Ga0373943_0000480 Ga0373943_0000480_12754_13344 196
750 3300035170 Ga0373943_0359292 Ga0373943_0359292_64_654 196
751 3300035171 Ga0373946_0006365 Ga0373946_0006365_3162_3752 196
752 3300035172 Ga0373955_0217433 Ga0373955_0217433_436_1026 196
753 3300035172 Ga0373955_0417008 Ga0373955_0417008_148_738 196
754 3300035410 Ga0373924_0005123 Ga0373924_0005123_2006_2596 196
755 3300035410 Ga0373924_0099101 Ga0373924_0099101_141_731 196
756 3300035691 Ga0373931_0232630 Ga0373931_0232630_265_855 196
757 3300035692 Ga0373935_0000474 Ga0373935_0000474_2101_2691 196
758 3300035692 Ga0373935_0089675 Ga0373935_0089675_842_1432 196
759 3300035695 Ga0373927_0000433 Ga0373927_0000433_29520_30110 196
760 3300035695 Ga0373927_0442217 Ga0373927_0442217_74_664 196
761 3300035724 Ga0373933_0021611 Ga0373933_0021611_701_1291 196
762 3300035724 Ga0373933_0022965 Ga0373933_0022965_2733_3323 196
763 3300035724 Ga0373933_0038036 Ga0373933_0038036_1997_2587 196
764 3300035725 Ga0373947_0000115 Ga0373947_0000115_37951_38541 196
765 3300035725 Ga0373947_0231523 Ga0373947_0231523_54_716 196
766 3300036401 Ga0373937_0020629 Ga0373937_0020629_1705_2295 196
767 3300036401 Ga0373937_0034114 Ga0373937_0034114_3842_4432 196
768 3300036401 Ga0373937_0408020 Ga0373937_0408020_629_1219 196
769 3300036401 Ga0373937_0564829 Ga0373937_0564829_444_1034 196
770 3300037068 Ga0373925_0001531 Ga0373925_0001531_11645_12235 196
771 3300037068 Ga0373925_0172517 Ga0373925_0172517_115_705 196
772 3300037068 Ga0373925_0367561 Ga0373925_0367561_83_676 196
773 3300039450 Ga0436363_1227896 Ga0436363_1227896_27_623 196
774 3300046463 Ga0495653_0125339 Ga0495653_0125339_828_1418 196
775 3300046472 Ga0495580_0001849 Ga0495580_0001849_14259_14849 196
776 3300046472 Ga0495580_0007791 Ga0495580_0007791_197_787 196
777 3300046472 Ga0495580_0020786 Ga0495580_0020786_62_652 196
778 3300046472 Ga0495580_0039958 Ga0495580_0039958_2002_2664 196
779 3300046472 Ga0495580_0145825 Ga0495580_0145825_148_738 196
780 3300046516 Ga0495628_0050370 Ga0495628_0050370_2172_2762 196
781 3300046517 Ga0495630_0424309 Ga0495630_0424309_305_895 196
782 3300046684 Ga0495669_0085838 Ga0495669_0085838_758_1348 196
783 3300046690 Ga0495624_0016490 Ga0495624_0016490_662_1252 196
784 3300047319 Ga0495674_0009335 Ga0495674_0009335_3018_3608 196
785 3300048088 Ga0495602_0143881 Ga0495602_0143881_42_632 196
786 3300048903 Ga0496100_0208809 Ga0496100_0208809_759_1349 196
787 3300048904 Ga0496101_0099388 Ga0496101_0099388_1448_2038 196
788 3300048904 Ga0496101_0270422 Ga0496101_0270422_571_1161 196
789 3300048905 Ga0496102_0001511 Ga0496102_0001511_9293_9883 196
790 3300048905 Ga0496102_0212551 Ga0496102_0212551_1177_1767 196
791 3300048906 Ga0496103_0001097 Ga0496103_0001097_148_738 196
792 3300048907 Ga0496104_0083719 Ga0496104_0083719_93_683 196
793 3300048907 Ga0496104_0202299 Ga0496104_0202299_1231_1824 196
794 3300048908 Ga0496105_0047541 Ga0496105_0047541_121_711 196
795 3300048909 Ga0496106_0065595 Ga0496106_0065595_960_1553 196
796 3300048910 Ga0496107_0067487 Ga0496107_0067487_1913_2503 196
797 3300048911 Ga0496108_0000051 Ga0496108_0000051_61042_61635 196
798 3300048912 Ga0496109_0000105 Ga0496109_0000105_8372_8965 196
799 3300048913 Ga0496110_0000138 Ga0496110_0000138_40932_41525 196
800 3300048914 Ga0496111_0128235 Ga0496111_0128235_1089_1682 196
801 3300048915 Ga0496112_0003243 Ga0496112_0003243_4439_5032 196
802 3300048916 Ga0496113_0000499 Ga0496113_0000499_10322_10915 196
803 3300050512 nmdc:mga0n895_7372_c1 nmdc:mga0n895_7372_c1_7047_7637 196
804 3300050513 nmdc:mga0rr50_71074_c1 nmdc:mga0rr50_71074_c1_1409_1999 196
805 3300050515 nmdc:mga0a205_835528_c1 nmdc:mga0a205_835528_c1_98_688 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

39

100

0.99

PF07499

RuvA_C

RuvA, C-terminal domain

185

232

0.95

PF14520

HHH_5

Helix-hairpin-helix domain

110

168

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zte-assembly1.cif.gz_A mtruva form iv 0.9772 1 132
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.976 1 131
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9663 1 131
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9613 1 132
2zte-assembly1.cif.gz_A mtruva form iv 0.9557 1 132
ID Description Score Start End Superfamily
1d8lB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9805 1 65 2.40.50.140
2h5xB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9768 67 132 1.10.150.20
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9754 65 132 1.10.150.20
2h5xD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.972 67 133 1.10.150.20
1bvsA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9702 68 131 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A2V9B6I0-F1-model_v4 Holliday junction branch migration protein RuvA 0.995 1 86 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A7W1I2A7-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9922 1 120 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A7V5H7S1-F1-model_v4 deleted 0.9899 1 101
AF-A0A358XVD5-F1-model_v4 Holliday junction branch migration protein RuvA 0.9898 1 62 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A7W1KT27-F1-model_v4 Holliday junction branch migration protein RuvA 0.9875 1 86 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378

Feature Viewer

pLDDT pTM Quality
90.44 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map