F481609

General Info

Members Datasets Scaffolds Average Seq Length
805 292 1610 223

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_003069|Ga0439438_003069_2018_2704
Length 228
Sequence MSEFNWNIQLPLHFGQAETPRMYLARALPEDPQRCVFETFIQQRFRQAHGADIRHFMPELFGMINASDGAEALCAVVGVRLASAGPLFLECYLDEAIDPLISAAADHTVDRSAIVEVGNLAASDTANARMSIIAMTYLLAMGGLEWVAFTGNLGLVNSFHRLGLKPVTLCAADPARLGEDRHAWGSYYESKPWVHVGNIRAGFIHLRDIGLFSRLGLPTSVEASCHVA

Samples

Sample ID Description Type Environment
1 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
78 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
79 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
80 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
81 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
82 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
83 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
84 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
87 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
88 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
89 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
90 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
91 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
92 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
93 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
94 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
95 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
98 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
99 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
100 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
190 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
198 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
199 2511231006 Pseudomonas sp. GM17 Isolate Nodule
200 2511231012 Pseudomonas sp. GM33 Isolate Nodule
201 2511231018 Pseudomonas sp. GM60 Isolate Nodule
202 2511231019 Pseudomonas sp. GM67 Isolate Nodule
203 2511231021 Pseudomonas sp. GM78 Isolate Nodule
204 2511231022 Pseudomonas sp. GM79 Isolate Nodule
205 2511231031 Pseudomonas sp. GM16 Isolate Nodule
206 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
207 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
208 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
209 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
210 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
211 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
212 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
213 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
214 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
215 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
216 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
217 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
218 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
219 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
220 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
221 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
222 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
223 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
224 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
225 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
226 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
227 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
228 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
229 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
230 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
231 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
232 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
233 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
234 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
235 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
236 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
237 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
238 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
239 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
240 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
241 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
242 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
243 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
244 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
245 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
246 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
247 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
248 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
249 2773857670 Pseudomonas sp. 478 Isolate Unclassified
250 2784132072 Pseudomonas sp. 460 Isolate Unclassified
251 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
252 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
253 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
254 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
255 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
256 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
257 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
258 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
259 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
260 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
261 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
262 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
263 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
264 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
265 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
266 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
267 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
268 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
269 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
270 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
271 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
272 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
273 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
274 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
275 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
276 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
277 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
278 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
279 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
280 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
281 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
282 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
283 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
284 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
285 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
286 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
287 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
288 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
289 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
290 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
291 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
292 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.32
Metatranscriptomes 0
Isolates 11.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.09
Nodule 1.61
Rhizoplane 3.85
Rhizosphere 81.74
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439438_003069 3300041405 Bacteria 6868
2 MRS2a_Contig_51 2124908027 Bacteria 27969
3 SwRhRL2b_contig_3602964 2162886007 Bacteria 4606
4 SwRhRL2b_contig_628020 2162886007 Bacteria 4513
5 Ga0055526_1002931 3300003771 Bacteria 11184
6 Ga0055537_1006879 3300003773 Bacteria 2818
7 Ga0055537_1017477 3300003773 Unclassified 1178
8 Ga0055524_1003743 3300003775 Bacteria 7262
9 Ga0055536_1000025 3300003781 Bacteria 183172
10 Ga0055536_1000037 3300003781 Bacteria 138437
11 Ga0055534_1001147 3300003784 Bacteria 11209
12 Ga0055530_10000007 3300003791 Bacteria 183172
13 Ga0055530_10000320 3300003791 Bacteria 43510
14 Ga0055530_10000621 3300003791 Bacteria 30767
15 Ga0055530_10001019 3300003791 Bacteria 22405
16 Ga0055530_10021649 3300003791 Bacteria 1888
17 Ga0055540_1000025 3300003792 Bacteria 197801
18 Ga0055540_1000729 3300003792 Bacteria 22405
19 Ga0055540_1000990 3300003792 Bacteria 18352
20 Ga0055531_10000585 3300003794 Bacteria 31831
21 Ga0065714_10000222 3300005288 Bacteria 7687
22 Ga0065714_10002603 3300005288 Bacteria 16794
23 Ga0065714_10003536 3300005288 Bacteria 6802
24 Ga0065714_10005770 3300005288 Bacteria 6942
25 Ga0065714_10012484 3300005288 Bacteria 3393
26 Ga0065714_10012953 3300005288 Bacteria 2925
27 Ga0065714_10014510 3300005288 Bacteria 1572
28 Ga0065714_10064853 3300005288 Bacteria 16996
29 Ga0065714_10069398 3300005288 Bacteria 4245
30 Ga0065714_10073329 3300005288 Bacteria 3204
31 Ga0065714_10112339 3300005288 Bacteria 1457
32 Ga0065704_10000485 3300005289 Bacteria 20501
33 Ga0065704_10084659 3300005289 Bacteria 3310
34 Ga0065704_10297060 3300005289 Bacteria 891
35 Ga0065712_10022894 3300005290 Bacteria 1593
36 Ga0065715_10009061 3300005293 Bacteria 4799
37 Ga0070670_100001054 3300005331 Bacteria 21894
38 Ga0070661_100001004 3300005344 Bacteria 20032
39 Ga0070665_100027248 3300005548 Bacteria 5755
40 Ga0070664_100001292 3300005564 Bacteria 20032
41 Ga0075364_10109597 3300006051 Bacteria 1841
42 Ga0075364_10121978 3300006051 Bacteria 1745
43 Ga0075432_10000121 3300006058 Bacteria 17497
44 Ga0075432_10001179 3300006058 Bacteria 8376
45 Ga0075432_10013890 3300006058 Bacteria 2740
46 Ga0075432_10056622 3300006058 Bacteria 1390
47 Ga0075432_10066858 3300006058 Bacteria 1287
48 Ga0075362_10119269 3300006177 Bacteria 1247
49 Ga0075369_10226122 3300006186 Bacteria 866
50 Ga0075436_100195864 3300006914 Bacteria 1430
51 Ga0075436_100331983 3300006914 Bacteria 1094
52 Ga0079104_1000085 3300006946 Bacteria 136289
53 Ga0079104_1000245 3300006946 Bacteria 72407
54 Ga0099826_10000365 3300006948 Bacteria 20892
55 Ga0105251_10001168 3300009011 Bacteria 22786
56 Ga0105251_10001289 3300009011 Bacteria 21676
57 Ga0105251_10041765 3300009011 Bacteria 2230
58 Ga0105251_10238941 3300009011 Bacteria 818
59 Ga0105244_10000806 3300009036 Bacteria 26610
60 Ga0105244_10000938 3300009036 Bacteria 24575
61 Ga0105244_10001369 3300009036 Bacteria 19810
62 Ga0105244_10011001 3300009036 Bacteria 5454
63 Ga0105244_10015608 3300009036 Bacteria 4352
64 Ga0105244_10095168 3300009036 Bacteria 1462
65 Ga0105244_10113122 3300009036 Bacteria 1319
66 Ga0105244_10122649 3300009036 Bacteria 1258
67 Ga0105244_10131261 3300009036 Bacteria 1209
68 Ga0105250_10001006 3300009092 Bacteria 16338
69 Ga0105250_10020102 3300009092 Bacteria 2700
70 Ga0105243_10000230 3300009148 Bacteria 64559
71 Ga0105242_10001326 3300009176 Bacteria 19534
72 Ga0105237_10000937 3300009545 Bacteria 39281
73 Ga0105246_10000047 3300011119 Bacteria 47128
74 Ga0157345_1000005 3300012498 Bacteria 78097
75 Ga0157373_10000409 3300013100 Bacteria 34480
76 Ga0157373_10000598 3300013100 Bacteria 28031
77 Ga0157373_10000845 3300013100 Bacteria 23804
78 Ga0157373_10003727 3300013100 Bacteria 11530
79 Ga0157373_10004523 3300013100 Bacteria 10457
80 Ga0157373_10345752 3300013100 Bacteria 1060
81 Ga0157371_10000535 3300013102 Bacteria 45229
82 Ga0157370_10014974 3300013104 Bacteria 7907
83 Ga0157370_10023243 3300013104 Bacteria 6157
84 Ga0157370_10084705 3300013104 Bacteria 2979
85 Ga0157370_10123938 3300013104 Bacteria 2413
86 Ga0157370_10409479 3300013104 Bacteria 1248
87 Ga0157369_10002178 3300013105 Bacteria 23587
88 Ga0157369_10003376 3300013105 Bacteria 18972
89 Ga0157369_10083664 3300013105 Bacteria 3412
90 Ga0163162_10000053 3300013306 Bacteria 112503
91 Ga0163162_10016024 3300013306 Bacteria 7325
92 Ga0163162_10066717 3300013306 Bacteria 3647
93 Ga0157375_10002189 3300013308 Bacteria 16893
94 Ga0182008_10000449 3300014497 Bacteria 31373
95 Ga0182008_10001820 3300014497 Bacteria 13894
96 Ga0182008_10014206 3300014497 Bacteria 4174
97 Ga0182008_10022515 3300014497 Bacteria 3227
98 Ga0182006_1000099 3300015261 Bacteria 98453
99 Ga0182006_1000607 3300015261 Bacteria 25961
100 Ga0182006_1008557 3300015261 Bacteria 4637
101 Ga0182007_10000130 3300015262 Bacteria 53164
102 Ga0182007_10000379 3300015262 Bacteria 28020
103 Ga0182007_10115795 3300015262 Bacteria 894
104 Ga0182005_1000208 3300015265 Bacteria 39222
105 Ga0182005_1001653 3300015265 Bacteria 8673
106 Ga0182005_1007489 3300015265 Bacteria 3271
107 Ga0182005_1020079 3300015265 Bacteria 1840
108 Ga0182005_1051273 3300015265 Bacteria 1122
109 Ga0182005_1055622 3300015265 Bacteria 1078
110 Ga0182005_1072883 3300015265 Bacteria 944
111 Ga0163161_10000236 3300017792 Bacteria 50548
112 Ga0163161_10001902 3300017792 Bacteria 15246
113 Ga0163161_10015240 3300017792 Bacteria 5356
114 Ga0163161_10045187 3300017792 Bacteria 3175
115 Ga0163161_10074579 3300017792 Bacteria 2488
116 Ga0209565_1001320 3300025263 Bacteria 11384
117 Ga0209565_1007389 3300025263 Bacteria 2969
118 Ga0209675_1001584 3300025291 Bacteria 12867
119 Ga0209675_1018166 3300025291 Bacteria 1976
120 Ga0209676_1000002 3300025292 Bacteria 1732948
121 Ga0209676_1000003 3300025292 Bacteria 1454178
122 Ga0209676_1001129 3300025292 Bacteria 29347
123 Ga0209676_1003838 3300025292 Bacteria 8823
124 Ga0209564_1003298 3300025295 Bacteria 11215
125 Ga0209050_1000004 3300025298 Bacteria 1600040
126 Ga0209050_1000006 3300025298 Bacteria 1359702
127 Ga0209050_1000013 3300025298 Bacteria 811408
128 Ga0209050_1000383 3300025298 Bacteria 83450
129 Ga0209050_1000782 3300025298 Bacteria 45306
130 Ga0209256_1003993 3300025299 Bacteria 9671
131 Ga0209051_1000001 3300025303 Bacteria 1732974
132 Ga0209051_1000006 3300025303 Bacteria 1015785
133 Ga0209051_1000007 3300025303 Bacteria 811408
134 Ga0209051_1004486 3300025303 Bacteria 8584
135 Ga0209257_1000056 3300025304 Bacteria 403132
136 Ga0209257_1006975 3300025304 Bacteria 7034
137 Ga0207696_1000609 3300025711 Bacteria 26679
138 Ga0207696_1019146 3300025711 Bacteria 2235
139 Ga0207655_1000070 3300025728 Bacteria 239196
140 Ga0207655_1000287 3300025728 Bacteria 77056
141 Ga0207655_1001371 3300025728 Bacteria 22824
142 Ga0207655_1004780 3300025728 Bacteria 9447
143 Ga0207655_1033626 3300025728 Bacteria 2320
144 Ga0207655_1041171 3300025728 Bacteria 1982
145 Ga0207713_1000774 3300025735 Bacteria 29524
146 Ga0207713_1001306 3300025735 Bacteria 20453
147 Ga0207713_1001375 3300025735 Bacteria 19748
148 Ga0207713_1006880 3300025735 Bacteria 6840
149 Ga0207713_1031258 3300025735 Bacteria 2356
150 Ga0207713_1035755 3300025735 Bacteria 2140
151 Ga0207713_1038479 3300025735 Bacteria 2029
152 Ga0207671_10001472 3300025914 Bacteria 27195
153 Ga0207650_10002898 3300025925 Bacteria 11840
154 Ga0207686_10066968 3300025934 Bacteria 2296
155 Ga0207709_10000014 3300025935 Bacteria 526302
156 Ga0207679_10000818 3300025945 Bacteria 20047
157 Ga0209281_1000009 3300027111 Bacteria 771717
158 Ga0209281_1000046 3300027111 Bacteria 327042
159 Ga0207428_10034208 3300027907 Bacteria 4167
160 Ga0207428_10055473 3300027907 Bacteria 3151
161 Ga0207428_10142288 3300027907 Bacteria 1830
162 Ga0207428_10153875 3300027907 Bacteria 1750
163 Ga0207428_10271030 3300027907 Bacteria 1262
164 Ga0207428_10278749 3300027907 Bacteria 1241
165 Ga0307511_10207996 3300030521 Bacteria 1004
166 Ga0316178_1106511 3300030735 Bacteria 11740
167 Ga0307408_100003404 3300031548 Bacteria 10909
168 Ga0307408_100005033 3300031548 Bacteria 8863
169 Ga0307408_100009387 3300031548 Bacteria 6446
170 Ga0307408_100257029 3300031548 Bacteria 1443
171 Ga0307516_10157798 3300031730 Bacteria 2022
172 Ga0307405_10000422 3300031731 Bacteria 15864
173 Ga0307405_10001323 3300031731 Bacteria 10377
174 Ga0307405_10029146 3300031731 Bacteria 3223
175 Ga0307413_10086866 3300031824 Bacteria 2023
176 Ga0307413_10107636 3300031824 Bacteria 1858
177 Ga0307406_10000995 3300031901 Bacteria 15730
178 Ga0307406_10041420 3300031901 Bacteria 2869
179 Ga0307406_10052592 3300031901 Bacteria 2591
180 Ga0307407_10027610 3300031903 Bacteria 3023
181 Ga0307412_10000333 3300031911 Bacteria 29855
182 Ga0307412_10001855 3300031911 Bacteria 11710
183 Ga0307412_10037205 3300031911 Bacteria 3125
184 Ga0307412_10170888 3300031911 Bacteria 1625
185 Ga0307416_100073136 3300032002 Bacteria 2857
186 Ga0307416_100556234 3300032002 Bacteria 1221
187 Ga0307414_10053846 3300032004 Bacteria 2808
188 Ga0307414_10131704 3300032004 Bacteria 1942
189 Ga0307414_10252669 3300032004 Bacteria 1466
190 Ga0307411_10004076 3300032005 Bacteria 6924
191 Ga0307510_10001358 3300033180 Bacteria 26701
192 Ga0439438_000008 3300041405 Bacteria 178072
193 Ga0439438_000048 3300041405 Bacteria 58674
194 Ga0439438_002317 3300041405 Bacteria 8146
195 Ga0439438_016592 3300041405 Bacteria 2139
196 Ga0439447_000490 3300041407 Bacteria 14702
197 Ga0439447_004724 3300041407 Bacteria 4641
198 Ga0439447_004792 3300041407 Bacteria 4602
199 Ga0439447_009984 3300041407 Bacteria 2844
200 Ga0439447_014735 3300041407 Bacteria 2184
201 Ga0439466_0003458 3300041411 Bacteria 6119
202 Ga0439466_0005843 3300041411 Bacteria 4687
203 Ga0439466_0015025 3300041411 Bacteria 2813
204 Ga0439466_0018642 3300041411 Bacteria 2489
205 Ga0439466_0022044 3300041411 Bacteria 2251
206 Ga0439466_0022559 3300041411 Bacteria 2220
207 Ga0439431_0000014 3300041997 Bacteria 30148
208 Ga0439445_0004006 3300042004 Bacteria 3324
209 Ga0439432_000037 3300042006 Bacteria 41453
210 Ga0439432_000051 3300042006 Bacteria 36464
211 Ga0439432_003061 3300042006 Bacteria 6226
212 Ga0439432_006757 3300042006 Bacteria 4084
213 Ga0439432_009182 3300042006 Bacteria 3453
214 Ga0439432_070360 3300042006 Bacteria 1067
215 Ga0439451_000581 3300042009 Bacteria 6947
216 Ga0439451_003745 3300042009 Bacteria 3083
217 Ga0439451_029152 3300042009 Bacteria 1111
218 Ga0439452_000043 3300042010 Bacteria 132609
219 Ga0439452_000053 3300042010 Bacteria 113190
220 Ga0439452_006167 3300042010 Bacteria 3778
221 Ga0439452_015778 3300042010 Bacteria 2063
222 Ga0439452_025506 3300042010 Bacteria 1500
223 Ga0439456_001801 3300042013 Bacteria 4322
224 Ga0439456_003002 3300042013 Bacteria 3412
225 Ga0439456_005148 3300042013 Bacteria 2653
226 Ga0439456_005938 3300042013 Bacteria 2486
227 Ga0439456_020249 3300042013 Bacteria 1403
228 Ga0439463_000077 3300042016 Bacteria 22576
229 Ga0439463_013249 3300042016 Bacteria 2029
230 Ga0439463_017487 3300042016 Bacteria 1778
231 Ga0450911_000009 3300042115 Bacteria 162968
232 Ga0450911_003316 3300042115 Bacteria 2867
233 Ga0450890_001291 3300042127 Bacteria 3623
234 Ga0450902_002822 3300042137 Bacteria 2489
235 Ga0450902_009621 3300042137 Bacteria 1524
236 Ga0450902_018936 3300042137 Bacteria 1131
237 Ga0450903_002453 3300042138 Bacteria 3305
238 Ga0450903_004388 3300042138 Bacteria 2411
239 Ga0450903_007062 3300042138 Bacteria 1854
240 Ga0450905_008912 3300042142 Bacteria 1376
241 Ga0450905_012020 3300042142 Bacteria 1216
242 Ga0450906_000235 3300042145 Bacteria 10600
243 Ga0450906_003015 3300042145 Bacteria 3654
244 Ga0450907_000120 3300042146 Bacteria 30093
245 Ga0450910_000572 3300042147 Bacteria 4377
246 Ga0439446_0002865 3300042156 Bacteria 4205
247 Ga0439446_0007421 3300042156 Bacteria 2882
248 Ga0439446_0110490 3300042156 Bacteria 876
249 Ga0450909_001781 3300042185 Bacteria 3029
250 Ga0450909_017498 3300042185 Bacteria 1061
251 Ga0439434_0001508 3300042435 Bacteria 6702
252 Ga0439434_0027030 3300042435 Bacteria 1734
253 Ga0439460_0001409 3300042461 Bacteria 5671
254 Ga0439460_0002552 3300042461 Bacteria 4392
255 Ga0439460_0004579 3300042461 Bacteria 3375
256 Ga0450893_0005198 3300042532 Bacteria 2083
257 Ga0439440_0000788 3300042993 Bacteria 5472
258 Ga0439440_0002062 3300042993 Bacteria 3748
259 Ga0439440_0003232 3300042993 Bacteria 3127
260 Ga0439440_0023712 3300042993 Bacteria 1401
261 Ga0495617_000263 3300046452 Bacteria 30333
262 Ga0495617_001790 3300046452 Bacteria 9164
263 Ga0495617_001945 3300046452 Bacteria 8668
264 Ga0495617_006314 3300046452 Bacteria 4163
265 Ga0495617_007751 3300046452 Bacteria 3712
266 Ga0495617_014315 3300046452 Bacteria 2695
267 Ga0495617_022578 3300046452 Bacteria 2127
268 Ga0495617_026689 3300046452 Bacteria 1945
269 Ga0495617_031942 3300046452 Bacteria 1767
270 Ga0495617_067385 3300046452 Bacteria 1179
271 Ga0495627_000039 3300046453 Bacteria 197253
272 Ga0495627_000140 3300046453 Bacteria 86227
273 Ga0495627_000203 3300046453 Bacteria 64485
274 Ga0495627_003143 3300046453 Bacteria 7459
275 Ga0495627_003323 3300046453 Bacteria 7153
276 Ga0495627_006275 3300046453 Bacteria 4672
277 Ga0495627_006756 3300046453 Bacteria 4465
278 Ga0495627_050995 3300046453 Bacteria 1245
279 Ga0495627_069279 3300046453 Bacteria 1032
280 Ga0495592_0369262 3300046454 Bacteria 916
281 Ga0495603_0026163 3300046455 Bacteria 3526
282 Ga0495603_0079537 3300046455 Bacteria 1921
283 Ga0495590_0000235 3300046457 Bacteria 30406
284 Ga0495590_0001793 3300046457 Bacteria 9110
285 Ga0495590_0011308 3300046457 Bacteria 3339
286 Ga0495590_0015871 3300046457 Bacteria 2725
287 Ga0495590_0025751 3300046457 Bacteria 2067
288 Ga0495590_0149408 3300046457 Bacteria 846
289 Ga0495591_000138 3300046458 Bacteria 78836
290 Ga0495591_000315 3300046458 Bacteria 43798
291 Ga0495591_000749 3300046458 Bacteria 23491
292 Ga0495591_004348 3300046458 Bacteria 6977
293 Ga0495591_004502 3300046458 Bacteria 6790
294 Ga0495591_004701 3300046458 Bacteria 6555
295 Ga0495591_005726 3300046458 Bacteria 5669
296 Ga0495591_020327 3300046458 Bacteria 2196
297 Ga0495591_081793 3300046458 Bacteria 822
298 Ga0495629_0019754 3300046459 Bacteria 4809
299 Ga0495638_0000196 3300046460 Bacteria 87444
300 Ga0495638_0000298 3300046460 Bacteria 64005
301 Ga0495638_0001043 3300046460 Bacteria 27399
302 Ga0495638_0003321 3300046460 Bacteria 12688
303 Ga0495638_0008238 3300046460 Bacteria 7406
304 Ga0495638_0016259 3300046460 Bacteria 4985
305 Ga0495638_0016482 3300046460 Bacteria 4948
306 Ga0495638_0017286 3300046460 Bacteria 4813
307 Ga0495638_0019100 3300046460 Bacteria 4538
308 Ga0495638_0330389 3300046460 Bacteria 811
309 Ga0495653_0008459 3300046463 Bacteria 8438
310 Ga0495653_0014104 3300046463 Bacteria 6515
311 Ga0495653_0059576 3300046463 Bacteria 2896
312 Ga0495653_0154981 3300046463 Bacteria 1596
313 Ga0495650_0001734 3300046471 Bacteria 19931
314 Ga0495650_0002021 3300046471 Bacteria 17769
315 Ga0495650_0002403 3300046471 Bacteria 15277
316 Ga0495650_0020041 3300046471 Bacteria 3272
317 Ga0495650_0069935 3300046471 Bacteria 1379
318 Ga0495582_0005980 3300046473 Bacteria 6782
319 Ga0495605_0000047 3300046474 Bacteria 171270
320 Ga0495605_0000810 3300046474 Bacteria 22320
321 Ga0495605_0001334 3300046474 Bacteria 16321
322 Ga0495605_0006683 3300046474 Bacteria 6604
323 Ga0495605_0007788 3300046474 Bacteria 6069
324 Ga0495605_0012511 3300046474 Bacteria 4704
325 Ga0495605_0013545 3300046474 Bacteria 4488
326 Ga0495605_0014291 3300046474 Bacteria 4351
327 Ga0495605_0017785 3300046474 Bacteria 3821
328 Ga0495605_0031209 3300046474 Bacteria 2723
329 Ga0495605_0073654 3300046474 Bacteria 1608
330 Ga0495639_0000059 3300046475 Bacteria 49016
331 Ga0495639_0005069 3300046475 Bacteria 5657
332 Ga0495584_0001872 3300046491 Bacteria 12169
333 Ga0495584_0002024 3300046491 Bacteria 11648
334 Ga0495584_0002780 3300046491 Bacteria 9779
335 Ga0495584_0018610 3300046491 Bacteria 3530
336 Ga0495584_0044030 3300046491 Bacteria 2252
337 Ga0495584_0047596 3300046491 Bacteria 2162
338 Ga0495584_0066240 3300046491 Bacteria 1816
339 Ga0495584_0115369 3300046491 Bacteria 1359
340 Ga0495584_0130398 3300046491 Bacteria 1275
341 Ga0495585_0000202 3300046492 Bacteria 62078
342 Ga0495585_0000333 3300046492 Bacteria 45988
343 Ga0495585_0000372 3300046492 Bacteria 43337
344 Ga0495585_0000622 3300046492 Bacteria 32989
345 Ga0495585_0007020 3300046492 Bacteria 6934
346 Ga0495585_0011004 3300046492 Bacteria 5371
347 Ga0495585_0014523 3300046492 Bacteria 4585
348 Ga0495585_0046949 3300046492 Bacteria 2406
349 Ga0495585_0050139 3300046492 Bacteria 2316
350 Ga0495585_0053859 3300046492 Bacteria 2226
351 Ga0495594_0020585 3300046499 Bacteria 3514
352 Ga0495594_0024695 3300046499 Bacteria 3230
353 Ga0495596_0000049 3300046500 Bacteria 87906
354 Ga0495607_0000770 3300046501 Bacteria 30744
355 Ga0495607_0002404 3300046501 Bacteria 15274
356 Ga0495607_0002730 3300046501 Bacteria 14079
357 Ga0495607_0003453 3300046501 Bacteria 12100
358 Ga0495607_0007340 3300046501 Bacteria 7638
359 Ga0495607_0012487 3300046501 Bacteria 5604
360 Ga0495607_0012867 3300046501 Bacteria 5503
361 Ga0495607_0015242 3300046501 Bacteria 4984
362 Ga0495607_0022703 3300046501 Bacteria 3936
363 Ga0495607_0035900 3300046501 Bacteria 2993
364 Ga0495607_0037452 3300046501 Bacteria 2914
365 Ga0495607_0054054 3300046501 Bacteria 2315
366 Ga0495607_0056852 3300046501 Bacteria 2244
367 Ga0495607_0103671 3300046501 Bacteria 1519
368 Ga0495607_0110503 3300046501 Bacteria 1458
369 Ga0495607_0178889 3300046501 Bacteria 1065
370 Ga0495583_0001642 3300046506 Bacteria 21784
371 Ga0495583_0002701 3300046506 Bacteria 14740
372 Ga0495583_0005647 3300046506 Bacteria 8425
373 Ga0495606_0001383 3300046507 Bacteria 32778
374 Ga0495606_0001516 3300046507 Bacteria 30798
375 Ga0495606_0001673 3300046507 Bacteria 28701
376 Ga0495606_0003190 3300046507 Bacteria 17683
377 Ga0495606_0004547 3300046507 Bacteria 13790
378 Ga0495606_0034606 3300046507 Bacteria 3466
379 Ga0495606_0042660 3300046507 Bacteria 3032
380 Ga0495610_0004087 3300046512 Bacteria 10939
381 Ga0495610_0006715 3300046512 Bacteria 7826
382 Ga0495610_0008691 3300046512 Bacteria 6538
383 Ga0495610_0009485 3300046512 Bacteria 6148
384 Ga0495610_0013198 3300046512 Bacteria 4920
385 Ga0495610_0013315 3300046512 Bacteria 4893
386 Ga0495610_0094534 3300046512 Bacteria 1349
387 Ga0495610_0171733 3300046512 Bacteria 908
388 Ga0495616_0001576 3300046513 Bacteria 15673
389 Ga0495616_0002736 3300046513 Bacteria 11540
390 Ga0495616_0008814 3300046513 Bacteria 5937
391 Ga0495616_0016240 3300046513 Bacteria 4124
392 Ga0495616_0029761 3300046513 Bacteria 2879
393 Ga0495616_0031629 3300046513 Bacteria 2769
394 Ga0495616_0037040 3300046513 Bacteria 2512
395 Ga0495616_0040231 3300046513 Bacteria 2389
396 Ga0495616_0047496 3300046513 Bacteria 2161
397 Ga0495616_0171168 3300046513 Bacteria 971
398 Ga0495620_0000855 3300046515 Bacteria 18810
399 Ga0495620_0000898 3300046515 Bacteria 18251
400 Ga0495620_0003212 3300046515 Bacteria 9384
401 Ga0495620_0004920 3300046515 Bacteria 7493
402 Ga0495620_0058224 3300046515 Bacteria 1618
403 Ga0495630_0003718 3300046517 Bacteria 10634
404 Ga0495630_0012638 3300046517 Bacteria 6135
405 Ga0495630_0124443 3300046517 Bacteria 1956
406 Ga0495631_0000002 3300046518 Bacteria 178694
407 Ga0495631_0000255 3300046518 Bacteria 36934
408 Ga0495631_0000479 3300046518 Bacteria 26745
409 Ga0495631_0005450 3300046518 Bacteria 6655
410 Ga0495631_0008780 3300046518 Bacteria 5078
411 Ga0495631_0040599 3300046518 Bacteria 2061
412 Ga0495632_0001723 3300046519 Bacteria 17774
413 Ga0495632_0003257 3300046519 Bacteria 11625
414 Ga0495632_0006402 3300046519 Bacteria 7580
415 Ga0495632_0008066 3300046519 Bacteria 6525
416 Ga0495632_0010340 3300046519 Bacteria 5535
417 Ga0495632_0011430 3300046519 Bacteria 5179
418 Ga0495632_0016206 3300046519 Bacteria 4152
419 Ga0495632_0018233 3300046519 Bacteria 3856
420 Ga0495632_0035835 3300046519 Bacteria 2528
421 Ga0495632_0054194 3300046519 Bacteria 1966
422 Ga0495637_0000044 3300046520 Bacteria 111531
423 Ga0495637_0000712 3300046520 Bacteria 22748
424 Ga0495637_0002779 3300046520 Bacteria 9495
425 Ga0495637_0004013 3300046520 Bacteria 7680
426 Ga0495637_0004709 3300046520 Bacteria 7041
427 Ga0495637_0005030 3300046520 Bacteria 6794
428 Ga0495637_0009418 3300046520 Bacteria 4765
429 Ga0495637_0015823 3300046520 Bacteria 3532
430 Ga0495637_0017434 3300046520 Bacteria 3346
431 Ga0495637_0020716 3300046520 Bacteria 3019
432 Ga0495637_0100641 3300046520 Bacteria 1129
433 Ga0495637_0124598 3300046520 Bacteria 988
434 Ga0495637_0131936 3300046520 Bacteria 953
435 Ga0495643_0002169 3300046522 Bacteria 16068
436 Ga0495643_0009722 3300046522 Bacteria 5948
437 Ga0495643_0010921 3300046522 Bacteria 5562
438 Ga0495643_0013147 3300046522 Bacteria 4967
439 Ga0495643_0027151 3300046522 Bacteria 3221
440 Ga0495643_0028611 3300046522 Bacteria 3122
441 Ga0495643_0080954 3300046522 Bacteria 1689
442 Ga0495643_0134473 3300046522 Bacteria 1238
443 Ga0495644_0000159 3300046523 Bacteria 32152
444 Ga0495644_0000878 3300046523 Bacteria 12434
445 Ga0495644_0003676 3300046523 Bacteria 6036
446 Ga0495644_0006693 3300046523 Bacteria 4464
447 Ga0495648_0000337 3300046524 Bacteria 51818
448 Ga0495648_0001764 3300046524 Bacteria 20892
449 Ga0495648_0002415 3300046524 Bacteria 17319
450 Ga0495648_0002559 3300046524 Bacteria 16664
451 Ga0495648_0004627 3300046524 Bacteria 11687
452 Ga0495648_0005118 3300046524 Bacteria 10985
453 Ga0495648_0025195 3300046524 Bacteria 4032
454 Ga0495648_0027788 3300046524 Bacteria 3780
455 Ga0495648_0058319 3300046524 Bacteria 2309
456 Ga0495648_0103531 3300046524 Bacteria 1565
457 Ga0495666_0001016 3300046526 Bacteria 13312
458 Ga0495666_0012277 3300046526 Bacteria 4271
459 Ga0495666_0022012 3300046526 Bacteria 3156
460 Ga0495654_0000197 3300046530 Bacteria 58733
461 Ga0495654_0000561 3300046530 Bacteria 30020
462 Ga0495654_0000851 3300046530 Bacteria 23130
463 Ga0495654_0002249 3300046530 Bacteria 12502
464 Ga0495654_0003898 3300046530 Bacteria 9020
465 Ga0495654_0006790 3300046530 Bacteria 6463
466 Ga0495654_0009969 3300046530 Bacteria 5189
467 Ga0495654_0011896 3300046530 Bacteria 4694
468 Ga0495654_0013179 3300046530 Bacteria 4428
469 Ga0495654_0018503 3300046530 Bacteria 3649
470 Ga0495654_0020353 3300046530 Bacteria 3458
471 Ga0495654_0022188 3300046530 Bacteria 3299
472 Ga0495654_0027919 3300046530 Bacteria 2888
473 Ga0495654_0032308 3300046530 Bacteria 2653
474 Ga0495654_0032587 3300046530 Bacteria 2640
475 Ga0495654_0034533 3300046530 Bacteria 2550
476 Ga0495586_0024052 3300046535 Bacteria 3253
477 Ga0495586_0404778 3300046535 Bacteria 785
478 Ga0495587_0000089 3300046536 Bacteria 70764
479 Ga0495587_0007118 3300046536 Bacteria 7257
480 Ga0495609_0001094 3300046538 Bacteria 18849
481 Ga0495609_0001600 3300046538 Bacteria 14800
482 Ga0495609_0003417 3300046538 Bacteria 9106
483 Ga0495609_0005156 3300046538 Bacteria 6954
484 Ga0495609_0126406 3300046538 Bacteria 1097
485 Ga0495597_0001188 3300046542 Bacteria 19515
486 Ga0495597_0001323 3300046542 Bacteria 18107
487 Ga0495597_0003566 3300046542 Bacteria 8980
488 Ga0495597_0004046 3300046542 Bacteria 8212
489 Ga0495597_0012474 3300046542 Bacteria 4100
490 Ga0495597_0056870 3300046542 Bacteria 1712
491 Ga0495622_0000676 3300046557 Bacteria 19344
492 Ga0495622_0001176 3300046557 Bacteria 13538
493 Ga0495622_0002949 3300046557 Bacteria 8107
494 Ga0495622_0004344 3300046557 Bacteria 6597
495 Ga0495622_0036352 3300046557 Bacteria 2296
496 Ga0495622_0138718 3300046557 Bacteria 1104
497 Ga0495633_0000571 3300046558 Bacteria 35869
498 Ga0495633_0000656 3300046558 Bacteria 31916
499 Ga0495633_0019067 3300046558 Bacteria 3472
500 Ga0495656_0019650 3300046615 Bacteria 2610
501 Ga0495668_0000732 3300046616 Bacteria 39331
502 Ga0495668_0816890 3300046616 Bacteria 516
503 Ga0495634_0001522 3300046642 Bacteria 20497
504 Ga0495634_0246334 3300046642 Bacteria 1095
505 Ga0495611_0000016 3300046648 Bacteria 129593
506 Ga0495611_0003958 3300046648 Bacteria 6444
507 Ga0495611_0170458 3300046648 Bacteria 1017
508 Ga0495625_0002733 3300046660 Bacteria 18697
509 Ga0495625_0003014 3300046660 Bacteria 17347
510 Ga0495625_0003863 3300046660 Bacteria 14477
511 Ga0495625_0004081 3300046660 Bacteria 13941
512 Ga0495625_0013745 3300046660 Bacteria 6490
513 Ga0495625_0018840 3300046660 Bacteria 5374
514 Ga0495625_0022688 3300046660 Bacteria 4807
515 Ga0495625_0054239 3300046660 Bacteria 2863
516 Ga0495625_0117690 3300046660 Bacteria 1811
517 Ga0495625_0133622 3300046660 Bacteria 1679
518 Ga0495625_0149807 3300046660 Bacteria 1569
519 Ga0495635_0000983 3300046663 Bacteria 18785
520 Ga0495635_0023127 3300046663 Bacteria 4330
521 Ga0495659_0000077 3300046664 Bacteria 42000
522 Ga0495661_0000011 3300046665 Bacteria 277997
523 Ga0495661_0007031 3300046665 Bacteria 7868
524 Ga0495661_0011184 3300046665 Bacteria 6090
525 Ga0495661_0024069 3300046665 Bacteria 3944
526 Ga0495661_0050371 3300046665 Bacteria 2521
527 Ga0495657_0085070 3300046675 Bacteria 2039
528 Ga0495623_0001160 3300046679 Bacteria 17848
529 Ga0495623_0003928 3300046679 Bacteria 9802
530 Ga0495646_0000414 3300046680 Bacteria 22554
531 Ga0495646_0015967 3300046680 Bacteria 4765
532 Ga0495646_0024053 3300046680 Bacteria 3835
533 Ga0495613_0009565 3300046689 Bacteria 7200
534 Ga0495670_0000373 3300046691 Bacteria 21412
535 Ga0495670_0000395 3300046691 Bacteria 20827
536 Ga0495670_0000563 3300046691 Bacteria 17690
537 Ga0495670_0001267 3300046691 Bacteria 12345
538 Ga0495670_0015676 3300046691 Bacteria 3725
539 Ga0495670_0037217 3300046691 Bacteria 2426
540 Ga0495670_0065492 3300046691 Bacteria 1831
541 Ga0495670_0089155 3300046691 Bacteria 1577
542 Ga0495671_0000324 3300046692 Bacteria 40091
543 Ga0495671_0000785 3300046692 Bacteria 22817
544 Ga0495671_0002489 3300046692 Bacteria 11605
545 Ga0495671_0004586 3300046692 Bacteria 8223
546 Ga0495671_0009284 3300046692 Bacteria 5498
547 Ga0495671_0028586 3300046692 Bacteria 2870
548 Ga0495671_0045244 3300046692 Bacteria 2204
549 Ga0495671_0105920 3300046692 Bacteria 1373
550 Ga0495671_0152090 3300046692 Bacteria 1126
551 Ga0495649_0000109 3300046694 Bacteria 72797
552 Ga0495649_0003158 3300046694 Bacteria 11259
553 Ga0495649_0006563 3300046694 Bacteria 7234
554 Ga0495649_0007664 3300046694 Bacteria 6555
555 Ga0495649_0033510 3300046694 Bacteria 2827
556 Ga0495649_0037666 3300046694 Bacteria 2654
557 Ga0495649_0066811 3300046694 Bacteria 1929
558 Ga0495649_0081647 3300046694 Bacteria 1728
559 Ga0495589_0000234 3300046794 Bacteria 46522
560 Ga0495589_0000448 3300046794 Bacteria 30373
561 Ga0495589_0013282 3300046794 Bacteria 4250
562 Ga0495589_0024813 3300046794 Bacteria 3045
563 Ga0495589_0028142 3300046794 Bacteria 2838
564 Ga0495589_0040394 3300046794 Bacteria 2329
565 Ga0495589_0041317 3300046794 Bacteria 2301
566 Ga0495589_0113860 3300046794 Bacteria 1304
567 Ga0495589_0337155 3300046794 Bacteria 695
568 Ga0495600_0038653 3300046809 Bacteria 3106
569 Ga0495600_0193942 3300046809 Bacteria 1305
570 Ga0495660_0002216 3300046810 Bacteria 12514
571 Ga0495660_0006833 3300046810 Bacteria 6724
572 Ga0495660_0010915 3300046810 Bacteria 5278
573 Ga0495660_0015771 3300046810 Bacteria 4362
574 Ga0495660_0016370 3300046810 Bacteria 4275
575 Ga0495660_0019752 3300046810 Bacteria 3866
576 Ga0495660_0021162 3300046810 Bacteria 3726
577 Ga0495660_0029313 3300046810 Bacteria 3106
578 Ga0495660_0034952 3300046810 Bacteria 2810
579 Ga0495660_0052740 3300046810 Bacteria 2209
580 Ga0495660_0079838 3300046810 Bacteria 1717
581 Ga0495660_0106165 3300046810 Bacteria 1439
582 Ga0495581_0027447 3300047315 Bacteria 3302
583 Ga0495581_0068043 3300047315 Bacteria 2059
584 Ga0495604_0000559 3300047317 Bacteria 32736
585 Ga0495604_0009001 3300047317 Bacteria 7896
586 Ga0495604_0012707 3300047317 Bacteria 6700
587 Ga0495636_0000899 3300047318 Bacteria 11042
588 Ga0495674_0010426 3300047319 Bacteria 8800
589 Ga0495672_0000210 3300047320 Bacteria 83349
590 Ga0495672_0000796 3300047320 Bacteria 34103
591 Ga0495672_0001891 3300047320 Bacteria 19913
592 Ga0495672_0003138 3300047320 Bacteria 14382
593 Ga0495672_0003897 3300047320 Bacteria 12520
594 Ga0495672_0003926 3300047320 Bacteria 12475
595 Ga0495672_0005049 3300047320 Bacteria 10550
596 Ga0495672_0020951 3300047320 Bacteria 4272
597 Ga0495672_0029012 3300047320 Bacteria 3491
598 Ga0495672_0056840 3300047320 Bacteria 2274
599 Ga0495672_0068541 3300047320 Bacteria 2016
600 Ga0495672_0073862 3300047320 Bacteria 1922
601 Ga0495676_0000572 3300047321 Bacteria 30227
602 Ga0495676_0000985 3300047321 Bacteria 23912
603 Ga0495680_0023047 3300047322 Bacteria 5181
604 Ga0495680_0072661 3300047322 Bacteria 2616
605 Ga0495680_0134157 3300047322 Bacteria 1816
606 Ga0495683_0000037 3300047323 Bacteria 140632
607 Ga0495683_0000111 3300047323 Bacteria 83676
608 Ga0495683_0001421 3300047323 Bacteria 15798
609 Ga0495683_0001855 3300047323 Bacteria 13261
610 Ga0495683_0006727 3300047323 Bacteria 6263
611 Ga0495683_0058161 3300047323 Bacteria 1920
612 Ga0495687_010838 3300047443 Bacteria 4953
613 Ga0495675_0009620 3300047444 Bacteria 6020
614 Ga0495675_0090237 3300047444 Bacteria 1923
615 Ga0495679_000064 3300047446 Bacteria 102509
616 Ga0495679_000974 3300047446 Bacteria 17665
617 Ga0495679_005167 3300047446 Bacteria 5842
618 Ga0495679_008712 3300047446 Bacteria 4104
619 Ga0495679_026079 3300047446 Bacteria 1945
620 Ga0495685_009249 3300047447 Bacteria 3286
621 Ga0495673_0000093 3300047469 Bacteria 185841
622 Ga0495673_0001677 3300047469 Bacteria 17028
623 Ga0495673_0001690 3300047469 Bacteria 16952
624 Ga0495673_0004914 3300047469 Bacteria 8231
625 Ga0495673_0008463 3300047469 Bacteria 5783
626 Ga0495673_0013426 3300047469 Bacteria 4301
627 Ga0495673_0028864 3300047469 Bacteria 2623
628 Ga0495673_0048702 3300047469 Bacteria 1867
629 Ga0495681_0000027 3300047470 Bacteria 141884
630 Ga0495681_0000029 3300047470 Bacteria 134816
631 Ga0495681_0000446 3300047470 Bacteria 31565
632 Ga0495681_0002714 3300047470 Bacteria 12520
633 Ga0495681_0003154 3300047470 Bacteria 11546
634 Ga0495681_0004766 3300047470 Bacteria 9189
635 Ga0495681_0007858 3300047470 Bacteria 6745
636 Ga0495681_0010319 3300047470 Bacteria 5657
637 Ga0495681_0030817 3300047470 Bacteria 2725
638 Ga0495681_0150052 3300047470 Bacteria 978
639 Ga0495684_0016215 3300047471 Bacteria 5737
640 Ga0495686_0001441 3300047472 Bacteria 25958
641 Ga0495686_0007165 3300047472 Bacteria 8394
642 Ga0495686_0015704 3300047472 Bacteria 5159
643 Ga0495593_0001685 3300047673 Bacteria 13103
644 Ga0495593_0007251 3300047673 Bacteria 6496
645 Ga0495593_0027899 3300047673 Bacteria 3103
646 Ga0495593_0105765 3300047673 Bacteria 1440
647 Ga0495626_0000072 3300048091 Bacteria 134289
648 Ga0495626_0000244 3300048091 Bacteria 63113
649 Ga0495626_0000340 3300048091 Bacteria 49123
650 Ga0495626_0000352 3300048091 Bacteria 48007
651 Ga0495626_0000651 3300048091 Bacteria 33467
652 Ga0495626_0003736 3300048091 Bacteria 9609
653 Ga0495626_0033829 3300048091 Bacteria 2447
654 Ga0495626_0045184 3300048091 Bacteria 2057
655 Ga0495626_0108681 3300048091 Bacteria 1203
656 Ga0495626_0245562 3300048091 Bacteria 719
657 Ga0496102_0000038 3300048905 Bacteria 198844
658 Ga0496103_0003344 3300048906 Bacteria 9810
659 Ga0496110_0030047 3300048913 Bacteria 4682
660 Ga0496110_0057252 3300048913 Bacteria 3431
661 Ga0496110_0208085 3300048913 Bacteria 1778
662 Ga0496115_0131116 3300048918 Bacteria 2066
663 Ga0496116_0000697 3300048919 Bacteria 43533
664 Ga0496116_0002982 3300048919 Bacteria 17203
665 Ga0496116_0015222 3300048919 Bacteria 6092
666 Ga0496117_0003347 3300048920 Bacteria 18718
667 Ga0496117_0005893 3300048920 Bacteria 12663
668 Ga0496117_0058242 3300048920 Bacteria 2677
669 Ga0496117_0104031 3300048920 Bacteria 1788
670 Ga0496118_0004582 3300048921 Bacteria 16258
671 Ga0496118_0012884 3300048921 Bacteria 7969
672 Ga0496118_0018132 3300048921 Bacteria 6366
673 Ga0496118_0035566 3300048921 Bacteria 4042
674 Ga0496121_0136505 3300048924 Bacteria 1826
675 Ga0496121_0263739 3300048924 Bacteria 1188
676 Ga0496121_0612661 3300048924 Bacteria 669
677 Ga0496122_0003361 3300048925 Bacteria 21087
678 Ga0496122_0101091 3300048925 Bacteria 1927
679 Ga0496123_0057583 3300048926 Bacteria 2528
680 Ga0496124_0004248 3300048927 Bacteria 16859
681 Ga0496124_0013456 3300048927 Bacteria 7985
682 Ga0496124_0100293 3300048927 Bacteria 2347
683 Ga0496124_0151229 3300048927 Bacteria 1820
684 Ga0496124_0376108 3300048927 Bacteria 995
685 Ga0496125_0010352 3300048928 Bacteria 9435
686 Ga0496125_0029276 3300048928 Bacteria 4953
687 Ga0496125_0075129 3300048928 Bacteria 2617
688 Ga0496126_0165036 3300048929 Bacteria 1890
689 Ga0495678_000707 3300049459 Bacteria 30373
690 Ga0495678_001630 3300049459 Bacteria 17085
691 Ga0495678_003056 3300049459 Bacteria 10627
692 Ga0495678_010366 3300049459 Bacteria 4536
693 Ga0495678_012121 3300049459 Bacteria 4094
694 Ga0495678_024596 3300049459 Bacteria 2598
695 Ga0495678_093682 3300049459 Bacteria 1052
696 Ga0495678_113156 3300049459 Bacteria 922
697 Ga0495682_0000709 3300049460 Bacteria 21844
698 Ga0495682_0217910 3300049460 Bacteria 676
699 Ga0501222_000471 3300049662 Bacteria 6015
700 Ga0501224_050549 3300049664 Bacteria 637
701 Ga0501235_008488 3300049669 Bacteria 2243
702 nmdc:mga00v17_213656_c1 3300050491 Bacteria 1248
703 nmdc:mga00v17_45057_c1 3300050491 Bacteria 2663
704 nmdc:mga00v17_65401_c1 3300050491 Bacteria 2243
705 nmdc:mga08x19_101257_c1 3300050514 Bacteria 1912
706 nmdc:mga08x19_290596_c1 3300050514 Bacteria 1134
707 nmdc:mga0sz30_32301_c1 3300050516 Bacteria 2171
708 Ga0500621_027440 3300053126 Bacteria 2240
709 Ga0500573_0006243 3300053140 Bacteria 6431
710 Ga0500586_007248 3300053145 Bacteria 2946
711 Ga0500649_100304 3300053722 Bacteria 1144
712 2511265464 2511231006 Bacteria 6794709
713 2511304114 2511231012 Bacteria 6738011
714 2511337896 2511231018 Bacteria 6436256
715 2511343806 2511231019 Bacteria 6520662
716 2511357714 2511231021 Bacteria 7302637
717 2511362765 2511231022 Bacteria 6719296
718 2511411908 2511231031 Bacteria 6558529
719 2511825065 2511231156 Bacteria 6845832
720 2512327280 2512047018 Bacteria 6663241
721 2583792471 2582580891 Bacteria 6800976
722 2599501588 2599185188 Bacteria 6164180
723 2599611758 2599185212 Bacteria 6765997
724 2599768904 2599185248 Bacteria 6696816
725 2599881387 2599185288 Bacteria 6666191
726 2599884688 2599185289 Bacteria 6778765
727 2599896133 2599185291 Bacteria 6775623
728 2599931491 2599185300 Bacteria 6062622
729 2599945167 2599185302 Bacteria 5954930
730 2599955481 2599185304 Bacteria 5951361
731 2599958019 2599185305 Bacteria 6748700
732 2599968612 2599185306 Bacteria 6637356
733 2599979804 2599185308 Bacteria 6621546
734 2599984342 2599185309 Bacteria 5969593
735 2599990487 2599185310 Bacteria 6014457
736 2600003893 2599185313 Bacteria 6658188
737 2600013616 2599185314 Bacteria 6621749
738 2600015742 2599185315 Bacteria 6771107
739 2600034029 2599185318 Bacteria 6961590
740 2600040452 2599185319 Bacteria 6637840
741 2600049150 2599185320 Bacteria 5963263
742 2600050949 2599185321 Bacteria 6764560
743 2600058610 2599185322 Bacteria 6763055
744 2600063456 2599185323 Bacteria 6688755
745 2600069019 2599185324 Bacteria 6590677
746 2624481301 2623620443 Bacteria 6427864
747 2624492697 2623620446 Bacteria 6500345
748 2643842134 2643221565 Bacteria 6216018
749 2643954537 2643221589 Bacteria 6250934
750 2644023346 2643221602 Bacteria 6249926
751 2644281187 2643221650 Bacteria 7029547
752 2652546409 2651869719 Bacteria 6047974
753 2671088827 2667528170 Bacteria 6786960
754 2715755804 2713897149 Bacteria 6506249
755 2738669650 2738541265 Bacteria 6594665
756 2738748043 2738541282 Bacteria 6593925
757 2738806903 2738541294 Bacteria 6925949
758 2738857085 2738541303 Bacteria 6591772
759 2738894263 2738541309 Bacteria 6926455
760 2739197433 2738543004 Bacteria 6381073
761 2739315332 2738543025 Bacteria 6600348
762 2774123628 2773857670 Bacteria 6407454
763 2784317205 2784132072 Bacteria 6596533
764 2794597940 2791355520 Bacteria 5948615
765 2808932763 2808606377 Bacteria 6646337
766 2808954847 2808606381 Bacteria 6646461
767 2808956217 2808606382 Bacteria 6841132
768 2808979726 2808606385 Bacteria 6711065
769 2808995446 2808606388 Bacteria 6706662
770 2819657824 2818991456 Bacteria 6123676
771 2825652156 2825651385 Bacteria 6715909
772 2834029886 2834028612 Bacteria 6354979
773 2842858569 2842854478 Bacteria 6143501
774 2844670004 2844665904 Bacteria 6817974
775 2852614513 2852612431 Bacteria 6885235
776 2852667749 2852667396 Bacteria 6885555
777 2860345528 2860339153 Bacteria 6846989
778 2878033256 2878029506 Bacteria 6418441
779 2880234015 2880230671 Bacteria 6140320
780 2908449667 2908446538 Bacteria 6829095
781 2912966551 2912963787 Bacteria 5646108
782 2913040164 2913036834 Bacteria 6704877
783 2919390365 2919385768 Bacteria 5897293
784 2919456312 2919456309 Bacteria 6586567
785 2919483190 2919481497 Bacteria 6907839
786 2919702608 2919697872 Bacteria 6553725
787 2923588268 2923586266 Bacteria 6565975
788 2931375013 2931369376 Bacteria 6847892
789 2931402717 2931396565 Bacteria 7251677
790 2947233586 2947233263 Bacteria 6439278
791 2988728992 2988728565 Bacteria 6124362
792 3007514656 3007511990 Bacteria 6481491
793 8015690850 8015687852 Bacteria 6613826
794 8019781089 8019775933 Bacteria 6858656
795 8029998081 8029995093 Bacteria 5990776
796 8054291254 8054285046 Bacteria 6919322
797 8054506348 8054503363 Bacteria 6101651
798 8055774021 8055770955 Bacteria 6827675
799 8055882998 8055878733 Bacteria 5907058
800 8056129045 8056125926 Bacteria 6228218
801 8056145947 8056143049 Bacteria 6307666
802 8056168506 8056166840 Bacteria 5820959
803 8056173904 8056172158 Bacteria 6133900
804 8056177744 8056177738 Bacteria 6748268
805 8056571051 8056569372 Bacteria 5997322
806 Ga0439438_003069
807 MRS2a_Contig_51
808 SwRhRL2b_contig_3602964
809 SwRhRL2b_contig_628020
810 Ga0055526_1002931
811 Ga0055537_1006879
812 Ga0055537_1017477
813 Ga0055524_1003743
814 Ga0055536_1000025
815 Ga0055536_1000037
816 Ga0055534_1001147
817 Ga0055530_10000007
818 Ga0055530_10000320
819 Ga0055530_10000621
820 Ga0055530_10001019
821 Ga0055530_10021649
822 Ga0055540_1000025
823 Ga0055540_1000729
824 Ga0055540_1000990
825 Ga0055531_10000585
826 Ga0065714_10000222
827 Ga0065714_10002603
828 Ga0065714_10003536
829 Ga0065714_10005770
830 Ga0065714_10012484
831 Ga0065714_10012953
832 Ga0065714_10014510
833 Ga0065714_10064853
834 Ga0065714_10069398
835 Ga0065714_10073329
836 Ga0065714_10112339
837 Ga0065704_10000485
838 Ga0065704_10084659
839 Ga0065704_10297060
840 Ga0065712_10022894
841 Ga0065715_10009061
842 Ga0070670_100001054
843 Ga0070661_100001004
844 Ga0070665_100027248
845 Ga0070664_100001292
846 Ga0075364_10109597
847 Ga0075364_10121978
848 Ga0075432_10000121
849 Ga0075432_10001179
850 Ga0075432_10013890
851 Ga0075432_10056622
852 Ga0075432_10066858
853 Ga0075362_10119269
854 Ga0075369_10226122
855 Ga0075436_100195864
856 Ga0075436_100331983
857 Ga0079104_1000085
858 Ga0079104_1000245
859 Ga0099826_10000365
860 Ga0105251_10001168
861 Ga0105251_10001289
862 Ga0105251_10041765
863 Ga0105251_10238941
864 Ga0105244_10000806
865 Ga0105244_10000938
866 Ga0105244_10001369
867 Ga0105244_10011001
868 Ga0105244_10015608
869 Ga0105244_10095168
870 Ga0105244_10113122
871 Ga0105244_10122649
872 Ga0105244_10131261
873 Ga0105250_10001006
874 Ga0105250_10020102
875 Ga0105243_10000230
876 Ga0105242_10001326
877 Ga0105237_10000937
878 Ga0105246_10000047
879 Ga0157345_1000005
880 Ga0157373_10000409
881 Ga0157373_10000598
882 Ga0157373_10000845
883 Ga0157373_10003727
884 Ga0157373_10004523
885 Ga0157373_10345752
886 Ga0157371_10000535
887 Ga0157370_10014974
888 Ga0157370_10023243
889 Ga0157370_10084705
890 Ga0157370_10123938
891 Ga0157370_10409479
892 Ga0157369_10002178
893 Ga0157369_10003376
894 Ga0157369_10083664
895 Ga0163162_10000053
896 Ga0163162_10016024
897 Ga0163162_10066717
898 Ga0157375_10002189
899 Ga0182008_10000449
900 Ga0182008_10001820
901 Ga0182008_10014206
902 Ga0182008_10022515
903 Ga0182006_1000099
904 Ga0182006_1000607
905 Ga0182006_1008557
906 Ga0182007_10000130
907 Ga0182007_10000379
908 Ga0182007_10115795
909 Ga0182005_1000208
910 Ga0182005_1001653
911 Ga0182005_1007489
912 Ga0182005_1020079
913 Ga0182005_1051273
914 Ga0182005_1055622
915 Ga0182005_1072883
916 Ga0163161_10000236
917 Ga0163161_10001902
918 Ga0163161_10015240
919 Ga0163161_10045187
920 Ga0163161_10074579
921 Ga0209565_1001320
922 Ga0209565_1007389
923 Ga0209675_1001584
924 Ga0209675_1018166
925 Ga0209676_1000002
926 Ga0209676_1000003
927 Ga0209676_1001129
928 Ga0209676_1003838
929 Ga0209564_1003298
930 Ga0209050_1000004
931 Ga0209050_1000006
932 Ga0209050_1000013
933 Ga0209050_1000383
934 Ga0209050_1000782
935 Ga0209256_1003993
936 Ga0209051_1000001
937 Ga0209051_1000006
938 Ga0209051_1000007
939 Ga0209051_1004486
940 Ga0209257_1000056
941 Ga0209257_1006975
942 Ga0207696_1000609
943 Ga0207696_1019146
944 Ga0207655_1000070
945 Ga0207655_1000287
946 Ga0207655_1001371
947 Ga0207655_1004780
948 Ga0207655_1033626
949 Ga0207655_1041171
950 Ga0207713_1000774
951 Ga0207713_1001306
952 Ga0207713_1001375
953 Ga0207713_1006880
954 Ga0207713_1031258
955 Ga0207713_1035755
956 Ga0207713_1038479
957 Ga0207671_10001472
958 Ga0207650_10002898
959 Ga0207686_10066968
960 Ga0207709_10000014
961 Ga0207679_10000818
962 Ga0209281_1000009
963 Ga0209281_1000046
964 Ga0207428_10034208
965 Ga0207428_10055473
966 Ga0207428_10142288
967 Ga0207428_10153875
968 Ga0207428_10271030
969 Ga0207428_10278749
970 Ga0307511_10207996
971 Ga0316178_1106511
972 Ga0307408_100003404
973 Ga0307408_100005033
974 Ga0307408_100009387
975 Ga0307408_100257029
976 Ga0307516_10157798
977 Ga0307405_10000422
978 Ga0307405_10001323
979 Ga0307405_10029146
980 Ga0307413_10086866
981 Ga0307413_10107636
982 Ga0307406_10000995
983 Ga0307406_10041420
984 Ga0307406_10052592
985 Ga0307407_10027610
986 Ga0307412_10000333
987 Ga0307412_10001855
988 Ga0307412_10037205
989 Ga0307412_10170888
990 Ga0307416_100073136
991 Ga0307416_100556234
992 Ga0307414_10053846
993 Ga0307414_10131704
994 Ga0307414_10252669
995 Ga0307411_10004076
996 Ga0307510_10001358
997 Ga0439438_000008
998 Ga0439438_000048
999 Ga0439438_002317
1000 Ga0439438_016592
1001 Ga0439447_000490
1002 Ga0439447_004724
1003 Ga0439447_004792
1004 Ga0439447_009984
1005 Ga0439447_014735
1006 Ga0439466_0003458
1007 Ga0439466_0005843
1008 Ga0439466_0015025
1009 Ga0439466_0018642
1010 Ga0439466_0022044
1011 Ga0439466_0022559
1012 Ga0439431_0000014
1013 Ga0439445_0004006
1014 Ga0439432_000037
1015 Ga0439432_000051
1016 Ga0439432_003061
1017 Ga0439432_006757
1018 Ga0439432_009182
1019 Ga0439432_070360
1020 Ga0439451_000581
1021 Ga0439451_003745
1022 Ga0439451_029152
1023 Ga0439452_000043
1024 Ga0439452_000053
1025 Ga0439452_006167
1026 Ga0439452_015778
1027 Ga0439452_025506
1028 Ga0439456_001801
1029 Ga0439456_003002
1030 Ga0439456_005148
1031 Ga0439456_005938
1032 Ga0439456_020249
1033 Ga0439463_000077
1034 Ga0439463_013249
1035 Ga0439463_017487
1036 Ga0450911_000009
1037 Ga0450911_003316
1038 Ga0450890_001291
1039 Ga0450902_002822
1040 Ga0450902_009621
1041 Ga0450902_018936
1042 Ga0450903_002453
1043 Ga0450903_004388
1044 Ga0450903_007062
1045 Ga0450905_008912
1046 Ga0450905_012020
1047 Ga0450906_000235
1048 Ga0450906_003015
1049 Ga0450907_000120
1050 Ga0450910_000572
1051 Ga0439446_0002865
1052 Ga0439446_0007421
1053 Ga0439446_0110490
1054 Ga0450909_001781
1055 Ga0450909_017498
1056 Ga0439434_0001508
1057 Ga0439434_0027030
1058 Ga0439460_0001409
1059 Ga0439460_0002552
1060 Ga0439460_0004579
1061 Ga0450893_0005198
1062 Ga0439440_0000788
1063 Ga0439440_0002062
1064 Ga0439440_0003232
1065 Ga0439440_0023712
1066 Ga0495617_000263
1067 Ga0495617_001790
1068 Ga0495617_001945
1069 Ga0495617_006314
1070 Ga0495617_007751
1071 Ga0495617_014315
1072 Ga0495617_022578
1073 Ga0495617_026689
1074 Ga0495617_031942
1075 Ga0495617_067385
1076 Ga0495627_000039
1077 Ga0495627_000140
1078 Ga0495627_000203
1079 Ga0495627_003143
1080 Ga0495627_003323
1081 Ga0495627_006275
1082 Ga0495627_006756
1083 Ga0495627_050995
1084 Ga0495627_069279
1085 Ga0495592_0369262
1086 Ga0495603_0026163
1087 Ga0495603_0079537
1088 Ga0495590_0000235
1089 Ga0495590_0001793
1090 Ga0495590_0011308
1091 Ga0495590_0015871
1092 Ga0495590_0025751
1093 Ga0495590_0149408
1094 Ga0495591_000138
1095 Ga0495591_000315
1096 Ga0495591_000749
1097 Ga0495591_004348
1098 Ga0495591_004502
1099 Ga0495591_004701
1100 Ga0495591_005726
1101 Ga0495591_020327
1102 Ga0495591_081793
1103 Ga0495629_0019754
1104 Ga0495638_0000196
1105 Ga0495638_0000298
1106 Ga0495638_0001043
1107 Ga0495638_0003321
1108 Ga0495638_0008238
1109 Ga0495638_0016259
1110 Ga0495638_0016482
1111 Ga0495638_0017286
1112 Ga0495638_0019100
1113 Ga0495638_0330389
1114 Ga0495653_0008459
1115 Ga0495653_0014104
1116 Ga0495653_0059576
1117 Ga0495653_0154981
1118 Ga0495650_0001734
1119 Ga0495650_0002021
1120 Ga0495650_0002403
1121 Ga0495650_0020041
1122 Ga0495650_0069935
1123 Ga0495582_0005980
1124 Ga0495605_0000047
1125 Ga0495605_0000810
1126 Ga0495605_0001334
1127 Ga0495605_0006683
1128 Ga0495605_0007788
1129 Ga0495605_0012511
1130 Ga0495605_0013545
1131 Ga0495605_0014291
1132 Ga0495605_0017785
1133 Ga0495605_0031209
1134 Ga0495605_0073654
1135 Ga0495639_0000059
1136 Ga0495639_0005069
1137 Ga0495584_0001872
1138 Ga0495584_0002024
1139 Ga0495584_0002780
1140 Ga0495584_0018610
1141 Ga0495584_0044030
1142 Ga0495584_0047596
1143 Ga0495584_0066240
1144 Ga0495584_0115369
1145 Ga0495584_0130398
1146 Ga0495585_0000202
1147 Ga0495585_0000333
1148 Ga0495585_0000372
1149 Ga0495585_0000622
1150 Ga0495585_0007020
1151 Ga0495585_0011004
1152 Ga0495585_0014523
1153 Ga0495585_0046949
1154 Ga0495585_0050139
1155 Ga0495585_0053859
1156 Ga0495594_0020585
1157 Ga0495594_0024695
1158 Ga0495596_0000049
1159 Ga0495607_0000770
1160 Ga0495607_0002404
1161 Ga0495607_0002730
1162 Ga0495607_0003453
1163 Ga0495607_0007340
1164 Ga0495607_0012487
1165 Ga0495607_0012867
1166 Ga0495607_0015242
1167 Ga0495607_0022703
1168 Ga0495607_0035900
1169 Ga0495607_0037452
1170 Ga0495607_0054054
1171 Ga0495607_0056852
1172 Ga0495607_0103671
1173 Ga0495607_0110503
1174 Ga0495607_0178889
1175 Ga0495583_0001642
1176 Ga0495583_0002701
1177 Ga0495583_0005647
1178 Ga0495606_0001383
1179 Ga0495606_0001516
1180 Ga0495606_0001673
1181 Ga0495606_0003190
1182 Ga0495606_0004547
1183 Ga0495606_0034606
1184 Ga0495606_0042660
1185 Ga0495610_0004087
1186 Ga0495610_0006715
1187 Ga0495610_0008691
1188 Ga0495610_0009485
1189 Ga0495610_0013198
1190 Ga0495610_0013315
1191 Ga0495610_0094534
1192 Ga0495610_0171733
1193 Ga0495616_0001576
1194 Ga0495616_0002736
1195 Ga0495616_0008814
1196 Ga0495616_0016240
1197 Ga0495616_0029761
1198 Ga0495616_0031629
1199 Ga0495616_0037040
1200 Ga0495616_0040231
1201 Ga0495616_0047496
1202 Ga0495616_0171168
1203 Ga0495620_0000855
1204 Ga0495620_0000898
1205 Ga0495620_0003212
1206 Ga0495620_0004920
1207 Ga0495620_0058224
1208 Ga0495630_0003718
1209 Ga0495630_0012638
1210 Ga0495630_0124443
1211 Ga0495631_0000002
1212 Ga0495631_0000255
1213 Ga0495631_0000479
1214 Ga0495631_0005450
1215 Ga0495631_0008780
1216 Ga0495631_0040599
1217 Ga0495632_0001723
1218 Ga0495632_0003257
1219 Ga0495632_0006402
1220 Ga0495632_0008066
1221 Ga0495632_0010340
1222 Ga0495632_0011430
1223 Ga0495632_0016206
1224 Ga0495632_0018233
1225 Ga0495632_0035835
1226 Ga0495632_0054194
1227 Ga0495637_0000044
1228 Ga0495637_0000712
1229 Ga0495637_0002779
1230 Ga0495637_0004013
1231 Ga0495637_0004709
1232 Ga0495637_0005030
1233 Ga0495637_0009418
1234 Ga0495637_0015823
1235 Ga0495637_0017434
1236 Ga0495637_0020716
1237 Ga0495637_0100641
1238 Ga0495637_0124598
1239 Ga0495637_0131936
1240 Ga0495643_0002169
1241 Ga0495643_0009722
1242 Ga0495643_0010921
1243 Ga0495643_0013147
1244 Ga0495643_0027151
1245 Ga0495643_0028611
1246 Ga0495643_0080954
1247 Ga0495643_0134473
1248 Ga0495644_0000159
1249 Ga0495644_0000878
1250 Ga0495644_0003676
1251 Ga0495644_0006693
1252 Ga0495648_0000337
1253 Ga0495648_0001764
1254 Ga0495648_0002415
1255 Ga0495648_0002559
1256 Ga0495648_0004627
1257 Ga0495648_0005118
1258 Ga0495648_0025195
1259 Ga0495648_0027788
1260 Ga0495648_0058319
1261 Ga0495648_0103531
1262 Ga0495666_0001016
1263 Ga0495666_0012277
1264 Ga0495666_0022012
1265 Ga0495654_0000197
1266 Ga0495654_0000561
1267 Ga0495654_0000851
1268 Ga0495654_0002249
1269 Ga0495654_0003898
1270 Ga0495654_0006790
1271 Ga0495654_0009969
1272 Ga0495654_0011896
1273 Ga0495654_0013179
1274 Ga0495654_0018503
1275 Ga0495654_0020353
1276 Ga0495654_0022188
1277 Ga0495654_0027919
1278 Ga0495654_0032308
1279 Ga0495654_0032587
1280 Ga0495654_0034533
1281 Ga0495586_0024052
1282 Ga0495586_0404778
1283 Ga0495587_0000089
1284 Ga0495587_0007118
1285 Ga0495609_0001094
1286 Ga0495609_0001600
1287 Ga0495609_0003417
1288 Ga0495609_0005156
1289 Ga0495609_0126406
1290 Ga0495597_0001188
1291 Ga0495597_0001323
1292 Ga0495597_0003566
1293 Ga0495597_0004046
1294 Ga0495597_0012474
1295 Ga0495597_0056870
1296 Ga0495622_0000676
1297 Ga0495622_0001176
1298 Ga0495622_0002949
1299 Ga0495622_0004344
1300 Ga0495622_0036352
1301 Ga0495622_0138718
1302 Ga0495633_0000571
1303 Ga0495633_0000656
1304 Ga0495633_0019067
1305 Ga0495656_0019650
1306 Ga0495668_0000732
1307 Ga0495668_0816890
1308 Ga0495634_0001522
1309 Ga0495634_0246334
1310 Ga0495611_0000016
1311 Ga0495611_0003958
1312 Ga0495611_0170458
1313 Ga0495625_0002733
1314 Ga0495625_0003014
1315 Ga0495625_0003863
1316 Ga0495625_0004081
1317 Ga0495625_0013745
1318 Ga0495625_0018840
1319 Ga0495625_0022688
1320 Ga0495625_0054239
1321 Ga0495625_0117690
1322 Ga0495625_0133622
1323 Ga0495625_0149807
1324 Ga0495635_0000983
1325 Ga0495635_0023127
1326 Ga0495659_0000077
1327 Ga0495661_0000011
1328 Ga0495661_0007031
1329 Ga0495661_0011184
1330 Ga0495661_0024069
1331 Ga0495661_0050371
1332 Ga0495657_0085070
1333 Ga0495623_0001160
1334 Ga0495623_0003928
1335 Ga0495646_0000414
1336 Ga0495646_0015967
1337 Ga0495646_0024053
1338 Ga0495613_0009565
1339 Ga0495670_0000373
1340 Ga0495670_0000395
1341 Ga0495670_0000563
1342 Ga0495670_0001267
1343 Ga0495670_0015676
1344 Ga0495670_0037217
1345 Ga0495670_0065492
1346 Ga0495670_0089155
1347 Ga0495671_0000324
1348 Ga0495671_0000785
1349 Ga0495671_0002489
1350 Ga0495671_0004586
1351 Ga0495671_0009284
1352 Ga0495671_0028586
1353 Ga0495671_0045244
1354 Ga0495671_0105920
1355 Ga0495671_0152090
1356 Ga0495649_0000109
1357 Ga0495649_0003158
1358 Ga0495649_0006563
1359 Ga0495649_0007664
1360 Ga0495649_0033510
1361 Ga0495649_0037666
1362 Ga0495649_0066811
1363 Ga0495649_0081647
1364 Ga0495589_0000234
1365 Ga0495589_0000448
1366 Ga0495589_0013282
1367 Ga0495589_0024813
1368 Ga0495589_0028142
1369 Ga0495589_0040394
1370 Ga0495589_0041317
1371 Ga0495589_0113860
1372 Ga0495589_0337155
1373 Ga0495600_0038653
1374 Ga0495600_0193942
1375 Ga0495660_0002216
1376 Ga0495660_0006833
1377 Ga0495660_0010915
1378 Ga0495660_0015771
1379 Ga0495660_0016370
1380 Ga0495660_0019752
1381 Ga0495660_0021162
1382 Ga0495660_0029313
1383 Ga0495660_0034952
1384 Ga0495660_0052740
1385 Ga0495660_0079838
1386 Ga0495660_0106165
1387 Ga0495581_0027447
1388 Ga0495581_0068043
1389 Ga0495604_0000559
1390 Ga0495604_0009001
1391 Ga0495604_0012707
1392 Ga0495636_0000899
1393 Ga0495674_0010426
1394 Ga0495672_0000210
1395 Ga0495672_0000796
1396 Ga0495672_0001891
1397 Ga0495672_0003138
1398 Ga0495672_0003897
1399 Ga0495672_0003926
1400 Ga0495672_0005049
1401 Ga0495672_0020951
1402 Ga0495672_0029012
1403 Ga0495672_0056840
1404 Ga0495672_0068541
1405 Ga0495672_0073862
1406 Ga0495676_0000572
1407 Ga0495676_0000985
1408 Ga0495680_0023047
1409 Ga0495680_0072661
1410 Ga0495680_0134157
1411 Ga0495683_0000037
1412 Ga0495683_0000111
1413 Ga0495683_0001421
1414 Ga0495683_0001855
1415 Ga0495683_0006727
1416 Ga0495683_0058161
1417 Ga0495687_010838
1418 Ga0495675_0009620
1419 Ga0495675_0090237
1420 Ga0495679_000064
1421 Ga0495679_000974
1422 Ga0495679_005167
1423 Ga0495679_008712
1424 Ga0495679_026079
1425 Ga0495685_009249
1426 Ga0495673_0000093
1427 Ga0495673_0001677
1428 Ga0495673_0001690
1429 Ga0495673_0004914
1430 Ga0495673_0008463
1431 Ga0495673_0013426
1432 Ga0495673_0028864
1433 Ga0495673_0048702
1434 Ga0495681_0000027
1435 Ga0495681_0000029
1436 Ga0495681_0000446
1437 Ga0495681_0002714
1438 Ga0495681_0003154
1439 Ga0495681_0004766
1440 Ga0495681_0007858
1441 Ga0495681_0010319
1442 Ga0495681_0030817
1443 Ga0495681_0150052
1444 Ga0495684_0016215
1445 Ga0495686_0001441
1446 Ga0495686_0007165
1447 Ga0495686_0015704
1448 Ga0495593_0001685
1449 Ga0495593_0007251
1450 Ga0495593_0027899
1451 Ga0495593_0105765
1452 Ga0495626_0000072
1453 Ga0495626_0000244
1454 Ga0495626_0000340
1455 Ga0495626_0000352
1456 Ga0495626_0000651
1457 Ga0495626_0003736
1458 Ga0495626_0033829
1459 Ga0495626_0045184
1460 Ga0495626_0108681
1461 Ga0495626_0245562
1462 Ga0496102_0000038
1463 Ga0496103_0003344
1464 Ga0496110_0030047
1465 Ga0496110_0057252
1466 Ga0496110_0208085
1467 Ga0496115_0131116
1468 Ga0496116_0000697
1469 Ga0496116_0002982
1470 Ga0496116_0015222
1471 Ga0496117_0003347
1472 Ga0496117_0005893
1473 Ga0496117_0058242
1474 Ga0496117_0104031
1475 Ga0496118_0004582
1476 Ga0496118_0012884
1477 Ga0496118_0018132
1478 Ga0496118_0035566
1479 Ga0496121_0136505
1480 Ga0496121_0263739
1481 Ga0496121_0612661
1482 Ga0496122_0003361
1483 Ga0496122_0101091
1484 Ga0496123_0057583
1485 Ga0496124_0004248
1486 Ga0496124_0013456
1487 Ga0496124_0100293
1488 Ga0496124_0151229
1489 Ga0496124_0376108
1490 Ga0496125_0010352
1491 Ga0496125_0029276
1492 Ga0496125_0075129
1493 Ga0496126_0165036
1494 Ga0495678_000707
1495 Ga0495678_001630
1496 Ga0495678_003056
1497 Ga0495678_010366
1498 Ga0495678_012121
1499 Ga0495678_024596
1500 Ga0495678_093682
1501 Ga0495678_113156
1502 Ga0495682_0000709
1503 Ga0495682_0217910
1504 Ga0501222_000471
1505 Ga0501224_050549
1506 Ga0501235_008488
1507 nmdc:mga00v17_213656_c1
1508 nmdc:mga00v17_45057_c1
1509 nmdc:mga00v17_65401_c1
1510 nmdc:mga08x19_101257_c1
1511 nmdc:mga08x19_290596_c1
1512 nmdc:mga0sz30_32301_c1
1513 Ga0500621_027440
1514 Ga0500573_0006243
1515 Ga0500586_007248
1516 Ga0500649_100304
1517 2511265464
1518 2511304114
1519 2511337896
1520 2511343806
1521 2511357714
1522 2511362765
1523 2511411908
1524 2511825065
1525 2512327280
1526 2583792471
1527 2599501588
1528 2599611758
1529 2599768904
1530 2599881387
1531 2599884688
1532 2599896133
1533 2599931491
1534 2599945167
1535 2599955481
1536 2599958019
1537 2599968612
1538 2599979804
1539 2599984342
1540 2599990487
1541 2600003893
1542 2600013616
1543 2600015742
1544 2600034029
1545 2600040452
1546 2600049150
1547 2600050949
1548 2600058610
1549 2600063456
1550 2600069019
1551 2624481301
1552 2624492697
1553 2643842134
1554 2643954537
1555 2644023346
1556 2644281187
1557 2652546409
1558 2671088827
1559 2715755804
1560 2738669650
1561 2738748043
1562 2738806903
1563 2738857085
1564 2738894263
1565 2739197433
1566 2739315332
1567 2774123628
1568 2784317205
1569 2794597940
1570 2808932763
1571 2808954847
1572 2808956217
1573 2808979726
1574 2808995446
1575 2819657824
1576 2825652156
1577 2834029886
1578 2842858569
1579 2844670004
1580 2852614513
1581 2852667749
1582 2860345528
1583 2878033256
1584 2880234015
1585 2908449667
1586 2912966551
1587 2913040164
1588 2919390365
1589 2919456312
1590 2919483190
1591 2919702608
1592 2923588268
1593 2931375013
1594 2931402717
1595 2947233586
1596 2988728992
1597 3007514656
1598 8015690850
1599 8019781089
1600 8029998081
1601 8054291254
1602 8054506348
1603 8055774021
1604 8055882998
1605 8056129045
1606 8056145947
1607 8056168506
1608 8056173904
1609 8056177744
1610 8056571051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12261

T_hemolysin

Thermostable hemolysin

27

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g8w-assembly1.cif.gz_A crystal structure of a probable acetyltransferase from staphylococcus epidermidis atcc 12228 0.764 58 161
3efa-assembly1.cif.gz_A-2 crystal structure of putative n-acetyltransferase from lactobacillus plantarum 0.7084 21 193
3ne7-assembly1.cif.gz_A crystal structure of paia n-acetyltransferase from thermoplasma acidophilum in complex with coenzyme a 0.6979 59 192
3efa-assembly1.cif.gz_A-2 crystal structure of putative n-acetyltransferase from lactobacillus plantarum 0.6914 21 193
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.6836 58 192
ID Description Score Start End Superfamily
4pv6F00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7067 59 193 3.40.630.30
af_I6YEZ8_30_168_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7046 65 144 3.40.630.30
3k9uB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6964 59 192 3.40.630.30
3efaA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.69 23 193 3.40.630.30
3h4qA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6758 31 193 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W5Y336-F1-model_v4 deleted 0.9771 21 204
AF-A0A1M3NX95-F1-model_v4 Thermostable hemolysin 0.9752 21 202
AF-A0A2M7N4E1-F1-model_v4 Uncharacterized protein 0.9741 21 135
AF-A0A2N3P510-F1-model_v4 deleted 0.9714 1 222
AF-A0A2K4G0C5-F1-model_v4 Thermostable hemolysin 0.9697 1 202

Map