F481602

General Info

Members Datasets Scaffolds Average Seq Length
805 595 1610 156

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1063119|Ga0209025_10631193
Length 163
Sequence MRFRAMRFIVVNLLLTLVWAFVTGSFTLHNLALGFAIGAMSLLLVREQLPASLNRVRPIKLLLLAGLFFKELTLSAIKVAFMVLRPNMRLRPGIFAYPLTITRDFEITLLANLITLTPGTLSVDVSDDRKMLYVHALSCHDPAAERRAISSGFERRIREAFPL

Samples

Sample ID Description Type Environment
1 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
52 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
63 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
64 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
110 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
117 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
120 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
121 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
124 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
216 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
223 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
238 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
239 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
240 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
241 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
242 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
243 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
244 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
245 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
246 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
247 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
248 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
249 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
250 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
251 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
252 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
253 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
254 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
255 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
256 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
257 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
258 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
259 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
260 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
261 2519899620 Rhizobium sp. Pop5 Isolate Nodule
262 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
263 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
264 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
265 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
266 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
267 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
268 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
269 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
270 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
271 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
272 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
273 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
274 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
275 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
276 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
277 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
278 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
279 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
280 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
281 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
282 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
283 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
284 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
285 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
286 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
287 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
288 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
289 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
290 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
291 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
292 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
293 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
294 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
295 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
296 2643221558 Rhizobium sp. Root149 Isolate Unclassified
297 2643221568 Rhizobium sp. Root564 Isolate Unclassified
298 2643221599 Rhizobium sp. Root708 Isolate Unclassified
299 2643221607 Rhizobium sp. Root73 Isolate Unclassified
300 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
301 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
302 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
303 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
304 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
305 2643221688 Rhizobium sp. Root482 Isolate Unclassified
306 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
307 2643221718 Rhizobium sp. Root268 Isolate Unclassified
308 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
309 2718217927 Rhizobium sp. N324 Isolate Nodule
310 2718218423 Rhizobium sp. N941 Isolate Nodule
311 2721755809 Rhizobium sp. N541 Isolate Nodule
312 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
313 2738541293 Rhizobium sp. GV031 Isolate Unclassified
314 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
315 2738543024 Aminobacter sp. AP02 Isolate Unclassified
316 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
317 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
318 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
319 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
320 2791355256 Rhizobium sp. M10 Isolate Nodule
321 2791355261 Rhizobium sp. J15 Isolate Nodule
322 2791355262 Rhizobium sp. M1 Isolate Nodule
323 2791355263 Rhizobium chutanense C5 Isolate Nodule
324 2791355265 Rhizobium sp. H4 Isolate Nodule
325 2791355266 Rhizobium sp. L43 Isolate Nodule
326 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
327 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
328 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
329 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
330 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
331 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
332 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
333 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
334 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
335 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
336 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
337 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
338 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
339 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
340 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
341 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
342 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
343 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
344 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
345 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
346 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
347 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
348 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
349 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
350 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
351 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
352 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
353 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
354 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
355 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
356 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
357 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
358 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
359 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
360 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
361 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
362 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
363 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
364 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
365 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
366 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
367 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
368 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
369 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
370 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
371 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
372 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
373 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
374 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
375 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
376 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
377 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
378 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
379 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
380 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
381 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
382 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
383 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
384 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
385 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
386 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
387 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
388 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
389 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
390 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
391 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
392 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
393 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
394 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
395 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
396 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
397 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
398 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
399 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
400 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
401 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
402 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
403 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
404 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
405 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
406 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
407 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
408 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
409 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
410 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
411 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
412 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
413 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
414 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
415 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
416 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
417 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
418 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
419 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
420 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
421 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
422 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
423 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
424 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
425 2936381700 Rhizobium chutanense C16 Isolate Unclassified
426 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
427 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
428 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
429 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
430 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
431 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
432 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
433 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
434 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
435 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
436 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
437 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
438 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
439 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
440 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
441 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
442 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
443 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
444 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
445 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
446 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
447 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
448 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
449 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
450 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
451 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
452 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
453 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
454 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
455 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
456 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
457 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
458 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
459 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
460 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
461 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
462 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
463 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
464 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
465 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
466 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
467 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
468 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
469 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
470 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
471 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
472 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
473 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
474 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
475 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
476 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
477 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
478 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
479 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
480 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
481 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
482 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
483 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
484 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
485 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
486 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
487 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
488 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
489 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
490 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
491 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
492 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
493 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
494 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
495 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
496 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
497 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
498 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
499 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
500 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
501 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
502 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
503 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
504 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
505 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
506 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
507 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
508 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
509 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
510 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
511 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
512 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
513 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
514 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
515 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
516 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
517 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
518 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
519 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
520 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
521 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
522 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
523 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
524 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
525 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
526 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
527 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
528 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
529 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
530 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
531 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
532 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
533 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
534 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
535 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
536 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
537 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
538 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
539 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
540 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
541 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
542 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
543 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
544 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
545 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
546 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
547 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
548 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
549 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
550 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
551 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
552 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
553 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
554 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
555 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
556 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
557 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
558 2996887358 Rhizobium sp. R711 Isolate Nodule
559 2996893221 Rhizobium sp. R635 Isolate Nodule
560 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
561 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
562 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
563 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
564 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
565 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
566 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
567 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
568 8005258706 Rhizobium sp. R693 Isolate Nodule
569 8005275841 Rhizobium sp. N4311 Isolate Nodule
570 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
571 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
572 8005321885 Rhizobium sp. R72 Isolate Nodule
573 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
574 8005382845 Rhizobium sp. R634 Isolate Nodule
575 8005395548 Rhizobium sp. R339 Isolate Nodule
576 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
577 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
578 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
579 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
580 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
581 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
582 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
583 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
584 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
585 8018176218 Rhizobium sp. N122 Isolate Nodule
586 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
587 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
588 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
589 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
590 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
591 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
592 8056382006 Rhizobium croatiense 13T Isolate Nodule
593 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
594 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
595 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.4
Metatranscriptomes 0
Isolates 44.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 16.02
Nodule 36.4
Rhizoplane 3.23
Rhizosphere 25.71
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209025_1063119 3300025294 Bacteria 1369
2 RicEn_FSXC66930_b1 2010549000 Bacteria 846
3 JGI24740J21852_10001010 3300001979 Bacteria 12579
4 JGI25155J39150_1000089 3300002704 Bacteria 51946
5 JGI25156J39149_1000147 3300002705 Bacteria 51946
6 JGI25162J39368_1000243 3300002737 Bacteria 54503
7 JGI25154J39366_1000160 3300002738 Bacteria 51946
8 JGI25157J39369_1000190 3300002741 Bacteria 51946
9 JGI25152J39213_1002089 3300002773 Bacteria 7849
10 JGI25152J39213_1004012 3300002773 Bacteria 4796
11 JGI25152J39213_1004601 3300002773 Bacteria 4295
12 JGI25150J39212_1000327 3300002774 Bacteria 23371
13 JGI25159J45721_1003582 3300002987 Bacteria 5436
14 JGI25151J46595_10000389 3300003187 Bacteria 45619
15 JGI25151J46595_10000900 3300003187 Bacteria 23371
16 JGI25151J46595_10004494 3300003187 Bacteria 7370
17 JGI25151J46595_10004666 3300003187 Bacteria 7208
18 JGI25151J46595_10016398 3300003187 Bacteria 3240
19 JGI25165J46597_1000318 3300003214 Bacteria 57977
20 JGI25153J46596_10019153 3300003215 Bacteria 2630
21 JGI25153J46596_10022060 3300003215 Bacteria 2359
22 JGI25153J46596_10028175 3300003215 Bacteria 1955
23 rootH1_10030544 3300003316 Bacteria 2780
24 rootH1_10108886 3300003316 Bacteria 1658
25 rootL2_10020846 3300003322 Bacteria 7936
26 rootH1_10055359 3300003323 Bacteria 1805
27 rootH1_10055994 3300003323 Bacteria 3609
28 rootH1_10055995 3300003323 Bacteria 4097
29 JGI25160J50197_1000047 3300003354 Bacteria 136499
30 JGI25160J50197_1016458 3300003354 Bacteria 2383
31 JGI25161J50226_1000033 3300003374 Bacteria 136499
32 Ga0055526_1013094 3300003771 Bacteria 3543
33 Ga0055526_1014952 3300003771 Bacteria 3151
34 Ga0055524_1008232 3300003775 Bacteria 4350
35 Ga0055524_1011719 3300003775 Bacteria 3408
36 Ga0055524_1031651 3300003775 Bacteria 1516
37 Ga0055536_1008469 3300003781 Bacteria 4411
38 Ga0055528_1000560 3300003790 Bacteria 28261
39 Ga0055528_1000659 3300003790 Bacteria 25113
40 Ga0055528_1004407 3300003790 Bacteria 6788
41 Ga0055528_1042227 3300003790 Bacteria 1007
42 Ga0055530_10010080 3300003791 Bacteria 3544
43 Ga0055540_1002220 3300003792 Bacteria 10537
44 Ga0055531_10002384 3300003794 Bacteria 12627
45 Ga0055543_1000075 3300004625 Bacteria 87163
46 Ga0065165_1000227 3300005262 Bacteria 98928
47 Ga0065165_1008323 3300005262 Bacteria 4881
48 Ga0070668_101230636 3300005347 Bacteria 679
49 Ga0070669_100196989 3300005353 Bacteria 1583
50 Ga0070671_100058464 3300005355 Bacteria 3209
51 Ga0070673_101478245 3300005364 Bacteria 640
52 Ga0070665_100021793 3300005548 Bacteria 6442
53 Ga0070665_100138823 3300005548 Bacteria 2434
54 Ga0070665_100531556 3300005548 Bacteria 1188
55 Ga0068855_101290010 3300005563 Bacteria 756
56 Ga0068857_101146699 3300005577 Bacteria 752
57 Ga0068856_100035333 3300005614 Bacteria 4897
58 Ga0068856_101100007 3300005614 Bacteria 812
59 Ga0068852_100123018 3300005616 Bacteria 2378
60 Ga0068861_101473906 3300005719 Bacteria 667
61 Ga0068862_101504860 3300005844 Bacteria 678
62 Ga0081539_10002544 3300005985 Bacteria 25336
63 Ga0075365_10003056 3300006038 Bacteria 8488
64 Ga0075365_10062309 3300006038 Bacteria 2494
65 Ga0075363_100112200 3300006048 Bacteria 1516
66 Ga0075363_100298677 3300006048 Bacteria 934
67 Ga0075367_10005582 3300006178 Bacteria 6265
68 Ga0075369_10005714 3300006186 Bacteria 4667
69 Ga0075369_10030477 3300006186 Bacteria 2272
70 Ga0075369_10562977 3300006186 Bacteria 544
71 Ga0075370_10192582 3300006353 Bacteria 1202
72 Ga0079104_1000010 3300006946 Bacteria 366021
73 Ga0105240_10000027 3300009093 Bacteria 348486
74 Ga0105243_10370678 3300009148 Bacteria 1321
75 Ga0105237_10001067 3300009545 Bacteria 36848
76 Ga0105238_10506478 3300009551 Bacteria 1209
77 Ga0105238_12463967 3300009551 Bacteria 556
78 Ga0123341_1078813 3300009765 Bacteria 1319
79 Ga0123342_1003979 3300009766 Bacteria 23134
80 Ga0105239_10013845 3300010375 Bacteria 8951
81 Ga0157373_10167226 3300013100 Bacteria 1548
82 Ga0157371_10006146 3300013102 Bacteria 9970
83 Ga0157370_10000223 3300013104 Bacteria 72025
84 Ga0157370_10484052 3300013104 Bacteria 1137
85 Ga0157369_10011799 3300013105 Bacteria 9922
86 Ga0157369_10169672 3300013105 Bacteria 2300
87 Ga0157369_10353922 3300013105 Bacteria 1525
88 Ga0157374_10820346 3300013296 Bacteria 946
89 Ga0163162_12500111 3300013306 Bacteria 594
90 Ga0163162_13179662 3300013306 Bacteria 527
91 Ga0182008_10138880 3300014497 Bacteria 1215
92 Ga0182005_1001567 3300015265 Bacteria 9037
93 Ga0228711_1000001 3300022739 Bacteria 357377
94 Ga0228710_1000001 3300022740 Bacteria 314328
95 Ga0209435_100036 3300025206 Bacteria 126970
96 Ga0209436_111200 3300025208 Bacteria 1590
97 Ga0209672_107279 3300025228 Bacteria 1714
98 Ga0209437_100036 3300025233 Bacteria 469153
99 Ga0207425_1000524 3300025245 Bacteria 23426
100 Ga0209646_1000132 3300025246 Bacteria 126859
101 Ga0209026_1000313 3300025250 Bacteria 52121
102 Ga0209026_1044895 3300025250 Bacteria 636
103 Ga0209677_100419 3300025253 Bacteria 25164
104 Ga0209759_1000417 3300025256 Bacteria 52121
105 Ga0209129_1000279 3300025258 Bacteria 48588
106 Ga0209129_1000640 3300025258 Bacteria 23426
107 Ga0209129_1000795 3300025258 Bacteria 19947
108 Ga0209233_1000056 3300025261 Bacteria 438104
109 Ga0209233_1000064 3300025261 Bacteria 392156
110 Ga0209673_1000015 3300025273 Bacteria 530618
111 Ga0209673_1000683 3300025273 Bacteria 48729
112 Ga0209673_1001072 3300025273 Bacteria 31048
113 Ga0209673_1009138 3300025273 Bacteria 4327
114 Ga0209673_1029080 3300025273 Bacteria 1765
115 Ga0209673_1031927 3300025273 Bacteria 1630
116 Ga0209130_1000038 3300025284 Bacteria 264226
117 Ga0209130_1011433 3300025284 Bacteria 2376
118 Ga0209130_1051955 3300025284 Bacteria 742
119 Ga0209676_1018816 3300025292 Bacteria 2397
120 Ga0209676_1039585 3300025292 Bacteria 1337
121 Ga0209025_1000165 3300025294 Bacteria 164692
122 Ga0209025_1001738 3300025294 Bacteria 26184
123 Ga0209025_1001991 3300025294 Bacteria 23426
124 Ga0209025_1008957 3300025294 Bacteria 7076
125 Ga0209564_1001249 3300025295 Bacteria 28285
126 Ga0209564_1011603 3300025295 Bacteria 3930
127 Ga0209564_1027628 3300025295 Bacteria 1837
128 Ga0209758_1000121 3300025297 Bacteria 192028
129 Ga0209758_1001831 3300025297 Bacteria 23426
130 Ga0209758_1029120 3300025297 Bacteria 2317
131 Ga0209758_1030705 3300025297 Bacteria 2221
132 Ga0209758_1075507 3300025297 Bacteria 1041
133 Ga0209050_1003961 3300025298 Bacteria 10456
134 Ga0209256_1001279 3300025299 Bacteria 27254
135 Ga0209256_1002727 3300025299 Bacteria 13667
136 Ga0209256_1023535 3300025299 Bacteria 1835
137 Ga0209256_1048728 3300025299 Bacteria 1036
138 Ga0207426_1000081 3300025302 Bacteria 304502
139 Ga0207426_1001592 3300025302 Bacteria 18158
140 Ga0207426_1075231 3300025302 Bacteria 930
141 Ga0209051_1001973 3300025303 Bacteria 15769
142 Ga0209051_1012223 3300025303 Bacteria 4165
143 Ga0209051_1043633 3300025303 Bacteria 1571
144 Ga0209257_1009681 3300025304 Bacteria 5088
145 Ga0209257_1052777 3300025304 Bacteria 1140
146 Ga0209257_1064268 3300025304 Bacteria 988
147 Ga0207710_10122840 3300025900 Bacteria 1241
148 Ga0207695_10000024 3300025913 Bacteria 632311
149 Ga0207671_10001277 3300025914 Bacteria 29618
150 Ga0207681_10188540 3300025923 Bacteria 1576
151 Ga0207694_10767877 3300025924 Bacteria 814
152 Ga0207644_10162051 3300025931 Bacteria 1739
153 Ga0207667_11155606 3300025949 Bacteria 755
154 Ga0207639_10672058 3300026041 Bacteria 959
155 Ga0207678_10189856 3300026067 Bacteria 1755
156 Ga0207675_101049121 3300026118 Bacteria 834
157 Ga0207698_10088159 3300026142 Bacteria 2530
158 Ga0209281_1000078 3300027111 Bacteria 261622
159 Ga0209281_1000164 3300027111 Bacteria 157372
160 Ga0209281_1000377 3300027111 Bacteria 71243
161 Ga0209282_1000007 3300027666 Bacteria 254917
162 Ga0268266_10015136 3300028379 Bacteria 6624
163 Ga0268266_10097794 3300028379 Bacteria 2582
164 Ga0268266_10107898 3300028379 Bacteria 2463
165 Ga0307515_10018668 3300028794 Bacteria 12526
166 Ga0307513_10514385 3300031456 Bacteria 913
167 Ga0307408_100090670 3300031548 Bacteria 2307
168 Ga0307408_100357989 3300031548 Bacteria 1240
169 Ga0316579_10175491 3300031691 Bacteria 1036
170 Ga0307405_10000740 3300031731 Bacteria 12692
171 Ga0307405_10235838 3300031731 Bacteria 1352
172 Ga0307405_10513570 3300031731 Bacteria 963
173 Ga0307405_11765972 3300031731 Bacteria 549
174 Ga0307406_10768934 3300031901 Bacteria 810
175 Ga0307412_10001859 3300031911 Bacteria 11678
176 Ga0307412_10321732 3300031911 Bacteria 1231
177 Ga0307412_10360980 3300031911 Bacteria 1170
178 Ga0315914_1000006 3300031967 Bacteria 239817
179 Ga0307409_100078385 3300031995 Bacteria 2658
180 Ga0307409_100127570 3300031995 Bacteria 2167
181 Ga0307414_10299490 3300032004 Bacteria 1360
182 Ga0315913_1000002 3300033430 Bacteria 241452
183 Ga0315915_1000001 3300033464 Bacteria 481518
184 Ga0316584_0198769 3300036712 Bacteria 1480
185 Ga0439436_0006782 3300041404 Bacteria 3520
186 Ga0439438_027989 3300041405 Bacteria 1518
187 Ga0439439_0192418 3300041406 Bacteria 591
188 Ga0439465_0005740 3300041413 Bacteria 3949
189 Ga0439465_0017997 3300041413 Bacteria 2208
190 Ga0451798_0035870 3300041458 Bacteria 1842
191 Ga0451804_0526351 3300041463 Bacteria 534
192 Ga0451837_0625152 3300041494 Bacteria 1544
193 Ga0451841_1363145 3300041498 Bacteria 591
194 Ga0451843_0401528 3300041509 Bacteria 831
195 Ga0451855_1896387 3300041511 Bacteria 1931
196 Ga0451853_2544414 3300041512 Bacteria 1396
197 Ga0439462_0008191 3300042015 Bacteria 2631
198 Ga0450918_013425 3300042531 Bacteria 1425
199 Ga0466965_0089286 3300044683 Bacteria 1566
200 Ga0466966_0159380 3300044684 Bacteria 1374
201 Ga0466963_0111467 3300044694 Bacteria 1878
202 Ga0466968_0047658 3300044735 Bacteria 1823
203 Ga0466970_0024757 3300044765 Bacteria 3139
204 Ga0466970_0062628 3300044765 Bacteria 1994
205 Ga0451576_0422227 3300045051 Bacteria 1399
206 Ga0466958_0120906 3300045836 Bacteria 1639
207 Ga0495629_0055368 3300046459 Bacteria 2773
208 Ga0495638_0000281 3300046460 Bacteria 68208
209 Ga0495638_0023467 3300046460 Bacteria 4033
210 Ga0495651_0031665 3300046462 Bacteria 4124
211 Ga0495650_0076748 3300046471 Bacteria 1298
212 Ga0495605_0023765 3300046474 Bacteria 3217
213 Ga0495585_0011348 3300046492 Bacteria 5275
214 Ga0495585_0059601 3300046492 Bacteria 2103
215 Ga0495607_0065362 3300046501 Bacteria 2051
216 Ga0495607_0229539 3300046501 Bacteria 903
217 Ga0495583_0003262 3300046506 Bacteria 12610
218 Ga0495583_0042416 3300046506 Bacteria 2125
219 Ga0495606_0001601 3300046507 Bacteria 29530
220 Ga0495606_0019113 3300046507 Bacteria 5110
221 Ga0495606_0059492 3300046507 Bacteria 2451
222 Ga0495606_0124834 3300046507 Bacteria 1536
223 Ga0495606_0147413 3300046507 Bacteria 1384
224 Ga0495610_0000618 3300046512 Bacteria 35134
225 Ga0495610_0077235 3300046512 Bacteria 1538
226 Ga0495610_0131497 3300046512 Bacteria 1086
227 Ga0495616_0057407 3300046513 Bacteria 1919
228 Ga0495620_0012939 3300046515 Bacteria 4289
229 Ga0495620_0029299 3300046515 Bacteria 2549
230 Ga0495620_0062837 3300046515 Bacteria 1541
231 Ga0495628_0240282 3300046516 Bacteria 1355
232 Ga0495631_0000470 3300046518 Bacteria 27171
233 Ga0495632_0004597 3300046519 Bacteria 9351
234 Ga0495632_0051942 3300046519 Bacteria 2016
235 Ga0495643_0047251 3300046522 Bacteria 2332
236 Ga0495643_0088715 3300046522 Bacteria 1598
237 Ga0495652_0066370 3300046529 Bacteria 3029
238 Ga0495654_0000223 3300046530 Bacteria 52992
239 Ga0495622_0017205 3300046557 Bacteria 3365
240 Ga0495633_0149648 3300046558 Bacteria 1078
241 Ga0495656_0042294 3300046615 Bacteria 1907
242 Ga0495656_0043805 3300046615 Bacteria 1881
243 Ga0495668_0015641 3300046616 Bacteria 4426
244 Ga0495668_0179964 3300046616 Bacteria 1158
245 Ga0495625_0001926 3300046660 Bacteria 23464
246 Ga0495625_0017921 3300046660 Bacteria 5535
247 Ga0495625_0113468 3300046660 Bacteria 1851
248 Ga0495625_0137014 3300046660 Bacteria 1654
249 Ga0495625_0193495 3300046660 Bacteria 1346
250 Ga0495588_0134646 3300046674 Bacteria 1304
251 Ga0495657_0226735 3300046675 Bacteria 1131
252 Ga0495623_0347184 3300046679 Bacteria 809
253 Ga0495670_0039950 3300046691 Bacteria 2340
254 Ga0495600_0174017 3300046809 Bacteria 1388
255 Ga0495604_0110470 3300047317 Bacteria 2005
256 Ga0495676_0137757 3300047321 Bacteria 1753
257 Ga0495683_0076393 3300047323 Bacteria 1639
258 Ga0495673_0063121 3300047469 Bacteria 1580
259 Ga0495673_0108665 3300047469 Bacteria 1112
260 Ga0495681_0018565 3300047470 Bacteria 3829
261 Ga0495681_0050496 3300047470 Bacteria 1960
262 Ga0495686_0003970 3300047472 Bacteria 12401
263 Ga0495686_0163648 3300047472 Bacteria 1298
264 Ga0495686_0445035 3300047472 Bacteria 689
265 Ga0495626_0212973 3300048091 Bacteria 788
266 Ga0496100_0091210 3300048903 Bacteria 2079
267 Ga0496101_0059947 3300048904 Bacteria 2760
268 Ga0496101_0289318 3300048904 Bacteria 1282
269 Ga0496101_0608267 3300048904 Bacteria 864
270 Ga0496102_0002635 3300048905 Bacteria 15245
271 Ga0496102_0259416 3300048905 Bacteria 1639
272 Ga0496103_0014923 3300048906 Bacteria 4617
273 Ga0496104_0131776 3300048907 Bacteria 2401
274 Ga0496105_0089520 3300048908 Bacteria 2542
275 Ga0496106_0055735 3300048909 Bacteria 2988
276 Ga0496106_0294561 3300048909 Bacteria 1301
277 Ga0496106_0435337 3300048909 Bacteria 1054
278 Ga0496107_0266855 3300048910 Bacteria 1274
279 Ga0496110_0066020 3300048913 Bacteria 3199
280 Ga0496111_0000142 3300048914 Bacteria 32155
281 Ga0496111_0073876 3300048914 Bacteria 2483
282 Ga0496113_0077078 3300048916 Bacteria 2548
283 Ga0496113_0428825 3300048916 Bacteria 1062
284 Ga0496113_0436412 3300048916 Bacteria 1052
285 Ga0496114_0181684 3300048917 Bacteria 1837
286 Ga0496114_0340850 3300048917 Bacteria 1325
287 Ga0496115_0694802 3300048918 Bacteria 800
288 Ga0496116_0000036 3300048919 Bacteria 388508
289 Ga0496116_0007038 3300048919 Bacteria 10073
290 Ga0496116_0007612 3300048919 Bacteria 9565
291 Ga0496116_0008710 3300048919 Bacteria 8761
292 Ga0496116_0029748 3300048919 Bacteria 3932
293 Ga0496116_0048846 3300048919 Bacteria 2835
294 Ga0496116_0079875 3300048919 Bacteria 2033
295 Ga0496116_0129062 3300048919 Bacteria 1445
296 Ga0496116_0186522 3300048919 Bacteria 1103
297 Ga0496117_0000337 3300048920 Bacteria 82874
298 Ga0496117_0001371 3300048920 Bacteria 35494
299 Ga0496117_0007162 3300048920 Bacteria 11013
300 Ga0496117_0032567 3300048920 Bacteria 3958
301 Ga0496117_0308317 3300048920 Bacteria 835
302 Ga0496118_0000396 3300048921 Bacteria 73830
303 Ga0496118_0006030 3300048921 Bacteria 13500
304 Ga0496118_0058643 3300048921 Bacteria 2874
305 Ga0496118_0060522 3300048921 Bacteria 2811
306 Ga0496118_0152793 3300048921 Bacteria 1442
307 Ga0496119_0003866 3300048922 Bacteria 15292
308 Ga0496119_0033186 3300048922 Bacteria 3427
309 Ga0496119_0057298 3300048922 Bacteria 2355
310 Ga0496119_0121277 3300048922 Bacteria 1437
311 Ga0496119_0324567 3300048922 Bacteria 752
312 Ga0496120_0099286 3300048923 Bacteria 1541
313 Ga0496120_0107773 3300048923 Bacteria 1460
314 Ga0496120_0190862 3300048923 Bacteria 999
315 Ga0496120_0383329 3300048923 Bacteria 624
316 Ga0496121_0001010 3300048924 Bacteria 50285
317 Ga0496121_0052633 3300048924 Bacteria 3417
318 Ga0496121_0092896 3300048924 Bacteria 2351
319 Ga0496121_0113565 3300048924 Bacteria 2061
320 Ga0496121_0126337 3300048924 Bacteria 1921
321 Ga0496121_0132559 3300048924 Bacteria 1862
322 Ga0496121_0146053 3300048924 Bacteria 1747
323 Ga0496121_0147894 3300048924 Bacteria 1733
324 Ga0496121_0200756 3300048924 Bacteria 1421
325 Ga0496121_0208931 3300048924 Bacteria 1384
326 Ga0496121_0246865 3300048924 Bacteria 1240
327 Ga0496121_0830779 3300048924 Bacteria 539
328 Ga0496122_0000009 3300048925 Bacteria 584024
329 Ga0496122_0000205 3300048925 Bacteria 131755
330 Ga0496122_0005041 3300048925 Bacteria 15970
331 Ga0496122_0005051 3300048925 Bacteria 15946
332 Ga0496122_0006419 3300048925 Bacteria 13506
333 Ga0496122_0009595 3300048925 Bacteria 10140
334 Ga0496122_0018263 3300048925 Bacteria 6493
335 Ga0496122_0059110 3300048925 Bacteria 2831
336 Ga0496122_0119057 3300048925 Bacteria 1708
337 Ga0496122_0212369 3300048925 Bacteria 1119
338 Ga0496122_0220670 3300048925 Bacteria 1088
339 Ga0496123_0000103 3300048926 Bacteria 168232
340 Ga0496123_0000245 3300048926 Bacteria 109471
341 Ga0496123_0003144 3300048926 Bacteria 18930
342 Ga0496123_0012018 3300048926 Bacteria 7426
343 Ga0496123_0013827 3300048926 Bacteria 6734
344 Ga0496123_0028567 3300048926 Bacteria 4124
345 Ga0496123_0044728 3300048926 Bacteria 3025
346 Ga0496123_0045945 3300048926 Bacteria 2967
347 Ga0496123_0084594 3300048926 Bacteria 1912
348 Ga0496123_0128139 3300048926 Bacteria 1412
349 Ga0496124_0001609 3300048927 Bacteria 32380
350 Ga0496124_0002681 3300048927 Bacteria 22806
351 Ga0496124_0012882 3300048927 Bacteria 8211
352 Ga0496124_0013444 3300048927 Bacteria 7989
353 Ga0496124_0013991 3300048927 Bacteria 7786
354 Ga0496124_0017562 3300048927 Bacteria 6739
355 Ga0496124_0041714 3300048927 Bacteria 3957
356 Ga0496124_0076987 3300048927 Bacteria 2752
357 Ga0496124_0139589 3300048927 Bacteria 1914
358 Ga0496124_0299907 3300048927 Bacteria 1161
359 Ga0496124_0381099 3300048927 Unclassified 986
360 Ga0496125_0000879 3300048928 Bacteria 47630
361 Ga0496125_0006309 3300048928 Bacteria 12871
362 Ga0496125_0010798 3300048928 Bacteria 9196
363 Ga0496125_0292800 3300048928 Bacteria 1001
364 Ga0496125_0293282 3300048928 Bacteria 1000
365 Ga0496125_0338936 3300048928 Bacteria 903
366 Ga0496125_0489564 3300048928 Bacteria 695
367 Ga0496126_0001035 3300048929 Bacteria 47018
368 Ga0496126_0001111 3300048929 Bacteria 45099
369 Ga0496126_0043168 3300048929 Bacteria 4160
370 Ga0496126_0072797 3300048929 Bacteria 3056
371 Ga0496126_0096598 3300048929 Bacteria 2590
372 Ga0496126_0724828 3300048929 Bacteria 770
373 Ga0495678_011246 3300049459 Bacteria 4296
374 Ga0495678_253699 3300049459 Bacteria 522
375 Ga0501031_0016406 3300049568 Bacteria 4810
376 Ga0501032_0000082 3300049569 Bacteria 82284
377 Ga0501032_0060370 3300049569 Bacteria 2543
378 Ga0501033_0000038 3300049570 Bacteria 144438
379 Ga0501033_0000070 3300049570 Bacteria 97795
380 Ga0501033_0372388 3300049570 Bacteria 998
381 Ga0501034_0000087 3300049571 Bacteria 166714
382 Ga0501034_0016781 3300049571 Bacteria 7508
383 Ga0501034_0302992 3300049571 Bacteria 1534
384 Ga0501034_0548421 3300049571 Bacteria 1065
385 Ga0501036_0000256 3300049572 Bacteria 36120
386 Ga0501036_0116052 3300049572 Bacteria 2261
387 Ga0501037_0000014 3300049573 Bacteria 171015
388 Ga0501037_0049463 3300049573 Bacteria 3078
389 Ga0501038_0000023 3300049574 Bacteria 151469
390 Ga0501038_0039847 3300049574 Bacteria 4108
391 Ga0501039_0000044 3300049575 Bacteria 108828
392 Ga0501039_0950508 3300049575 Bacteria 668
393 Ga0501043_0000088 3300049579 Bacteria 82282
394 Ga0501043_0449830 3300049579 Bacteria 968
395 Ga0501046_0166057 3300049580 Bacteria 1658
396 Ga0501046_0231837 3300049580 Bacteria 1364
397 Ga0501073_0133012 3300049589 Bacteria 1724
398 Ga0501073_0286105 3300049589 Bacteria 1137
399 Ga0501076_1152725 3300049592 Bacteria 638
400 Ga0501080_0052025 3300049742 Bacteria 3812
401 Ga0501083_0115080 3300049744 Bacteria 1766
402 Ga0501241_005912 3300049758 Bacteria 2271
403 Ga0501035_0000047 3300049822 Bacteria 146497
404 Ga0501035_0000367 3300049822 Bacteria 52067
405 Ga0501035_0179658 3300049822 Bacteria 1824
406 Ga0501044_0001585 3300049823 Bacteria 26648
407 Ga0501044_0057807 3300049823 Bacteria 3979
408 Ga0501044_0606894 3300049823 Bacteria 987
409 nmdc:mga03683_604785_c1 3300050489 Bacteria 537
410 nmdc:mga03n38_254731_c1 3300050490 Bacteria 928
411 nmdc:mga0yw44_12538_c1 3300050492 Bacteria 4424
412 nmdc:mga0yw44_21512_c1 3300050492 Bacteria 3599
413 nmdc:mga06z11_39364_c1 3300050494 Bacteria 1742
414 nmdc:mga07m45_114917_c1 3300050496 Bacteria 1552
415 nmdc:mga07m45_370349_c1 3300050496 Bacteria 832
416 nmdc:mga0sz30_31097_c1 3300050516 Bacteria 2208
417 nmdc:mga0sz30_505309_c1 3300050516 Bacteria 544
418 Ga0500610_0078477 3300053079 Bacteria 1720
419 Ga0500578_0069739 3300053086 Bacteria 2241
420 Ga0500643_016910 3300053087 Bacteria 2457
421 Ga0500557_000806 3300053105 Bacteria 4537
422 Ga0500562_037489 3300053108 Bacteria 1287
423 Ga0500569_045351 3300053109 Bacteria 1305
424 Ga0500569_117122 3300053109 Bacteria 884
425 Ga0500572_009945 3300053111 Bacteria 2261
426 Ga0500594_0000728 3300053118 Bacteria 6997
427 Ga0500618_000007 3300053125 Bacteria 226268
428 Ga0500618_003278 3300053125 Bacteria 5623
429 Ga0500618_009376 3300053125 Bacteria 2674
430 Ga0500568_0001294 3300053139 Bacteria 16421
431 Ga0500577_0066683 3300053142 Bacteria 1401
432 Ga0500588_0021150 3300053146 Bacteria 1753
433 Ga0500590_003716 3300053148 Bacteria 7089
434 Ga0500604_0282266 3300053151 Bacteria 576
435 Ga0500616_0000328 3300053153 Bacteria 68215
436 Ga0500616_0000599 3300053153 Bacteria 43738
437 Ga0500622_0099703 3300053156 Bacteria 1432
438 Ga0500624_023380 3300053157 Bacteria 1013
439 Ga0500627_0165429 3300053158 Bacteria 997
440 Ga0500634_0007251 3300053161 Bacteria 5446
441 Ga0500634_0266767 3300053161 Bacteria 700
442 Ga0500636_0000004 3300053177 Bacteria 202392
443 Ga0500636_0004687 3300053177 Bacteria 7762
444 Ga0500636_0187692 3300053177 Bacteria 1104
445 Ga0500565_046521 3300053734 Bacteria 623
446 Ga0501082_0206276 3300060353 Bacteria 1710
447 2510132115 2510065019 Bacteria 6903379
448 2510304505 2510065057 Bacteria 6649661
449 2511136870 2510917022 Bacteria 6504556
450 2511171308 2510917026 Bacteria 7046020
451 2511186467 2510917028 Bacteria 6185411
452 2511500877 2511231052 Bacteria 6974333
453 2512972369 2512875026 Bacteria 6861065
454 2513568949 2513237084 Bacteria 7231967
455 2513583585 2513237086 Bacteria 7265287
456 2513596096 2513237088 Bacteria 6927906
457 2513603448 2513237089 Bacteria 6553624
458 2513620864 2513237091 Bacteria 6900273
459 2513635767 2513237093 Bacteria 7545552
460 2513709395 2513237103 Bacteria 7647401
461 2513865776 2513237138 Bacteria 7368160
462 2513985399 2513237156 Bacteria 6402557
463 2513999396 2513237159 Bacteria 6810126
464 2514004903 2513237160 Bacteria 6650282
465 2515111095 2515075009 Bacteria 7288508
466 2516892149 2516653046 Bacteria 6989037
467 2517039739 2516653077 Bacteria 7555578
468 2517093861 2517093000 Bacteria 7412387
469 2517405683 2517287029 Bacteria 6905599
470 2517568966 2517487022 Bacteria 7227575
471 2520376540 2519899620 Bacteria 6499161
472 2524450202 2524023207 Bacteria 6813453
473 2524457877 2524023209 Bacteria 6679728
474 2530644082 2529292951 Bacteria 6916614
475 2535515543 2534681796 Bacteria 7146037
476 2551676338 2551306084 Bacteria 8942552
477 2551687445 2551306085 Bacteria 7347181
478 2551702394 2551306087 Bacteria 7351905
479 2551719010 2551306090 Bacteria 7953713
480 2551731111 2551306091 Bacteria 7086830
481 2551737494 2551306092 Bacteria 6992595
482 2585165394 2582581283 Bacteria 6030556
483 2585202902 2582581294 Bacteria 6626667
484 2585230561 2582581299 Bacteria 6518058
485 2585256780 2582581304 Bacteria 5831370
486 2585266370 2582581306 Bacteria 6450535
487 2585275788 2582581307 Bacteria 6597605
488 2585278764 2582581308 Bacteria 7413247
489 2585329776 2582581316 Bacteria 7774528
490 2585387345 2582581865 Bacteria 6644329
491 2585397829 2582581866 Bacteria 6859583
492 2585400302 2582581867 Bacteria 7184437
493 2585535874 2585427527 Bacteria 7273426
494 2585554043 2585427530 Bacteria 7383882
495 2585559293 2585427531 Bacteria 6992870
496 2585823026 2585427590 Bacteria 6824633
497 2585844219 2585427594 Bacteria 6180594
498 2585901242 2585427608 Bacteria 6544331
499 2585905331 2585427609 Bacteria 6667127
500 2585999440 2585427634 Bacteria 6455027
501 2587979553 2585428125 Bacteria 6662905
502 2599719159 2599185236 Bacteria 6875203
503 2616305962 2615840626 Bacteria 7921970
504 2616553794 2615840698 Bacteria 7319877
505 2617381959 2617270742 Bacteria 6808054
506 2643810180 2643221558 Bacteria 5460675
507 2643856019 2643221568 Bacteria 5187270
508 2644007749 2643221599 Bacteria 6292121
509 2644046738 2643221607 Bacteria 6314006
510 2644191012 2643221634 Bacteria 6705461
511 2644202445 2643221636 Bacteria 6583769
512 2644206361 2643221637 Bacteria 5345260
513 2644242721 2643221643 Bacteria 5749658
514 2644479527 2643221686 Bacteria 6310811
515 2644493540 2643221688 Bacteria 5260751
516 2644500853 2643221689 Bacteria 6042950
517 2644650008 2643221718 Bacteria 5345506
518 2671112721 2667528174 Bacteria 6435400
519 2719384684 2718217927 Bacteria 6972593
520 2721398394 2718218423 Bacteria 6438183
521 2724037207 2721755809 Bacteria 6438790
522 2725950764 2724679232 Bacteria 7646494
523 2738803568 2738541293 Bacteria 7065685
524 2738948571 2738541317 Bacteria 5340176
525 2739306629 2738543024 Bacteria 5603683
526 2766067796 2765235942 Bacteria 7445910
527 2778177325 2775507266 Bacteria 7392367
528 2792622158 2791355091 Bacteria 6135441
529 2792628277 2791355092 Bacteria 6248105
530 2793298819 2791355256 Bacteria 6798008
531 2793329406 2791355261 Bacteria 6661293
532 2793336078 2791355262 Bacteria 6774204
533 2793339967 2791355263 Bacteria 6872478
534 2793353400 2791355265 Bacteria 6539969
535 2793358716 2791355266 Bacteria 7116587
536 2802717609 2802428858 Bacteria 6636079
537 2802723464 2802428859 Bacteria 6667919
538 2802731086 2802428860 Bacteria 6525526
539 2802736092 2802428861 Bacteria 6534206
540 2802743697 2802428862 Bacteria 6633353
541 2802750591 2802428863 Bacteria 6410669
542 2819612532 2818991448 Bacteria 6772224
543 2819639391 2818991453 Bacteria 7181617
544 2837652531 2837651117 Bacteria 3772164
545 2837681348 2837678835 Bacteria 5252418
546 2838031273 2838029111 Bacteria 6603031
547 2838047105 2838042994 Bacteria 6046894
548 2838681122 2838680041 Bacteria 6545511
549 2838694845 2838694306 Bacteria 6853137
550 2838708221 2838707686 Bacteria 6619912
551 2838738945 2838736955 Bacteria 5760694
552 2841842843 2841840854 Bacteria 5761912
553 2842080545 2842077413 Bacteria 6508645
554 2842115918 2842110456 Bacteria 7656360
555 2842121164 2842118031 Bacteria 7033875
556 2842142624 2842140634 Bacteria 5759631
557 2842207862 2842205361 Bacteria 6340321
558 2842220776 2842217011 Bacteria 7497767
559 2842237633 2842237096 Bacteria 6620661
560 2842281343 2842278818 Bacteria 6340002
561 2842287292 2842285085 Bacteria 6011953
562 2842294204 2842291075 Bacteria 7076806
563 2842300507 2842298080 Bacteria 6123127
564 2842358375 2842357229 Bacteria 6485165
565 2842371585 2842370503 Bacteria 7038661
566 2842380601 2842377471 Bacteria 7140707
567 2842387672 2842384541 Bacteria 7057858
568 2842400910 2842395702 Bacteria 6780583
569 2842404560 2842402390 Bacteria 6681310
570 2842410755 2842409023 Bacteria 6687331
571 2842417789 2842415677 Bacteria 6596907
572 2842478132 2842475841 Bacteria 6603183
573 2842504941 2842502639 Bacteria 6604161
574 2842509581 2842509118 Bacteria 6850950
575 2842525188 2842521101 Bacteria 6569494
576 2852388920 2852387548 Bacteria 8025568
577 2854898682 2854896431 Bacteria 5869725
578 2854921714 2854916844 Bacteria 5725939
579 2855832069 2855825444 Bacteria 6785811
580 2855840353 2855839649 Bacteria 7135830
581 2857520487 2857516855 Bacteria 7787325
582 2858800884 2858800743 Bacteria 6603254
583 2889793818 2889790730 Bacteria 5689708
584 2889920125 2889914905 Bacteria 5702301
585 2891376519 2891373044 Bacteria 5202277
586 2913313531 2913308742 Bacteria 5350706
587 2915986088 2915980308 Bacteria 6624279
588 2915988199 2915986958 Bacteria 6739310
589 2915997918 2915993759 Bacteria 7016183
590 2916005688 2916000859 Bacteria 6865702
591 2916012813 2916007675 Bacteria 6898660
592 2916015393 2916014648 Bacteria 6946486
593 2916027592 2916021584 Bacteria 6854472
594 2916034577 2916028427 Bacteria 6748433
595 2916035324 2916035215 Bacteria 6755766
596 2916043308 2916041962 Bacteria 6820487
597 2916052464 2916048683 Bacteria 6543552
598 2916057624 2916055098 Bacteria 6758838
599 2916067988 2916061851 Bacteria 6737736
600 2916073718 2916068649 Bacteria 6943657
601 2916076754 2916076590 Bacteria 6596108
602 2917558468 2917554339 Bacteria 4987857
603 2919167215 2919166419 Bacteria 4952238
604 2919171650 2919171160 Bacteria 6499771
605 2919409160 2919408235 Bacteria 6149349
606 2921207660 2921201388 Bacteria 6926299
607 2921212480 2921208531 Bacteria 6745326
608 2921243901 2921237296 Bacteria 6876710
609 2921245938 2921244191 Bacteria 6568419
610 2921250872 2921250672 Bacteria 6677771
611 2921261043 2921257292 Bacteria 6808382
612 2921269327 2921263974 Bacteria 6864552
613 2921286437 2921282425 Bacteria 6826397
614 2921294032 2921289301 Bacteria 7316391
615 2921300355 2921296804 Bacteria 7176999
616 2923557730 2923556063 Bacteria 6793593
617 2924146950 2924144063 Bacteria 6883928
618 2924156288 2924150972 Bacteria 7169444
619 2924160478 2924158325 Bacteria 7188855
620 2924172360 2924165586 Bacteria 7260590
621 2924178577 2924172951 Bacteria 6749356
622 2924181520 2924179722 Bacteria 6843264
623 2924190263 2924186466 Bacteria 6876637
624 2924195983 2924193448 Bacteria 6955718
625 2924204417 2924200457 Bacteria 6757188
626 2924207453 2924207177 Bacteria 6917007
627 2924215681 2924214083 Bacteria 7080103
628 2924223002 2924221636 Bacteria 7113495
629 2924234843 2924228884 Bacteria 6633132
630 2933018823 2933016740 Bacteria 6355406
631 2933592123 2933586486 Bacteria 7667493
632 2935895367 2935894831 Bacteria 6620579
633 2936368318 2936367885 Bacteria 7324495
634 2936376151 2936375103 Bacteria 6652732
635 2936386880 2936381700 Bacteria 7006523
636 2937003363 2937002841 Bacteria 6934057
637 2937010666 2937009748 Bacteria 6746052
638 2937020789 2937016420 Bacteria 6782579
639 2937028019 2937023124 Bacteria 6815156
640 2937029950 2937029754 Bacteria 6424026
641 2937038056 2937036028 Bacteria 6846469
642 2937044621 2937042894 Bacteria 6741576
643 2937052672 2937049772 Bacteria 6757901
644 2937061628 2937056579 Bacteria 7107896
645 2937066506 2937063883 Bacteria 7199456
646 2937073785 2937071275 Bacteria 6984483
647 2937083151 2937078374 Bacteria 6610289
648 2937085254 2937084907 Bacteria 6618516
649 2937097930 2937091812 Bacteria 6979387
650 2937103722 2937098957 Bacteria 7249374
651 2937111564 2937106411 Bacteria 6947143
652 2937118267 2937113482 Bacteria 6505872
653 2937120872 2937119839 Bacteria 6597547
654 2937130179 2937126314 Bacteria 6771275
655 2937846633 2937843397 Bacteria 5256375
656 2957380109 2957375807 Bacteria 6425588
657 2957385163 2957382221 Bacteria 6737050
658 2957389226 2957388812 Bacteria 6778072
659 2957398611 2957395598 Bacteria 6822399
660 2957402700 2957402308 Bacteria 6741770
661 2957415187 2957408893 Bacteria 6558585
662 2957417992 2957415311 Bacteria 6991633
663 2957425628 2957422303 Bacteria 7172205
664 2957433168 2957430029 Bacteria 7022557
665 2957439894 2957437181 Bacteria 6568994
666 2957449934 2957443900 Bacteria 6869977
667 2957453534 2957450854 Bacteria 6765715
668 2957457854 2957457609 Bacteria 6967680
669 2957466422 2957464669 Bacteria 6568877
670 2957474009 2957471148 Bacteria 6797643
671 2957483757 2957478035 Bacteria 6756658
672 2957485374 2957484790 Bacteria 6703082
673 2957495901 2957491536 Bacteria 6695180
674 2957499784 2957498199 Bacteria 7126688
675 2957510328 2957505466 Bacteria 7253085
676 2960587986 2960584000 Bacteria 6864594
677 2960595488 2960591022 Bacteria 6622873
678 2960600669 2960597568 Bacteria 6550735
679 2960604643 2960603979 Bacteria 6898737
680 2960613825 2960610863 Bacteria 6691244
681 2960617613 2960617483 Bacteria 6727748
682 2960624671 2960624210 Bacteria 6875384
683 2960633312 2960631154 Bacteria 6732508
684 2960642317 2960637947 Bacteria 7296468
685 2960646520 2960645483 Bacteria 7211087
686 2960656823 2960652885 Bacteria 7083688
687 2960662290 2960660292 Bacteria 7041660
688 2960668459 2960667422 Bacteria 6763020
689 2960677545 2960674078 Bacteria 6609048
690 2960684078 2960680706 Bacteria 6624464
691 2960691098 2960687367 Bacteria 6535474
692 2960696289 2960693952 Bacteria 6749742
693 2964612068 2964607997 Bacteria 7101408
694 2964617589 2964615318 Bacteria 6809089
695 2964622901 2964621998 Bacteria 6834995
696 2964633211 2964628898 Bacteria 7083044
697 2964642088 2964636051 Bacteria 7091832
698 2964644429 2964643177 Bacteria 6820887
699 2964653009 2964649959 Bacteria 6675118
700 2964661122 2964656573 Bacteria 7100150
701 2964666067 2964663802 Bacteria 7019362
702 2964671201 2964670856 Bacteria 6851364
703 2964683652 2964678106 Bacteria 6792020
704 2964689181 2964685014 Bacteria 6839111
705 2964693564 2964691889 Bacteria 6802758
706 2964701907 2964698721 Bacteria 6765331
707 2964712416 2964705432 Bacteria 7114648
708 2964713608 2964712639 Bacteria 6695970
709 2964720354 2964719344 Bacteria 7286602
710 2967669682 2967664464 Bacteria 6948836
711 2967673729 2967671571 Bacteria 7021409
712 2967678830 2967678726 Bacteria 7264382
713 2967686331 2967686174 Bacteria 6678622
714 2967693151 2967693043 Bacteria 6804451
715 2967703414 2967699805 Bacteria 6854538
716 2967709260 2967706974 Bacteria 7186053
717 2967716624 2967714385 Bacteria 7000047
718 2967724764 2967721400 Bacteria 7073753
719 2967730650 2967728569 Bacteria 6641507
720 2967740992 2967735183 Bacteria 6827012
721 2967746038 2967742019 Bacteria 6794534
722 2967752199 2967748971 Bacteria 6733771
723 2967757641 2967755722 Bacteria 6814706
724 2967763726 2967762386 Bacteria 6923502
725 2967773149 2967769361 Bacteria 6587838
726 2967777221 2967775926 Bacteria 6738189
727 2970020175 2970019648 Bacteria 7072033
728 2970030405 2970026789 Bacteria 6785236
729 2970039171 2970033650 Bacteria 7118744
730 2970043006 2970040964 Bacteria 6731123
731 2970050013 2970047711 Bacteria 7088379
732 2970059701 2970054988 Bacteria 6611507
733 2970067832 2970061556 Bacteria 7099761
734 2970074927 2970068827 Bacteria 7123112
735 2970076458 2970076120 Bacteria 6697332
736 2970086594 2970082768 Bacteria 6183754
737 2970093497 2970088815 Bacteria 6933825
738 2970102279 2970095765 Bacteria 6936963
739 2970108471 2970102677 Bacteria 6812532
740 2970109912 2970109326 Bacteria 6863976
741 2970118061 2970116247 Bacteria 6501857
742 2970128263 2970122695 Bacteria 6625855
743 2970129424 2970129317 Bacteria 6806560
744 2970136934 2970136068 Bacteria 7207982
745 2970149059 2970143518 Bacteria 6446480
746 2970153908 2970149975 Bacteria 6779706
747 2970164015 2970156795 Bacteria 7168044
748 2970167410 2970164137 Bacteria 6861252
749 2970171511 2970170962 Bacteria 6876229
750 2970182229 2970177841 Bacteria 6768001
751 2970189450 2970184632 Bacteria 7054431
752 2970198418 2970191845 Bacteria 7032787
753 2977518611 2977516862 Bacteria 6940108
754 2977527182 2977523885 Bacteria 6960446
755 2977533334 2977530762 Bacteria 6951399
756 2977537896 2977537788 Bacteria 6929320
757 2977544847 2977544691 Bacteria 6875412
758 2977551892 2977551784 Bacteria 7125765
759 2977563106 2977558990 Bacteria 6863948
760 2977568937 2977565890 Bacteria 6901543
761 2977579054 2977572785 Bacteria 6763888
762 2977581588 2977579622 Bacteria 6772100
763 2978973641 2978969890 Bacteria 5400756
764 2984591915 2984587000 Bacteria 5263363
765 2989354347 2989349275 Bacteria 6349068
766 2989771863 2989771324 Bacteria 5605128
767 2996313156 2996310559 Bacteria 6357320
768 2996889474 2996887358 Bacteria 5795980
769 2996895341 2996893221 Bacteria 5823108
770 3005412207 3005409236 Bacteria 7188837
771 3005417705 3005416602 Bacteria 7064308
772 3005453265 3005452660 Bacteria 5889319
773 639647254 639633055 Bacteria 7751309
774 648737766 648276728 Bacteria 6968865
775 8002287970 8002285264 Bacteria 6717907
776 8003992768 8003992118 Bacteria 7266902
777 8004000098 8003999396 Bacteria 7063185
778 8005260819 8005258706 Bacteria 6184835
779 8005279401 8005275841 Bacteria 6929066
780 8005292629 8005289223 Bacteria 6634003
781 8005315060 8005314921 Bacteria 7072929
782 8005324001 8005321885 Bacteria 5795980
783 8005376807 8005376324 Bacteria 6590079
784 8005386169 8005382845 Bacteria 6732062
785 8005397434 8005395548 Bacteria 6806915
786 8005461736 8005460587 Bacteria 7157962
787 8005485768 8005484373 Bacteria 6297373
788 8005544169 8005542996 Bacteria 7077758
789 8005562942 8005556819 Bacteria 6908598
790 8005570242 8005563573 Bacteria 7153261
791 8005645736 8005645114 Bacteria 6950293
792 8005684742 8005682033 Bacteria 6726518
793 8005698969 8005695170 Bacteria 6912330
794 8018168373 8018163183 Bacteria 7277977
795 8018178089 8018176218 Bacteria 6896178
796 8024480910 8024479707 Bacteria 6954785
797 8024489925 8024486573 Bacteria 6540512
798 8054461699 8054460903 Bacteria 4872905
799 8054560130 8054558443 Bacteria 5204801
800 8055434012 8055431914 Bacteria 4551896
801 8056379386 8056375014 Bacteria 7006639
802 8056384928 8056382006 Bacteria 6408074
803 8056879942 8056875544 Bacteria 4355797
804 8057581774 8057575449 Bacteria 7367519
805 8057881791 8057874678 Bacteria 7494653
806 Ga0209025_1063119
807 RicEn_FSXC66930_b1
808 JGI24740J21852_10001010
809 JGI25155J39150_1000089
810 JGI25156J39149_1000147
811 JGI25162J39368_1000243
812 JGI25154J39366_1000160
813 JGI25157J39369_1000190
814 JGI25152J39213_1002089
815 JGI25152J39213_1004012
816 JGI25152J39213_1004601
817 JGI25150J39212_1000327
818 JGI25159J45721_1003582
819 JGI25151J46595_10000389
820 JGI25151J46595_10000900
821 JGI25151J46595_10004494
822 JGI25151J46595_10004666
823 JGI25151J46595_10016398
824 JGI25165J46597_1000318
825 JGI25153J46596_10019153
826 JGI25153J46596_10022060
827 JGI25153J46596_10028175
828 rootH1_10030544
829 rootH1_10108886
830 rootL2_10020846
831 rootH1_10055359
832 rootH1_10055994
833 rootH1_10055995
834 JGI25160J50197_1000047
835 JGI25160J50197_1016458
836 JGI25161J50226_1000033
837 Ga0055526_1013094
838 Ga0055526_1014952
839 Ga0055524_1008232
840 Ga0055524_1011719
841 Ga0055524_1031651
842 Ga0055536_1008469
843 Ga0055528_1000560
844 Ga0055528_1000659
845 Ga0055528_1004407
846 Ga0055528_1042227
847 Ga0055530_10010080
848 Ga0055540_1002220
849 Ga0055531_10002384
850 Ga0055543_1000075
851 Ga0065165_1000227
852 Ga0065165_1008323
853 Ga0070668_101230636
854 Ga0070669_100196989
855 Ga0070671_100058464
856 Ga0070673_101478245
857 Ga0070665_100021793
858 Ga0070665_100138823
859 Ga0070665_100531556
860 Ga0068855_101290010
861 Ga0068857_101146699
862 Ga0068856_100035333
863 Ga0068856_101100007
864 Ga0068852_100123018
865 Ga0068861_101473906
866 Ga0068862_101504860
867 Ga0081539_10002544
868 Ga0075365_10003056
869 Ga0075365_10062309
870 Ga0075363_100112200
871 Ga0075363_100298677
872 Ga0075367_10005582
873 Ga0075369_10005714
874 Ga0075369_10030477
875 Ga0075369_10562977
876 Ga0075370_10192582
877 Ga0079104_1000010
878 Ga0105240_10000027
879 Ga0105243_10370678
880 Ga0105237_10001067
881 Ga0105238_10506478
882 Ga0105238_12463967
883 Ga0123341_1078813
884 Ga0123342_1003979
885 Ga0105239_10013845
886 Ga0157373_10167226
887 Ga0157371_10006146
888 Ga0157370_10000223
889 Ga0157370_10484052
890 Ga0157369_10011799
891 Ga0157369_10169672
892 Ga0157369_10353922
893 Ga0157374_10820346
894 Ga0163162_12500111
895 Ga0163162_13179662
896 Ga0182008_10138880
897 Ga0182005_1001567
898 Ga0228711_1000001
899 Ga0228710_1000001
900 Ga0209435_100036
901 Ga0209436_111200
902 Ga0209672_107279
903 Ga0209437_100036
904 Ga0207425_1000524
905 Ga0209646_1000132
906 Ga0209026_1000313
907 Ga0209026_1044895
908 Ga0209677_100419
909 Ga0209759_1000417
910 Ga0209129_1000279
911 Ga0209129_1000640
912 Ga0209129_1000795
913 Ga0209233_1000056
914 Ga0209233_1000064
915 Ga0209673_1000015
916 Ga0209673_1000683
917 Ga0209673_1001072
918 Ga0209673_1009138
919 Ga0209673_1029080
920 Ga0209673_1031927
921 Ga0209130_1000038
922 Ga0209130_1011433
923 Ga0209130_1051955
924 Ga0209676_1018816
925 Ga0209676_1039585
926 Ga0209025_1000165
927 Ga0209025_1001738
928 Ga0209025_1001991
929 Ga0209025_1008957
930 Ga0209564_1001249
931 Ga0209564_1011603
932 Ga0209564_1027628
933 Ga0209758_1000121
934 Ga0209758_1001831
935 Ga0209758_1029120
936 Ga0209758_1030705
937 Ga0209758_1075507
938 Ga0209050_1003961
939 Ga0209256_1001279
940 Ga0209256_1002727
941 Ga0209256_1023535
942 Ga0209256_1048728
943 Ga0207426_1000081
944 Ga0207426_1001592
945 Ga0207426_1075231
946 Ga0209051_1001973
947 Ga0209051_1012223
948 Ga0209051_1043633
949 Ga0209257_1009681
950 Ga0209257_1052777
951 Ga0209257_1064268
952 Ga0207710_10122840
953 Ga0207695_10000024
954 Ga0207671_10001277
955 Ga0207681_10188540
956 Ga0207694_10767877
957 Ga0207644_10162051
958 Ga0207667_11155606
959 Ga0207639_10672058
960 Ga0207678_10189856
961 Ga0207675_101049121
962 Ga0207698_10088159
963 Ga0209281_1000078
964 Ga0209281_1000164
965 Ga0209281_1000377
966 Ga0209282_1000007
967 Ga0268266_10015136
968 Ga0268266_10097794
969 Ga0268266_10107898
970 Ga0307515_10018668
971 Ga0307513_10514385
972 Ga0307408_100090670
973 Ga0307408_100357989
974 Ga0316579_10175491
975 Ga0307405_10000740
976 Ga0307405_10235838
977 Ga0307405_10513570
978 Ga0307405_11765972
979 Ga0307406_10768934
980 Ga0307412_10001859
981 Ga0307412_10321732
982 Ga0307412_10360980
983 Ga0315914_1000006
984 Ga0307409_100078385
985 Ga0307409_100127570
986 Ga0307414_10299490
987 Ga0315913_1000002
988 Ga0315915_1000001
989 Ga0316584_0198769
990 Ga0439436_0006782
991 Ga0439438_027989
992 Ga0439439_0192418
993 Ga0439465_0005740
994 Ga0439465_0017997
995 Ga0451798_0035870
996 Ga0451804_0526351
997 Ga0451837_0625152
998 Ga0451841_1363145
999 Ga0451843_0401528
1000 Ga0451855_1896387
1001 Ga0451853_2544414
1002 Ga0439462_0008191
1003 Ga0450918_013425
1004 Ga0466965_0089286
1005 Ga0466966_0159380
1006 Ga0466963_0111467
1007 Ga0466968_0047658
1008 Ga0466970_0024757
1009 Ga0466970_0062628
1010 Ga0451576_0422227
1011 Ga0466958_0120906
1012 Ga0495629_0055368
1013 Ga0495638_0000281
1014 Ga0495638_0023467
1015 Ga0495651_0031665
1016 Ga0495650_0076748
1017 Ga0495605_0023765
1018 Ga0495585_0011348
1019 Ga0495585_0059601
1020 Ga0495607_0065362
1021 Ga0495607_0229539
1022 Ga0495583_0003262
1023 Ga0495583_0042416
1024 Ga0495606_0001601
1025 Ga0495606_0019113
1026 Ga0495606_0059492
1027 Ga0495606_0124834
1028 Ga0495606_0147413
1029 Ga0495610_0000618
1030 Ga0495610_0077235
1031 Ga0495610_0131497
1032 Ga0495616_0057407
1033 Ga0495620_0012939
1034 Ga0495620_0029299
1035 Ga0495620_0062837
1036 Ga0495628_0240282
1037 Ga0495631_0000470
1038 Ga0495632_0004597
1039 Ga0495632_0051942
1040 Ga0495643_0047251
1041 Ga0495643_0088715
1042 Ga0495652_0066370
1043 Ga0495654_0000223
1044 Ga0495622_0017205
1045 Ga0495633_0149648
1046 Ga0495656_0042294
1047 Ga0495656_0043805
1048 Ga0495668_0015641
1049 Ga0495668_0179964
1050 Ga0495625_0001926
1051 Ga0495625_0017921
1052 Ga0495625_0113468
1053 Ga0495625_0137014
1054 Ga0495625_0193495
1055 Ga0495588_0134646
1056 Ga0495657_0226735
1057 Ga0495623_0347184
1058 Ga0495670_0039950
1059 Ga0495600_0174017
1060 Ga0495604_0110470
1061 Ga0495676_0137757
1062 Ga0495683_0076393
1063 Ga0495673_0063121
1064 Ga0495673_0108665
1065 Ga0495681_0018565
1066 Ga0495681_0050496
1067 Ga0495686_0003970
1068 Ga0495686_0163648
1069 Ga0495686_0445035
1070 Ga0495626_0212973
1071 Ga0496100_0091210
1072 Ga0496101_0059947
1073 Ga0496101_0289318
1074 Ga0496101_0608267
1075 Ga0496102_0002635
1076 Ga0496102_0259416
1077 Ga0496103_0014923
1078 Ga0496104_0131776
1079 Ga0496105_0089520
1080 Ga0496106_0055735
1081 Ga0496106_0294561
1082 Ga0496106_0435337
1083 Ga0496107_0266855
1084 Ga0496110_0066020
1085 Ga0496111_0000142
1086 Ga0496111_0073876
1087 Ga0496113_0077078
1088 Ga0496113_0428825
1089 Ga0496113_0436412
1090 Ga0496114_0181684
1091 Ga0496114_0340850
1092 Ga0496115_0694802
1093 Ga0496116_0000036
1094 Ga0496116_0007038
1095 Ga0496116_0007612
1096 Ga0496116_0008710
1097 Ga0496116_0029748
1098 Ga0496116_0048846
1099 Ga0496116_0079875
1100 Ga0496116_0129062
1101 Ga0496116_0186522
1102 Ga0496117_0000337
1103 Ga0496117_0001371
1104 Ga0496117_0007162
1105 Ga0496117_0032567
1106 Ga0496117_0308317
1107 Ga0496118_0000396
1108 Ga0496118_0006030
1109 Ga0496118_0058643
1110 Ga0496118_0060522
1111 Ga0496118_0152793
1112 Ga0496119_0003866
1113 Ga0496119_0033186
1114 Ga0496119_0057298
1115 Ga0496119_0121277
1116 Ga0496119_0324567
1117 Ga0496120_0099286
1118 Ga0496120_0107773
1119 Ga0496120_0190862
1120 Ga0496120_0383329
1121 Ga0496121_0001010
1122 Ga0496121_0052633
1123 Ga0496121_0092896
1124 Ga0496121_0113565
1125 Ga0496121_0126337
1126 Ga0496121_0132559
1127 Ga0496121_0146053
1128 Ga0496121_0147894
1129 Ga0496121_0200756
1130 Ga0496121_0208931
1131 Ga0496121_0246865
1132 Ga0496121_0830779
1133 Ga0496122_0000009
1134 Ga0496122_0000205
1135 Ga0496122_0005041
1136 Ga0496122_0005051
1137 Ga0496122_0006419
1138 Ga0496122_0009595
1139 Ga0496122_0018263
1140 Ga0496122_0059110
1141 Ga0496122_0119057
1142 Ga0496122_0212369
1143 Ga0496122_0220670
1144 Ga0496123_0000103
1145 Ga0496123_0000245
1146 Ga0496123_0003144
1147 Ga0496123_0012018
1148 Ga0496123_0013827
1149 Ga0496123_0028567
1150 Ga0496123_0044728
1151 Ga0496123_0045945
1152 Ga0496123_0084594
1153 Ga0496123_0128139
1154 Ga0496124_0001609
1155 Ga0496124_0002681
1156 Ga0496124_0012882
1157 Ga0496124_0013444
1158 Ga0496124_0013991
1159 Ga0496124_0017562
1160 Ga0496124_0041714
1161 Ga0496124_0076987
1162 Ga0496124_0139589
1163 Ga0496124_0299907
1164 Ga0496124_0381099
1165 Ga0496125_0000879
1166 Ga0496125_0006309
1167 Ga0496125_0010798
1168 Ga0496125_0292800
1169 Ga0496125_0293282
1170 Ga0496125_0338936
1171 Ga0496125_0489564
1172 Ga0496126_0001035
1173 Ga0496126_0001111
1174 Ga0496126_0043168
1175 Ga0496126_0072797
1176 Ga0496126_0096598
1177 Ga0496126_0724828
1178 Ga0495678_011246
1179 Ga0495678_253699
1180 Ga0501031_0016406
1181 Ga0501032_0000082
1182 Ga0501032_0060370
1183 Ga0501033_0000038
1184 Ga0501033_0000070
1185 Ga0501033_0372388
1186 Ga0501034_0000087
1187 Ga0501034_0016781
1188 Ga0501034_0302992
1189 Ga0501034_0548421
1190 Ga0501036_0000256
1191 Ga0501036_0116052
1192 Ga0501037_0000014
1193 Ga0501037_0049463
1194 Ga0501038_0000023
1195 Ga0501038_0039847
1196 Ga0501039_0000044
1197 Ga0501039_0950508
1198 Ga0501043_0000088
1199 Ga0501043_0449830
1200 Ga0501046_0166057
1201 Ga0501046_0231837
1202 Ga0501073_0133012
1203 Ga0501073_0286105
1204 Ga0501076_1152725
1205 Ga0501080_0052025
1206 Ga0501083_0115080
1207 Ga0501241_005912
1208 Ga0501035_0000047
1209 Ga0501035_0000367
1210 Ga0501035_0179658
1211 Ga0501044_0001585
1212 Ga0501044_0057807
1213 Ga0501044_0606894
1214 nmdc:mga03683_604785_c1
1215 nmdc:mga03n38_254731_c1
1216 nmdc:mga0yw44_12538_c1
1217 nmdc:mga0yw44_21512_c1
1218 nmdc:mga06z11_39364_c1
1219 nmdc:mga07m45_114917_c1
1220 nmdc:mga07m45_370349_c1
1221 nmdc:mga0sz30_31097_c1
1222 nmdc:mga0sz30_505309_c1
1223 Ga0500610_0078477
1224 Ga0500578_0069739
1225 Ga0500643_016910
1226 Ga0500557_000806
1227 Ga0500562_037489
1228 Ga0500569_045351
1229 Ga0500569_117122
1230 Ga0500572_009945
1231 Ga0500594_0000728
1232 Ga0500618_000007
1233 Ga0500618_003278
1234 Ga0500618_009376
1235 Ga0500568_0001294
1236 Ga0500577_0066683
1237 Ga0500588_0021150
1238 Ga0500590_003716
1239 Ga0500604_0282266
1240 Ga0500616_0000328
1241 Ga0500616_0000599
1242 Ga0500622_0099703
1243 Ga0500624_023380
1244 Ga0500627_0165429
1245 Ga0500634_0007251
1246 Ga0500634_0266767
1247 Ga0500636_0000004
1248 Ga0500636_0004687
1249 Ga0500636_0187692
1250 Ga0500565_046521
1251 Ga0501082_0206276
1252 2510132115
1253 2510304505
1254 2511136870
1255 2511171308
1256 2511186467
1257 2511500877
1258 2512972369
1259 2513568949
1260 2513583585
1261 2513596096
1262 2513603448
1263 2513620864
1264 2513635767
1265 2513709395
1266 2513865776
1267 2513985399
1268 2513999396
1269 2514004903
1270 2515111095
1271 2516892149
1272 2517039739
1273 2517093861
1274 2517405683
1275 2517568966
1276 2520376540
1277 2524450202
1278 2524457877
1279 2530644082
1280 2535515543
1281 2551676338
1282 2551687445
1283 2551702394
1284 2551719010
1285 2551731111
1286 2551737494
1287 2585165394
1288 2585202902
1289 2585230561
1290 2585256780
1291 2585266370
1292 2585275788
1293 2585278764
1294 2585329776
1295 2585387345
1296 2585397829
1297 2585400302
1298 2585535874
1299 2585554043
1300 2585559293
1301 2585823026
1302 2585844219
1303 2585901242
1304 2585905331
1305 2585999440
1306 2587979553
1307 2599719159
1308 2616305962
1309 2616553794
1310 2617381959
1311 2643810180
1312 2643856019
1313 2644007749
1314 2644046738
1315 2644191012
1316 2644202445
1317 2644206361
1318 2644242721
1319 2644479527
1320 2644493540
1321 2644500853
1322 2644650008
1323 2671112721
1324 2719384684
1325 2721398394
1326 2724037207
1327 2725950764
1328 2738803568
1329 2738948571
1330 2739306629
1331 2766067796
1332 2778177325
1333 2792622158
1334 2792628277
1335 2793298819
1336 2793329406
1337 2793336078
1338 2793339967
1339 2793353400
1340 2793358716
1341 2802717609
1342 2802723464
1343 2802731086
1344 2802736092
1345 2802743697
1346 2802750591
1347 2819612532
1348 2819639391
1349 2837652531
1350 2837681348
1351 2838031273
1352 2838047105
1353 2838681122
1354 2838694845
1355 2838708221
1356 2838738945
1357 2841842843
1358 2842080545
1359 2842115918
1360 2842121164
1361 2842142624
1362 2842207862
1363 2842220776
1364 2842237633
1365 2842281343
1366 2842287292
1367 2842294204
1368 2842300507
1369 2842358375
1370 2842371585
1371 2842380601
1372 2842387672
1373 2842400910
1374 2842404560
1375 2842410755
1376 2842417789
1377 2842478132
1378 2842504941
1379 2842509581
1380 2842525188
1381 2852388920
1382 2854898682
1383 2854921714
1384 2855832069
1385 2855840353
1386 2857520487
1387 2858800884
1388 2889793818
1389 2889920125
1390 2891376519
1391 2913313531
1392 2915986088
1393 2915988199
1394 2915997918
1395 2916005688
1396 2916012813
1397 2916015393
1398 2916027592
1399 2916034577
1400 2916035324
1401 2916043308
1402 2916052464
1403 2916057624
1404 2916067988
1405 2916073718
1406 2916076754
1407 2917558468
1408 2919167215
1409 2919171650
1410 2919409160
1411 2921207660
1412 2921212480
1413 2921243901
1414 2921245938
1415 2921250872
1416 2921261043
1417 2921269327
1418 2921286437
1419 2921294032
1420 2921300355
1421 2923557730
1422 2924146950
1423 2924156288
1424 2924160478
1425 2924172360
1426 2924178577
1427 2924181520
1428 2924190263
1429 2924195983
1430 2924204417
1431 2924207453
1432 2924215681
1433 2924223002
1434 2924234843
1435 2933018823
1436 2933592123
1437 2935895367
1438 2936368318
1439 2936376151
1440 2936386880
1441 2937003363
1442 2937010666
1443 2937020789
1444 2937028019
1445 2937029950
1446 2937038056
1447 2937044621
1448 2937052672
1449 2937061628
1450 2937066506
1451 2937073785
1452 2937083151
1453 2937085254
1454 2937097930
1455 2937103722
1456 2937111564
1457 2937118267
1458 2937120872
1459 2937130179
1460 2937846633
1461 2957380109
1462 2957385163
1463 2957389226
1464 2957398611
1465 2957402700
1466 2957415187
1467 2957417992
1468 2957425628
1469 2957433168
1470 2957439894
1471 2957449934
1472 2957453534
1473 2957457854
1474 2957466422
1475 2957474009
1476 2957483757
1477 2957485374
1478 2957495901
1479 2957499784
1480 2957510328
1481 2960587986
1482 2960595488
1483 2960600669
1484 2960604643
1485 2960613825
1486 2960617613
1487 2960624671
1488 2960633312
1489 2960642317
1490 2960646520
1491 2960656823
1492 2960662290
1493 2960668459
1494 2960677545
1495 2960684078
1496 2960691098
1497 2960696289
1498 2964612068
1499 2964617589
1500 2964622901
1501 2964633211
1502 2964642088
1503 2964644429
1504 2964653009
1505 2964661122
1506 2964666067
1507 2964671201
1508 2964683652
1509 2964689181
1510 2964693564
1511 2964701907
1512 2964712416
1513 2964713608
1514 2964720354
1515 2967669682
1516 2967673729
1517 2967678830
1518 2967686331
1519 2967693151
1520 2967703414
1521 2967709260
1522 2967716624
1523 2967724764
1524 2967730650
1525 2967740992
1526 2967746038
1527 2967752199
1528 2967757641
1529 2967763726
1530 2967773149
1531 2967777221
1532 2970020175
1533 2970030405
1534 2970039171
1535 2970043006
1536 2970050013
1537 2970059701
1538 2970067832
1539 2970074927
1540 2970076458
1541 2970086594
1542 2970093497
1543 2970102279
1544 2970108471
1545 2970109912
1546 2970118061
1547 2970128263
1548 2970129424
1549 2970136934
1550 2970149059
1551 2970153908
1552 2970164015
1553 2970167410
1554 2970171511
1555 2970182229
1556 2970189450
1557 2970198418
1558 2977518611
1559 2977527182
1560 2977533334
1561 2977537896
1562 2977544847
1563 2977551892
1564 2977563106
1565 2977568937
1566 2977579054
1567 2977581588
1568 2978973641
1569 2984591915
1570 2989354347
1571 2989771863
1572 2996313156
1573 2996889474
1574 2996895341
1575 3005412207
1576 3005417705
1577 3005453265
1578 639647254
1579 648737766
1580 8002287970
1581 8003992768
1582 8004000098
1583 8005260819
1584 8005279401
1585 8005292629
1586 8005315060
1587 8005324001
1588 8005376807
1589 8005386169
1590 8005397434
1591 8005461736
1592 8005485768
1593 8005544169
1594 8005562942
1595 8005570242
1596 8005645736
1597 8005684742
1598 8005698969
1599 8018168373
1600 8018178089
1601 8024480910
1602 8024489925
1603 8054461699
1604 8054560130
1605 8055434012
1606 8056379386
1607 8056384928
1608 8056879942
1609 8057581774
1610 8057881791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

12

160

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qru-assembly1.cif.gz_e structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.9529 2 45
5zng-assembly1.cif.gz_A the crystal complex of immune receptor rga5a_s of pia from rice (oryzae sativa) with rice blast (magnaporthe oryzae) effector protein avr1-co39 0.9007 86 132
7qru-assembly1.cif.gz_e structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.8783 2 45
7nlj-assembly1.cif.gz_A complex of rice blast (magnaporthe oryzae) effector protein apikl2a with host target shma25 from setaria italica 0.8543 87 132
8b2r-assembly1.cif.gz_A complex of rice blast (magnaporthe oryzae) effector protein avr-pikf with a rice (oryza sativa) rga5 hma domain mutant. 0.8458 87 146
ID Description Score Start End Superfamily
5zngA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9007 86 132 3.30.70.100
af_K7KE01_9_82_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8895 88 131 3.30.70.100
af_I1LL17_38_112_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8466 89 146 3.30.70.100
af_Q9C5D3_169_235_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8445 86 146 3.30.70.100
af_A0A1D6KPQ3_20_86_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8429 86 146 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Y9EXY4-F1-model_v4 Sodium:proton antiporter 0.9385 52 157 GO:0005886
GO:0008324
AF-A0A2N6A1Z0-F1-model_v4 Cation:proton antiporter 0.9381 50 157 GO:0005886
GO:0008324
AF-A0A1X7GCM3-F1-model_v4 Multicomponent Na+:H+ antiporter subunit E 0.9345 50 157 GO:0005886
GO:0008324
AF-A0A391N4B9-F1-model_v4 Na(+)/H(+) antiporter subunit E 0.9329 47 157 GO:0005886
GO:0008324
AF-A0A6G4N3V1-F1-model_v4 Na+/H+ antiporter subunit E 0.9313 80 154 GO:0005886
GO:0008324
GO:0015297

Map