F481645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 806 | 289 | 800 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300025960|Ga0207651_10099193|Ga0207651_100991932 |
| Length | 350 |
| Sequence | VGLNPRNARCAAIKTRFIAPCHDEAVVMRYLFDCAAIAITLTASSTSTLAQTYPVKPLRIIAAQSAGGVTDMLARTLAQKFNESWKQPAVVENRPGAGGAIGTEVAAKSAPDGYTLLLSSAGPIVINQYLYPSLAYDPLRDLQPIAFIASSPLILVTHPSVPARSVRELIALARAKPDKLSYGSGGSGSPPHLTAELFKTTTGVRMVHVPYKGSAPSVLALVAGQVDLSFSTVVITLPQIKAGRLHALAVTSPKRSRVVPDLPTMEEAGVAGFESQQWFGLFAPAGLAQDIVSKIYAETTRVIQSPQIRDRLANEGGEPDTLTPDQFAAFIRRDAARWAKVVKDSGATAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 2 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 210 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 211 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 212 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 213 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 248 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 249 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 284 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 289 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.85 |
| Nodule | 0 |
| Rhizoplane | 2.48 |
| Rhizosphere | 94.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000707 | 3300003203 | Bacteria | 15594 |
| 2 | Ga0055540_1000654 | 3300003792 | Bacteria | 24325 |
| 3 | Ga0065712_10135169 | 3300005290 | Bacteria | 1505 |
| 4 | Ga0070676_10027201 | 3300005328 | Bacteria | 3242 |
| 5 | Ga0070676_10055984 | 3300005328 | Bacteria | 2329 |
| 6 | Ga0070683_100009923 | 3300005329 | Bacteria | 8162 |
| 7 | Ga0070683_100013594 | 3300005329 | Bacteria | 7103 |
| 8 | Ga0070690_100020953 | 3300005330 | Bacteria | 3988 |
| 9 | Ga0070690_100074882 | 3300005330 | Bacteria | 2206 |
| 10 | Ga0070690_100143099 | 3300005330 | Bacteria | 1625 |
| 11 | Ga0070670_100000483 | 3300005331 | Bacteria | 31999 |
| 12 | Ga0070670_100003991 | 3300005331 | Bacteria | 12315 |
| 13 | Ga0070670_100005246 | 3300005331 | Bacteria | 10911 |
| 14 | Ga0070670_100037537 | 3300005331 | Bacteria | 4168 |
| 15 | Ga0070670_100185270 | 3300005331 | Bacteria | 1807 |
| 16 | Ga0070677_10001359 | 3300005333 | Bacteria | 7813 |
| 17 | Ga0070677_10004286 | 3300005333 | Bacteria | 4643 |
| 18 | Ga0070677_10007754 | 3300005333 | Unclassified | 3594 |
| 19 | Ga0070677_10015234 | 3300005333 | Bacteria | 2721 |
| 20 | Ga0070677_10024668 | 3300005333 | Bacteria | 2238 |
| 21 | Ga0068869_100034372 | 3300005334 | Bacteria | 3585 |
| 22 | Ga0068869_100045460 | 3300005334 | Bacteria | 3161 |
| 23 | Ga0068869_100102771 | 3300005334 | Bacteria | 2164 |
| 24 | Ga0068869_100166393 | 3300005334 | Unclassified | 1720 |
| 25 | Ga0068869_100173131 | 3300005334 | Bacteria | 1687 |
| 26 | Ga0070666_10003778 | 3300005335 | Bacteria | 9180 |
| 27 | Ga0070666_10017090 | 3300005335 | Bacteria | 4648 |
| 28 | Ga0070666_10017096 | 3300005335 | Bacteria | 4646 |
| 29 | Ga0070666_10018150 | 3300005335 | Bacteria | 4519 |
| 30 | Ga0070666_10031393 | 3300005335 | Unclassified | 3507 |
| 31 | Ga0070666_10039114 | 3300005335 | Bacteria | 3159 |
| 32 | Ga0070680_100388808 | 3300005336 | Bacteria | 1188 |
| 33 | Ga0068868_100000421 | 3300005338 | Bacteria | 28678 |
| 34 | Ga0068868_100000544 | 3300005338 | Bacteria | 25315 |
| 35 | Ga0068868_100006019 | 3300005338 | Bacteria | 8565 |
| 36 | Ga0068868_100011660 | 3300005338 | Bacteria | 6404 |
| 37 | Ga0068868_100025660 | 3300005338 | Bacteria | 4485 |
| 38 | Ga0068868_100036427 | 3300005338 | Bacteria | 3808 |
| 39 | Ga0068868_100108964 | 3300005338 | Unclassified | 2249 |
| 40 | Ga0070660_100085657 | 3300005339 | Unclassified | 2479 |
| 41 | Ga0070689_100031295 | 3300005340 | Bacteria | 4043 |
| 42 | Ga0070689_100102376 | 3300005340 | Bacteria | 2268 |
| 43 | Ga0070689_100265045 | 3300005340 | Bacteria | 1421 |
| 44 | Ga0070689_100360338 | 3300005340 | Bacteria | 1222 |
| 45 | Ga0070687_100053678 | 3300005343 | Bacteria | 2097 |
| 46 | Ga0070687_100088813 | 3300005343 | Bacteria | 1705 |
| 47 | Ga0070687_100189671 | 3300005343 | Bacteria | 1238 |
| 48 | Ga0070661_100002938 | 3300005344 | Bacteria | 11761 |
| 49 | Ga0070661_100011278 | 3300005344 | Bacteria | 6227 |
| 50 | Ga0070692_10087247 | 3300005345 | Bacteria | 1690 |
| 51 | Ga0070668_100027916 | 3300005347 | Bacteria | 4284 |
| 52 | Ga0070668_100037336 | 3300005347 | Bacteria | 3709 |
| 53 | Ga0070668_100193293 | 3300005347 | Bacteria | 1668 |
| 54 | Ga0070668_100218808 | 3300005347 | Bacteria | 1570 |
| 55 | Ga0070668_100304915 | 3300005347 | Bacteria | 1336 |
| 56 | Ga0070669_100016792 | 3300005353 | Bacteria | 5224 |
| 57 | Ga0070669_100084505 | 3300005353 | Bacteria | 2368 |
| 58 | Ga0070669_100095430 | 3300005353 | Unclassified | 2236 |
| 59 | Ga0070669_100182247 | 3300005353 | Bacteria | 1643 |
| 60 | Ga0070675_100001594 | 3300005354 | Bacteria | 16751 |
| 61 | Ga0070675_100005907 | 3300005354 | Bacteria | 9376 |
| 62 | Ga0070675_100029057 | 3300005354 | Bacteria | 4455 |
| 63 | Ga0070675_100036749 | 3300005354 | Bacteria | 3987 |
| 64 | Ga0070675_100062904 | 3300005354 | Bacteria | 3067 |
| 65 | Ga0070675_100135125 | 3300005354 | Bacteria | 2104 |
| 66 | Ga0070675_100277660 | 3300005354 | Bacteria | 1471 |
| 67 | Ga0070675_100333367 | 3300005354 | Bacteria | 1342 |
| 68 | Ga0070671_100010384 | 3300005355 | Bacteria | 7469 |
| 69 | Ga0070671_100012134 | 3300005355 | Bacteria | 6934 |
| 70 | Ga0070671_100013744 | 3300005355 | Bacteria | 6530 |
| 71 | Ga0070671_100026402 | 3300005355 | Bacteria | 4772 |
| 72 | Ga0070671_100030090 | 3300005355 | Unclassified | 4480 |
| 73 | Ga0070671_100052140 | 3300005355 | Bacteria | 3402 |
| 74 | Ga0070671_100056542 | 3300005355 | Bacteria | 3264 |
| 75 | Ga0070674_100017437 | 3300005356 | Bacteria | 4518 |
| 76 | Ga0070674_100020518 | 3300005356 | Bacteria | 4225 |
| 77 | Ga0070674_100021230 | 3300005356 | Bacteria | 4164 |
| 78 | Ga0070674_100081161 | 3300005356 | Bacteria | 2317 |
| 79 | Ga0070673_100006483 | 3300005364 | Bacteria | 7609 |
| 80 | Ga0070673_100008587 | 3300005364 | Bacteria | 6802 |
| 81 | Ga0070673_100010295 | 3300005364 | Bacteria | 6326 |
| 82 | Ga0070673_100024852 | 3300005364 | Bacteria | 4398 |
| 83 | Ga0070673_100046006 | 3300005364 | Bacteria | 3387 |
| 84 | Ga0070673_100129300 | 3300005364 | Unclassified | 2117 |
| 85 | Ga0070673_100181856 | 3300005364 | Bacteria | 1800 |
| 86 | Ga0070688_100012765 | 3300005365 | Bacteria | 4717 |
| 87 | Ga0070688_100044115 | 3300005365 | Bacteria | 2751 |
| 88 | Ga0070688_100100052 | 3300005365 | Bacteria | 1910 |
| 89 | Ga0070667_100001848 | 3300005367 | Bacteria | 18822 |
| 90 | Ga0070667_100067791 | 3300005367 | Bacteria | 3035 |
| 91 | Ga0070667_100073068 | 3300005367 | Bacteria | 2924 |
| 92 | Ga0070667_100085974 | 3300005367 | Bacteria | 2698 |
| 93 | Ga0070667_100209236 | 3300005367 | Bacteria | 1733 |
| 94 | Ga0070667_100300881 | 3300005367 | Unclassified | 1444 |
| 95 | Ga0070667_100304079 | 3300005367 | Unclassified | 1436 |
| 96 | Ga0070714_100022417 | 3300005435 | Bacteria | 5179 |
| 97 | Ga0070701_10038810 | 3300005438 | Bacteria | 2412 |
| 98 | Ga0070701_10100119 | 3300005438 | Bacteria | 1604 |
| 99 | Ga0070705_100026095 | 3300005440 | Bacteria | 3177 |
| 100 | Ga0070705_100115222 | 3300005440 | Unclassified | 1725 |
| 101 | Ga0070700_100011392 | 3300005441 | Unclassified | 4925 |
| 102 | Ga0070700_100018163 | 3300005441 | Bacteria | 4038 |
| 103 | Ga0070700_100026460 | 3300005441 | Bacteria | 3426 |
| 104 | Ga0070700_100078837 | 3300005441 | Bacteria | 2121 |
| 105 | Ga0070694_100094041 | 3300005444 | Unclassified | 2108 |
| 106 | Ga0070694_100179028 | 3300005444 | Unclassified | 1567 |
| 107 | Ga0070678_100000281 | 3300005456 | Bacteria | 23641 |
| 108 | Ga0070678_100000701 | 3300005456 | Bacteria | 16588 |
| 109 | Ga0070678_100002597 | 3300005456 | Bacteria | 9929 |
| 110 | Ga0070678_100003716 | 3300005456 | Bacteria | 8541 |
| 111 | Ga0070678_100003940 | 3300005456 | Bacteria | 8341 |
| 112 | Ga0070678_100010672 | 3300005456 | Bacteria | 5625 |
| 113 | Ga0070678_100022358 | 3300005456 | Bacteria | 4189 |
| 114 | Ga0070678_100056346 | 3300005456 | Bacteria | 2874 |
| 115 | Ga0070678_100059588 | 3300005456 | Bacteria | 2806 |
| 116 | Ga0070678_100079281 | 3300005456 | Bacteria | 2483 |
| 117 | Ga0070678_100172825 | 3300005456 | Bacteria | 1761 |
| 118 | Ga0070678_100243805 | 3300005456 | Bacteria | 1504 |
| 119 | Ga0070678_100313418 | 3300005456 | Unclassified | 1337 |
| 120 | Ga0070662_100031021 | 3300005457 | Bacteria | 3747 |
| 121 | Ga0070662_100069338 | 3300005457 | Bacteria | 2594 |
| 122 | Ga0070662_100089304 | 3300005457 | Bacteria | 2311 |
| 123 | Ga0070662_100333670 | 3300005457 | Bacteria | 1239 |
| 124 | Ga0070681_10007773 | 3300005458 | Bacteria | 10481 |
| 125 | Ga0070681_10012078 | 3300005458 | Bacteria | 8564 |
| 126 | Ga0070681_10036424 | 3300005458 | Bacteria | 4940 |
| 127 | Ga0070681_10044687 | 3300005458 | Unclassified | 4434 |
| 128 | Ga0070681_10055432 | 3300005458 | Bacteria | 3946 |
| 129 | Ga0070681_10063499 | 3300005458 | Bacteria | 3665 |
| 130 | Ga0070681_10133033 | 3300005458 | Bacteria | 2419 |
| 131 | Ga0068867_100008650 | 3300005459 | Bacteria | 7189 |
| 132 | Ga0068867_100009787 | 3300005459 | Bacteria | 6756 |
| 133 | Ga0068867_100011002 | 3300005459 | Bacteria | 6379 |
| 134 | Ga0068867_100015279 | 3300005459 | Bacteria | 5442 |
| 135 | Ga0068867_100137478 | 3300005459 | Bacteria | 1906 |
| 136 | Ga0068867_100279118 | 3300005459 | Bacteria | 1369 |
| 137 | Ga0070685_10052239 | 3300005466 | Bacteria | 2365 |
| 138 | Ga0070706_100007041 | 3300005467 | Bacteria | 10604 |
| 139 | Ga0070706_100023816 | 3300005467 | Bacteria | 5637 |
| 140 | Ga0070706_100060112 | 3300005467 | Bacteria | 3507 |
| 141 | Ga0070706_100086903 | 3300005467 | Unclassified | 2898 |
| 142 | Ga0070706_100109456 | 3300005467 | Bacteria | 2571 |
| 143 | Ga0070706_100340103 | 3300005467 | Bacteria | 1399 |
| 144 | Ga0070707_100013180 | 3300005468 | Bacteria | 7729 |
| 145 | Ga0070707_100017332 | 3300005468 | Bacteria | 6771 |
| 146 | Ga0070707_100092583 | 3300005468 | Bacteria | 2927 |
| 147 | Ga0070698_100000120 | 3300005471 | Bacteria | 67569 |
| 148 | Ga0070679_100042295 | 3300005530 | Bacteria | 4537 |
| 149 | Ga0070684_100198522 | 3300005535 | Unclassified | 1827 |
| 150 | Ga0070697_100013262 | 3300005536 | Bacteria | 6463 |
| 151 | Ga0070697_100043501 | 3300005536 | Bacteria | 3637 |
| 152 | Ga0070697_100173121 | 3300005536 | Bacteria | 1828 |
| 153 | Ga0070697_100224505 | 3300005536 | Bacteria | 1601 |
| 154 | Ga0068853_100093077 | 3300005539 | Bacteria | 2653 |
| 155 | Ga0070672_100000856 | 3300005543 | Bacteria | 18175 |
| 156 | Ga0070672_100001056 | 3300005543 | Bacteria | 16805 |
| 157 | Ga0070672_100031926 | 3300005543 | Bacteria | 3970 |
| 158 | Ga0070672_100040680 | 3300005543 | Bacteria | 3568 |
| 159 | Ga0070672_100057319 | 3300005543 | Bacteria | 3057 |
| 160 | Ga0070672_100088638 | 3300005543 | Unclassified | 2491 |
| 161 | Ga0070672_100127568 | 3300005543 | Bacteria | 2088 |
| 162 | Ga0070686_100067046 | 3300005544 | Bacteria | 2336 |
| 163 | Ga0070686_100171091 | 3300005544 | Bacteria | 1536 |
| 164 | Ga0070686_100271527 | 3300005544 | Bacteria | 1247 |
| 165 | Ga0070695_100008105 | 3300005545 | Bacteria | 6225 |
| 166 | Ga0070695_100069972 | 3300005545 | Bacteria | 2294 |
| 167 | Ga0070695_100178905 | 3300005545 | Bacteria | 1501 |
| 168 | Ga0070695_100191469 | 3300005545 | Bacteria | 1456 |
| 169 | Ga0070696_100025217 | 3300005546 | Bacteria | 4041 |
| 170 | Ga0070696_100129137 | 3300005546 | Bacteria | 1837 |
| 171 | Ga0070693_100040794 | 3300005547 | Bacteria | 2608 |
| 172 | Ga0070693_100252069 | 3300005547 | Unclassified | 1170 |
| 173 | Ga0070665_100002513 | 3300005548 | Bacteria | 20153 |
| 174 | Ga0070665_100059038 | 3300005548 | Bacteria | 3845 |
| 175 | Ga0070665_100263154 | 3300005548 | Bacteria | 1726 |
| 176 | Ga0070704_100059510 | 3300005549 | Unclassified | 2726 |
| 177 | Ga0070704_100195752 | 3300005549 | Unclassified | 1628 |
| 178 | Ga0070664_100000329 | 3300005564 | Bacteria | 34409 |
| 179 | Ga0070664_100089901 | 3300005564 | Bacteria | 2657 |
| 180 | Ga0070664_100092960 | 3300005564 | Bacteria | 2613 |
| 181 | Ga0070664_100189974 | 3300005564 | Bacteria | 1830 |
| 182 | Ga0070664_100337333 | 3300005564 | Bacteria | 1369 |
| 183 | Ga0070664_100369932 | 3300005564 | Bacteria | 1306 |
| 184 | Ga0068854_100004773 | 3300005578 | Bacteria | 8546 |
| 185 | Ga0068854_100011066 | 3300005578 | Bacteria | 5856 |
| 186 | Ga0068854_100048908 | 3300005578 | Bacteria | 3019 |
| 187 | Ga0068854_100398249 | 3300005578 | Bacteria | 1139 |
| 188 | Ga0070702_100013023 | 3300005615 | Bacteria | 4188 |
| 189 | Ga0070702_100038175 | 3300005615 | Bacteria | 2672 |
| 190 | Ga0070702_100073639 | 3300005615 | Bacteria | 2024 |
| 191 | Ga0070702_100128147 | 3300005615 | Bacteria | 1599 |
| 192 | Ga0068852_100000200 | 3300005616 | Bacteria | 40742 |
| 193 | Ga0068852_100010934 | 3300005616 | Bacteria | 6802 |
| 194 | Ga0068852_100058250 | 3300005616 | Unclassified | 3345 |
| 195 | Ga0068859_100072696 | 3300005617 | Bacteria | 3476 |
| 196 | Ga0068859_100398820 | 3300005617 | Bacteria | 1471 |
| 197 | Ga0068859_100607429 | 3300005617 | Bacteria | 1187 |
| 198 | Ga0068864_100005962 | 3300005618 | Bacteria | 9999 |
| 199 | Ga0068864_100032913 | 3300005618 | Bacteria | 4406 |
| 200 | Ga0068864_100051979 | 3300005618 | Bacteria | 3531 |
| 201 | Ga0068864_100085741 | 3300005618 | Bacteria | 2769 |
| 202 | Ga0068864_100093333 | 3300005618 | Bacteria | 2658 |
| 203 | Ga0068866_10023077 | 3300005718 | Unclassified | 2889 |
| 204 | Ga0068866_10028078 | 3300005718 | Bacteria | 2678 |
| 205 | Ga0068866_10084268 | 3300005718 | Bacteria | 1715 |
| 206 | Ga0068866_10174747 | 3300005718 | Bacteria | 1264 |
| 207 | Ga0068861_100027261 | 3300005719 | Bacteria | 4159 |
| 208 | Ga0068861_100049628 | 3300005719 | Bacteria | 3178 |
| 209 | Ga0068861_100186214 | 3300005719 | Bacteria | 1731 |
| 210 | Ga0068851_10120327 | 3300005834 | Bacteria | 1410 |
| 211 | Ga0068870_10026086 | 3300005840 | Unclassified | 2909 |
| 212 | Ga0068870_10027623 | 3300005840 | Bacteria | 2840 |
| 213 | Ga0068870_10045907 | 3300005840 | Bacteria | 2289 |
| 214 | Ga0068870_10162374 | 3300005840 | Bacteria | 1326 |
| 215 | Ga0068863_100043608 | 3300005841 | Unclassified | 4257 |
| 216 | Ga0068863_100101849 | 3300005841 | Bacteria | 2730 |
| 217 | Ga0068863_100143398 | 3300005841 | Bacteria | 2284 |
| 218 | Ga0068863_100153418 | 3300005841 | Bacteria | 2204 |
| 219 | Ga0068858_100014277 | 3300005842 | Bacteria | 7489 |
| 220 | Ga0068858_100059116 | 3300005842 | Bacteria | 3543 |
| 221 | Ga0068858_100186819 | 3300005842 | Bacteria | 1957 |
| 222 | Ga0068860_100060532 | 3300005843 | Bacteria | 3598 |
| 223 | Ga0068860_100066252 | 3300005843 | Unclassified | 3430 |
| 224 | Ga0068860_100121034 | 3300005843 | Bacteria | 2506 |
| 225 | Ga0068860_100128216 | 3300005843 | Bacteria | 2433 |
| 226 | Ga0068860_100229119 | 3300005843 | Bacteria | 1805 |
| 227 | Ga0068862_100073405 | 3300005844 | Bacteria | 2956 |
| 228 | Ga0068862_100077340 | 3300005844 | Bacteria | 2881 |
| 229 | Ga0068862_100109561 | 3300005844 | Bacteria | 2422 |
| 230 | Ga0068862_100189171 | 3300005844 | Unclassified | 1851 |
| 231 | Ga0068862_100256979 | 3300005844 | Bacteria | 1593 |
| 232 | Ga0081455_10000164 | 3300005937 | Bacteria | 81995 |
| 233 | Ga0081455_10001486 | 3300005937 | Bacteria | 29017 |
| 234 | Ga0081539_10000054 | 3300005985 | Bacteria | 259053 |
| 235 | Ga0081539_10001828 | 3300005985 | Bacteria | 33585 |
| 236 | Ga0081539_10007960 | 3300005985 | Bacteria | 9425 |
| 237 | Ga0075365_10232852 | 3300006038 | Bacteria | 1293 |
| 238 | Ga0075363_100029258 | 3300006048 | Bacteria | 2842 |
| 239 | Ga0070715_10095912 | 3300006163 | Bacteria | 1374 |
| 240 | Ga0070716_100001401 | 3300006173 | Bacteria | 10690 |
| 241 | Ga0075362_10011395 | 3300006177 | Bacteria | 3501 |
| 242 | Ga0075367_10010209 | 3300006178 | Bacteria | 4925 |
| 243 | Ga0075367_10027710 | 3300006178 | Bacteria | 3225 |
| 244 | Ga0075369_10000327 | 3300006186 | Bacteria | 14203 |
| 245 | Ga0075369_10065672 | 3300006186 | Bacteria | 1591 |
| 246 | Ga0075366_10045257 | 3300006195 | Bacteria | 2608 |
| 247 | Ga0097621_100004924 | 3300006237 | Bacteria | 9368 |
| 248 | Ga0097621_100008507 | 3300006237 | Bacteria | 7389 |
| 249 | Ga0097621_100039222 | 3300006237 | Bacteria | 3803 |
| 250 | Ga0097621_100059196 | 3300006237 | Bacteria | 3135 |
| 251 | Ga0097621_100068795 | 3300006237 | Bacteria | 2921 |
| 252 | Ga0097621_100071128 | 3300006237 | Bacteria | 2874 |
| 253 | Ga0097621_100097369 | 3300006237 | Bacteria | 2470 |
| 254 | Ga0097621_100210972 | 3300006237 | Bacteria | 1690 |
| 255 | Ga0075370_10010206 | 3300006353 | Bacteria | 4899 |
| 256 | Ga0075370_10096697 | 3300006353 | Bacteria | 1707 |
| 257 | Ga0068871_100000437 | 3300006358 | Bacteria | 28701 |
| 258 | Ga0068871_100000447 | 3300006358 | Bacteria | 28376 |
| 259 | Ga0068871_100010311 | 3300006358 | Bacteria | 6813 |
| 260 | Ga0068871_100010723 | 3300006358 | Bacteria | 6701 |
| 261 | Ga0068871_100012469 | 3300006358 | Bacteria | 6268 |
| 262 | Ga0068871_100031597 | 3300006358 | Bacteria | 4176 |
| 263 | Ga0075428_100002635 | 3300006844 | Bacteria | 19521 |
| 264 | Ga0075428_100006285 | 3300006844 | Bacteria | 13204 |
| 265 | Ga0075428_100012504 | 3300006844 | Bacteria | 9440 |
| 266 | Ga0075428_100112140 | 3300006844 | Bacteria | 2970 |
| 267 | Ga0075428_100139966 | 3300006844 | Bacteria | 2631 |
| 268 | Ga0075430_100051035 | 3300006846 | Bacteria | 3487 |
| 269 | Ga0075430_100229313 | 3300006846 | Bacteria | 1540 |
| 270 | Ga0075430_100313143 | 3300006846 | Bacteria | 1298 |
| 271 | Ga0075431_100001415 | 3300006847 | Bacteria | 22040 |
| 272 | Ga0075431_100007754 | 3300006847 | Bacteria | 10692 |
| 273 | Ga0075431_100025203 | 3300006847 | Bacteria | 6097 |
| 274 | Ga0075433_10107914 | 3300006852 | Bacteria | 2469 |
| 275 | Ga0075434_100096576 | 3300006871 | Bacteria | 2960 |
| 276 | Ga0075434_100327861 | 3300006871 | Bacteria | 1551 |
| 277 | Ga0075429_100005895 | 3300006880 | Bacteria | 10576 |
| 278 | Ga0075429_100026726 | 3300006880 | Bacteria | 5011 |
| 279 | Ga0075429_100028009 | 3300006880 | Bacteria | 4890 |
| 280 | Ga0075429_100029527 | 3300006880 | Bacteria | 4762 |
| 281 | Ga0075429_100041179 | 3300006880 | Bacteria | 4023 |
| 282 | Ga0068865_100037331 | 3300006881 | Unclassified | 3279 |
| 283 | Ga0068865_100063041 | 3300006881 | Bacteria | 2604 |
| 284 | Ga0068865_100071529 | 3300006881 | Bacteria | 2461 |
| 285 | Ga0075436_100020610 | 3300006914 | Bacteria | 4524 |
| 286 | Ga0075436_100029510 | 3300006914 | Bacteria | 3772 |
| 287 | Ga0097620_100072698 | 3300006931 | Bacteria | 3476 |
| 288 | Ga0097620_100398850 | 3300006931 | Bacteria | 1471 |
| 289 | Ga0097620_100607488 | 3300006931 | Bacteria | 1187 |
| 290 | Ga0075435_100006662 | 3300007076 | Bacteria | 8187 |
| 291 | Ga0075435_100122597 | 3300007076 | Bacteria | 2170 |
| 292 | Ga0075435_100140791 | 3300007076 | Bacteria | 2024 |
| 293 | Ga0075435_100317543 | 3300007076 | Bacteria | 1333 |
| 294 | Ga0099794_10022778 | 3300007265 | Bacteria | 2858 |
| 295 | Ga0099794_10022852 | 3300007265 | Bacteria | 2855 |
| 296 | Ga0099794_10025794 | 3300007265 | Bacteria | 2711 |
| 297 | Ga0099794_10053843 | 3300007265 | Bacteria | 1941 |
| 298 | Ga0099794_10138818 | 3300007265 | Bacteria | 1230 |
| 299 | Ga0099795_10025500 | 3300007788 | Bacteria | 1983 |
| 300 | Ga0111539_10001180 | 3300009094 | Bacteria | 34688 |
| 301 | Ga0111539_10002096 | 3300009094 | Bacteria | 26642 |
| 302 | Ga0111539_10011072 | 3300009094 | Bacteria | 11348 |
| 303 | Ga0111539_10017884 | 3300009094 | Bacteria | 8779 |
| 304 | Ga0111539_10030251 | 3300009094 | Bacteria | 6585 |
| 305 | Ga0111539_10035779 | 3300009094 | Bacteria | 6011 |
| 306 | Ga0111539_10045031 | 3300009094 | Bacteria | 5283 |
| 307 | Ga0111539_10061458 | 3300009094 | Bacteria | 4450 |
| 308 | Ga0111539_10076202 | 3300009094 | Bacteria | 3949 |
| 309 | Ga0111539_10209544 | 3300009094 | Bacteria | 2271 |
| 310 | Ga0111539_10237065 | 3300009094 | Bacteria | 2124 |
| 311 | Ga0111539_10312331 | 3300009094 | Bacteria | 1829 |
| 312 | Ga0111539_10374209 | 3300009094 | Unclassified | 1658 |
| 313 | Ga0111539_10412471 | 3300009094 | Bacteria | 1573 |
| 314 | Ga0105245_10026682 | 3300009098 | Bacteria | 5086 |
| 315 | Ga0105245_10052676 | 3300009098 | Bacteria | 3650 |
| 316 | Ga0105245_10476048 | 3300009098 | Bacteria | 1261 |
| 317 | Ga0105245_10493467 | 3300009098 | Bacteria | 1239 |
| 318 | Ga0105247_10198235 | 3300009101 | Bacteria | 1347 |
| 319 | Ga0114129_10019617 | 3300009147 | Bacteria | 9625 |
| 320 | Ga0114129_10133238 | 3300009147 | Bacteria | 3412 |
| 321 | Ga0114129_10493654 | 3300009147 | Bacteria | 1600 |
| 322 | Ga0105243_10021111 | 3300009148 | Bacteria | 4942 |
| 323 | Ga0105243_10042758 | 3300009148 | Bacteria | 3548 |
| 324 | Ga0105243_10058198 | 3300009148 | Unclassified | 3079 |
| 325 | Ga0105243_10059257 | 3300009148 | Bacteria | 3055 |
| 326 | Ga0105243_10093022 | 3300009148 | Bacteria | 2487 |
| 327 | Ga0105243_10431390 | 3300009148 | Bacteria | 1232 |
| 328 | Ga0105242_10003850 | 3300009176 | Bacteria | 11669 |
| 329 | Ga0105242_10004388 | 3300009176 | Bacteria | 10975 |
| 330 | Ga0105242_10037532 | 3300009176 | Unclassified | 3892 |
| 331 | Ga0105242_10112289 | 3300009176 | Bacteria | 2325 |
| 332 | Ga0105242_10113883 | 3300009176 | Bacteria | 2310 |
| 333 | Ga0105242_10182831 | 3300009176 | Bacteria | 1851 |
| 334 | Ga0105248_10068598 | 3300009177 | Bacteria | 3981 |
| 335 | Ga0105248_10133730 | 3300009177 | Bacteria | 2798 |
| 336 | Ga0105248_10218854 | 3300009177 | Bacteria | 2144 |
| 337 | Ga0105238_10117235 | 3300009551 | Bacteria | 2643 |
| 338 | Ga0105249_10035327 | 3300009553 | Bacteria | 4533 |
| 339 | Ga0105249_10072198 | 3300009553 | Bacteria | 3190 |
| 340 | Ga0105249_10129402 | 3300009553 | Bacteria | 2408 |
| 341 | Ga0105249_10133150 | 3300009553 | Bacteria | 2375 |
| 342 | Ga0105246_10087302 | 3300011119 | Bacteria | 2238 |
| 343 | Ga0105246_10331506 | 3300011119 | Bacteria | 1240 |
| 344 | Ga0157374_10000653 | 3300013296 | Bacteria | 30599 |
| 345 | Ga0157374_10020612 | 3300013296 | Bacteria | 5854 |
| 346 | Ga0157374_10074917 | 3300013296 | Unclassified | 3198 |
| 347 | Ga0157374_10140639 | 3300013296 | Bacteria | 2343 |
| 348 | Ga0157374_10199794 | 3300013296 | Bacteria | 1957 |
| 349 | Ga0157374_10391766 | 3300013296 | Bacteria | 1385 |
| 350 | Ga0157374_10538577 | 3300013296 | Unclassified | 1175 |
| 351 | Ga0157378_10011956 | 3300013297 | Bacteria | 7601 |
| 352 | Ga0157378_10018221 | 3300013297 | Bacteria | 6163 |
| 353 | Ga0157378_10033333 | 3300013297 | Bacteria | 4552 |
| 354 | Ga0157378_10058465 | 3300013297 | Bacteria | 3439 |
| 355 | Ga0157378_10083852 | 3300013297 | Bacteria | 2885 |
| 356 | Ga0157378_10161624 | 3300013297 | Bacteria | 2095 |
| 357 | Ga0157378_10222622 | 3300013297 | Bacteria | 1794 |
| 358 | Ga0157378_10225251 | 3300013297 | Bacteria | 1784 |
| 359 | Ga0163162_10015389 | 3300013306 | Bacteria | 7473 |
| 360 | Ga0163162_10015710 | 3300013306 | Bacteria | 7397 |
| 361 | Ga0163162_10047449 | 3300013306 | Bacteria | 4305 |
| 362 | Ga0163162_10145969 | 3300013306 | Unclassified | 2482 |
| 363 | Ga0163162_10222961 | 3300013306 | Bacteria | 2015 |
| 364 | Ga0163162_10441658 | 3300013306 | Unclassified | 1433 |
| 365 | Ga0157375_10000621 | 3300013308 | Bacteria | 31483 |
| 366 | Ga0157375_10002228 | 3300013308 | Bacteria | 16782 |
| 367 | Ga0157375_10056907 | 3300013308 | Bacteria | 3863 |
| 368 | Ga0157375_10143108 | 3300013308 | Bacteria | 2520 |
| 369 | Ga0157375_10228828 | 3300013308 | Bacteria | 2018 |
| 370 | Ga0157375_10432767 | 3300013308 | Bacteria | 1481 |
| 371 | Ga0163163_10036631 | 3300014325 | Bacteria | 4767 |
| 372 | Ga0163163_10255438 | 3300014325 | Unclassified | 1803 |
| 373 | Ga0157380_10044574 | 3300014326 | Bacteria | 3477 |
| 374 | Ga0157380_10257517 | 3300014326 | Bacteria | 1583 |
| 375 | Ga0157380_10624835 | 3300014326 | Bacteria | 1070 |
| 376 | Ga0157379_10019658 | 3300014968 | Bacteria | 5967 |
| 377 | Ga0157379_10113279 | 3300014968 | Bacteria | 2438 |
| 378 | Ga0157376_10006789 | 3300014969 | Bacteria | 8104 |
| 379 | Ga0157376_10031688 | 3300014969 | Bacteria | 4237 |
| 380 | Ga0157376_10150259 | 3300014969 | Bacteria | 2100 |
| 381 | Ga0157376_10151113 | 3300014969 | Unclassified | 2094 |
| 382 | Ga0157376_10206101 | 3300014969 | Bacteria | 1812 |
| 383 | Ga0157376_10357802 | 3300014969 | Bacteria | 1399 |
| 384 | Ga0157376_10451998 | 3300014969 | Bacteria | 1253 |
| 385 | Ga0157376_10688514 | 3300014969 | Bacteria | 1026 |
| 386 | Ga0163161_10010635 | 3300017792 | Bacteria | 6372 |
| 387 | Ga0163161_10029881 | 3300017792 | Bacteria | 3874 |
| 388 | Ga0163161_10060246 | 3300017792 | Bacteria | 2762 |
| 389 | Ga0163161_10326356 | 3300017792 | Bacteria | 1214 |
| 390 | Ga0209130_1029636 | 3300025284 | Bacteria | 1138 |
| 391 | Ga0207426_1025807 | 3300025302 | Bacteria | 1975 |
| 392 | Ga0207697_10009842 | 3300025315 | Bacteria | 4110 |
| 393 | Ga0207697_10010166 | 3300025315 | Bacteria | 4034 |
| 394 | Ga0207697_10016138 | 3300025315 | Unclassified | 3080 |
| 395 | Ga0207656_10059441 | 3300025321 | Unclassified | 1673 |
| 396 | Ga0207656_10090936 | 3300025321 | Bacteria | 1385 |
| 397 | Ga0207682_10000357 | 3300025893 | Bacteria | 20976 |
| 398 | Ga0207682_10001994 | 3300025893 | Bacteria | 9238 |
| 399 | Ga0207682_10002135 | 3300025893 | Bacteria | 8970 |
| 400 | Ga0207682_10003947 | 3300025893 | Bacteria | 6321 |
| 401 | Ga0207682_10005572 | 3300025893 | Bacteria | 5120 |
| 402 | Ga0207682_10005871 | 3300025893 | Bacteria | 4977 |
| 403 | Ga0207642_10013949 | 3300025899 | Bacteria | 2948 |
| 404 | Ga0207642_10017872 | 3300025899 | Bacteria | 2708 |
| 405 | Ga0207642_10034423 | 3300025899 | Bacteria | 2154 |
| 406 | Ga0207642_10059380 | 3300025899 | Bacteria | 1768 |
| 407 | Ga0207688_10007041 | 3300025901 | Bacteria | 6116 |
| 408 | Ga0207688_10011506 | 3300025901 | Bacteria | 4816 |
| 409 | Ga0207688_10091329 | 3300025901 | Bacteria | 1749 |
| 410 | Ga0207688_10236022 | 3300025901 | Bacteria | 1105 |
| 411 | Ga0207680_10003125 | 3300025903 | Bacteria | 7779 |
| 412 | Ga0207680_10039735 | 3300025903 | Bacteria | 2732 |
| 413 | Ga0207680_10230901 | 3300025903 | Bacteria | 1272 |
| 414 | Ga0207685_10118635 | 3300025905 | Bacteria | 1158 |
| 415 | Ga0207645_10003942 | 3300025907 | Bacteria | 11082 |
| 416 | Ga0207645_10004168 | 3300025907 | Bacteria | 10735 |
| 417 | Ga0207645_10006895 | 3300025907 | Bacteria | 8102 |
| 418 | Ga0207645_10007892 | 3300025907 | Bacteria | 7483 |
| 419 | Ga0207645_10030250 | 3300025907 | Bacteria | 3489 |
| 420 | Ga0207645_10048125 | 3300025907 | Bacteria | 2722 |
| 421 | Ga0207645_10118801 | 3300025907 | Bacteria | 1715 |
| 422 | Ga0207643_10005914 | 3300025908 | Bacteria | 6535 |
| 423 | Ga0207643_10010167 | 3300025908 | Bacteria | 5059 |
| 424 | Ga0207643_10048771 | 3300025908 | Bacteria | 2399 |
| 425 | Ga0207643_10057136 | 3300025908 | Bacteria | 2221 |
| 426 | Ga0207684_10020818 | 3300025910 | Bacteria | 5603 |
| 427 | Ga0207684_10064722 | 3300025910 | Bacteria | 3104 |
| 428 | Ga0207684_10122878 | 3300025910 | Bacteria | 2226 |
| 429 | Ga0207684_10223392 | 3300025910 | Bacteria | 1625 |
| 430 | Ga0207707_10019952 | 3300025912 | Bacteria | 5850 |
| 431 | Ga0207707_10033160 | 3300025912 | Bacteria | 4519 |
| 432 | Ga0207707_10072705 | 3300025912 | Bacteria | 2997 |
| 433 | Ga0207707_10088495 | 3300025912 | Unclassified | 2705 |
| 434 | Ga0207707_10120268 | 3300025912 | Bacteria | 2296 |
| 435 | Ga0207707_10121135 | 3300025912 | Bacteria | 2287 |
| 436 | Ga0207662_10002375 | 3300025918 | Bacteria | 9429 |
| 437 | Ga0207662_10025381 | 3300025918 | Bacteria | 3413 |
| 438 | Ga0207662_10069334 | 3300025918 | Bacteria | 2130 |
| 439 | Ga0207657_10127936 | 3300025919 | Unclassified | 2084 |
| 440 | Ga0207652_10069494 | 3300025921 | Bacteria | 3057 |
| 441 | Ga0207652_10353694 | 3300025921 | Bacteria | 1326 |
| 442 | Ga0207652_10362936 | 3300025921 | Bacteria | 1307 |
| 443 | Ga0207646_10106785 | 3300025922 | Bacteria | 2511 |
| 444 | Ga0207646_10215205 | 3300025922 | Bacteria | 1735 |
| 445 | Ga0207681_10040677 | 3300025923 | Bacteria | 3095 |
| 446 | Ga0207681_10435155 | 3300025923 | Bacteria | 1065 |
| 447 | Ga0207650_10001197 | 3300025925 | Bacteria | 19048 |
| 448 | Ga0207650_10003351 | 3300025925 | Bacteria | 11021 |
| 449 | Ga0207650_10004207 | 3300025925 | Bacteria | 9836 |
| 450 | Ga0207650_10043667 | 3300025925 | Bacteria | 3291 |
| 451 | Ga0207650_10117285 | 3300025925 | Bacteria | 2068 |
| 452 | Ga0207650_10283183 | 3300025925 | Unclassified | 1350 |
| 453 | Ga0207659_10000560 | 3300025926 | Bacteria | 22349 |
| 454 | Ga0207659_10010536 | 3300025926 | Bacteria | 5811 |
| 455 | Ga0207659_10013837 | 3300025926 | Bacteria | 5184 |
| 456 | Ga0207659_10018737 | 3300025926 | Bacteria | 4542 |
| 457 | Ga0207659_10134348 | 3300025926 | Bacteria | 1913 |
| 458 | Ga0207687_10060985 | 3300025927 | Bacteria | 2662 |
| 459 | Ga0207687_10165451 | 3300025927 | Unclassified | 1701 |
| 460 | Ga0207644_10000669 | 3300025931 | Bacteria | 21644 |
| 461 | Ga0207644_10003503 | 3300025931 | Bacteria | 10157 |
| 462 | Ga0207644_10018134 | 3300025931 | Bacteria | 4759 |
| 463 | Ga0207644_10090564 | 3300025931 | Bacteria | 2279 |
| 464 | Ga0207644_10322348 | 3300025931 | Unclassified | 1249 |
| 465 | Ga0207706_10012515 | 3300025933 | Bacteria | 7729 |
| 466 | Ga0207706_10040534 | 3300025933 | Bacteria | 4127 |
| 467 | Ga0207706_10204627 | 3300025933 | Unclassified | 1731 |
| 468 | Ga0207706_10403831 | 3300025933 | Bacteria | 1184 |
| 469 | Ga0207686_10018785 | 3300025934 | Bacteria | 3919 |
| 470 | Ga0207686_10035958 | 3300025934 | Bacteria | 2977 |
| 471 | Ga0207686_10062766 | 3300025934 | Bacteria | 2360 |
| 472 | Ga0207709_10156843 | 3300025935 | Unclassified | 1583 |
| 473 | Ga0207670_10005745 | 3300025936 | Bacteria | 6844 |
| 474 | Ga0207670_10079597 | 3300025936 | Unclassified | 2288 |
| 475 | Ga0207670_10173335 | 3300025936 | Bacteria | 1619 |
| 476 | Ga0207669_10037446 | 3300025937 | Unclassified | 2783 |
| 477 | Ga0207669_10045357 | 3300025937 | Bacteria | 2589 |
| 478 | Ga0207704_10018258 | 3300025938 | Bacteria | 3658 |
| 479 | Ga0207704_10021683 | 3300025938 | Bacteria | 3426 |
| 480 | Ga0207665_10003318 | 3300025939 | Bacteria | 10779 |
| 481 | Ga0207691_10000470 | 3300025940 | Bacteria | 39893 |
| 482 | Ga0207691_10001135 | 3300025940 | Bacteria | 26436 |
| 483 | Ga0207691_10003996 | 3300025940 | Bacteria | 14303 |
| 484 | Ga0207691_10014920 | 3300025940 | Bacteria | 7404 |
| 485 | Ga0207691_10109654 | 3300025940 | Bacteria | 2456 |
| 486 | Ga0207691_10148708 | 3300025940 | Bacteria | 2060 |
| 487 | Ga0207691_10244947 | 3300025940 | Bacteria | 1549 |
| 488 | Ga0207691_10256133 | 3300025940 | Unclassified | 1509 |
| 489 | Ga0207711_10220645 | 3300025941 | Unclassified | 1734 |
| 490 | Ga0207689_10006278 | 3300025942 | Bacteria | 10531 |
| 491 | Ga0207689_10016087 | 3300025942 | Bacteria | 6331 |
| 492 | Ga0207689_10022167 | 3300025942 | Bacteria | 5341 |
| 493 | Ga0207689_10034477 | 3300025942 | Bacteria | 4204 |
| 494 | Ga0207689_10063485 | 3300025942 | Bacteria | 3039 |
| 495 | Ga0207689_10104955 | 3300025942 | Bacteria | 2322 |
| 496 | Ga0207689_10108625 | 3300025942 | Bacteria | 2280 |
| 497 | Ga0207661_10002744 | 3300025944 | Bacteria | 12121 |
| 498 | Ga0207661_10004804 | 3300025944 | Bacteria | 9460 |
| 499 | Ga0207661_10100171 | 3300025944 | Bacteria | 2431 |
| 500 | Ga0207679_10015095 | 3300025945 | Bacteria | 5094 |
| 501 | Ga0207679_10140576 | 3300025945 | Bacteria | 1951 |
| 502 | Ga0207679_10310384 | 3300025945 | Bacteria | 1362 |
| 503 | Ga0207651_10005066 | 3300025960 | Bacteria | 6721 |
| 504 | Ga0207651_10023286 | 3300025960 | Bacteria | 3806 |
| 505 | Ga0207651_10029360 | 3300025960 | Bacteria | 3483 |
| 506 | Ga0207651_10099193 | 3300025960 | Bacteria | 2156 |
| 507 | Ga0207651_10150097 | 3300025960 | Bacteria | 1813 |
| 508 | Ga0207651_10163784 | 3300025960 | Unclassified | 1746 |
| 509 | Ga0207712_10081065 | 3300025961 | Bacteria | 2362 |
| 510 | Ga0207712_10100181 | 3300025961 | Bacteria | 2152 |
| 511 | Ga0207668_10239559 | 3300025972 | Bacteria | 1467 |
| 512 | Ga0207668_10318300 | 3300025972 | Bacteria | 1290 |
| 513 | Ga0207640_10006330 | 3300025981 | Bacteria | 6493 |
| 514 | Ga0207640_10014232 | 3300025981 | Unclassified | 4575 |
| 515 | Ga0207640_10030183 | 3300025981 | Bacteria | 3336 |
| 516 | Ga0207640_10126403 | 3300025981 | Bacteria | 1841 |
| 517 | Ga0207658_10014281 | 3300025986 | Bacteria | 5438 |
| 518 | Ga0207658_10031982 | 3300025986 | Bacteria | 3741 |
| 519 | Ga0207658_10101518 | 3300025986 | Bacteria | 2254 |
| 520 | Ga0207677_10001517 | 3300026023 | Bacteria | 12270 |
| 521 | Ga0207677_10008476 | 3300026023 | Bacteria | 5747 |
| 522 | Ga0207677_10155305 | 3300026023 | Bacteria | 1771 |
| 523 | Ga0207677_10234361 | 3300026023 | Bacteria | 1481 |
| 524 | Ga0207677_10290309 | 3300026023 | Bacteria | 1347 |
| 525 | Ga0207703_10128534 | 3300026035 | Bacteria | 2185 |
| 526 | Ga0207703_10161203 | 3300026035 | Bacteria | 1964 |
| 527 | Ga0207703_10191819 | 3300026035 | Bacteria | 1810 |
| 528 | Ga0207703_10217135 | 3300026035 | Bacteria | 1708 |
| 529 | Ga0207639_10067006 | 3300026041 | Bacteria | 2793 |
| 530 | Ga0207708_10014517 | 3300026075 | Bacteria | 5895 |
| 531 | Ga0207708_10015469 | 3300026075 | Bacteria | 5722 |
| 532 | Ga0207708_10032394 | 3300026075 | Bacteria | 3970 |
| 533 | Ga0207708_10068726 | 3300026075 | Unclassified | 2711 |
| 534 | Ga0207708_10088231 | 3300026075 | Bacteria | 2389 |
| 535 | Ga0207708_10103459 | 3300026075 | Bacteria | 2206 |
| 536 | Ga0207708_10336285 | 3300026075 | Bacteria | 1235 |
| 537 | Ga0207641_10036559 | 3300026088 | Unclassified | 4100 |
| 538 | Ga0207641_10037194 | 3300026088 | Bacteria | 4064 |
| 539 | Ga0207641_10077131 | 3300026088 | Unclassified | 2883 |
| 540 | Ga0207648_10000663 | 3300026089 | Bacteria | 38545 |
| 541 | Ga0207648_10003622 | 3300026089 | Bacteria | 16152 |
| 542 | Ga0207648_10012278 | 3300026089 | Bacteria | 8020 |
| 543 | Ga0207648_10019268 | 3300026089 | Bacteria | 6159 |
| 544 | Ga0207648_10029616 | 3300026089 | Unclassified | 4854 |
| 545 | Ga0207648_10051455 | 3300026089 | Bacteria | 3600 |
| 546 | Ga0207648_10057495 | 3300026089 | Unclassified | 3393 |
| 547 | Ga0207648_10081090 | 3300026089 | Bacteria | 2830 |
| 548 | Ga0207676_10001530 | 3300026095 | Bacteria | 17068 |
| 549 | Ga0207676_10001708 | 3300026095 | Bacteria | 16184 |
| 550 | Ga0207676_10007149 | 3300026095 | Bacteria | 7906 |
| 551 | Ga0207676_10009887 | 3300026095 | Bacteria | 6787 |
| 552 | Ga0207676_10010953 | 3300026095 | Bacteria | 6473 |
| 553 | Ga0207676_10027081 | 3300026095 | Bacteria | 4266 |
| 554 | Ga0207676_10056986 | 3300026095 | Unclassified | 3075 |
| 555 | Ga0207676_10068165 | 3300026095 | Bacteria | 2845 |
| 556 | Ga0207676_10077278 | 3300026095 | Bacteria | 2692 |
| 557 | Ga0207674_10029837 | 3300026116 | Bacteria | 5738 |
| 558 | Ga0207674_10256706 | 3300026116 | Bacteria | 1695 |
| 559 | Ga0207674_10498384 | 3300026116 | Bacteria | 1177 |
| 560 | Ga0207675_100008190 | 3300026118 | Bacteria | 9848 |
| 561 | Ga0207675_100012673 | 3300026118 | Bacteria | 7879 |
| 562 | Ga0207675_100034340 | 3300026118 | Bacteria | 4728 |
| 563 | Ga0207675_100079449 | 3300026118 | Bacteria | 3074 |
| 564 | Ga0207675_100234074 | 3300026118 | Bacteria | 1773 |
| 565 | Ga0207675_100390126 | 3300026118 | Bacteria | 1370 |
| 566 | Ga0207675_100503378 | 3300026118 | Bacteria | 1206 |
| 567 | Ga0207683_10000394 | 3300026121 | Bacteria | 40159 |
| 568 | Ga0207683_10000419 | 3300026121 | Bacteria | 39170 |
| 569 | Ga0207683_10000581 | 3300026121 | Bacteria | 33773 |
| 570 | Ga0207683_10000838 | 3300026121 | Bacteria | 28142 |
| 571 | Ga0207683_10001935 | 3300026121 | Bacteria | 18332 |
| 572 | Ga0207683_10002874 | 3300026121 | Bacteria | 15015 |
| 573 | Ga0207683_10006786 | 3300026121 | Bacteria | 9801 |
| 574 | Ga0207683_10009959 | 3300026121 | Bacteria | 8108 |
| 575 | Ga0207683_10032720 | 3300026121 | Bacteria | 4517 |
| 576 | Ga0207683_10210851 | 3300026121 | Unclassified | 1768 |
| 577 | Ga0207683_10319053 | 3300026121 | Bacteria | 1423 |
| 578 | Ga0207698_10103902 | 3300026142 | Unclassified | 2362 |
| 579 | Ga0209969_1001471 | 3300027360 | Bacteria | 3252 |
| 580 | Ga0209969_1003060 | 3300027360 | Bacteria | 2312 |
| 581 | Ga0209967_1000706 | 3300027364 | Bacteria | 4306 |
| 582 | Ga0209967_1015138 | 3300027364 | Bacteria | 1103 |
| 583 | Ga0210000_1000438 | 3300027462 | Bacteria | 5727 |
| 584 | Ga0210000_1000480 | 3300027462 | Bacteria | 5464 |
| 585 | Ga0209995_1000757 | 3300027471 | Bacteria | 4966 |
| 586 | Ga0209995_1002576 | 3300027471 | Bacteria | 2868 |
| 587 | Ga0209995_1005811 | 3300027471 | Bacteria | 1984 |
| 588 | Ga0209968_1005253 | 3300027526 | Bacteria | 1946 |
| 589 | Ga0209999_1007031 | 3300027543 | Bacteria | 2023 |
| 590 | Ga0209983_1028771 | 3300027665 | Bacteria | 1180 |
| 591 | Ga0209971_1016569 | 3300027682 | Bacteria | 1747 |
| 592 | Ga0209971_1020908 | 3300027682 | Bacteria | 1556 |
| 593 | Ga0209974_10009049 | 3300027876 | Bacteria | 3386 |
| 594 | Ga0209974_10022144 | 3300027876 | Bacteria | 2104 |
| 595 | Ga0207428_10004110 | 3300027907 | Bacteria | 13948 |
| 596 | Ga0207428_10005229 | 3300027907 | Bacteria | 12133 |
| 597 | Ga0207428_10008952 | 3300027907 | Bacteria | 9016 |
| 598 | Ga0207428_10028036 | 3300027907 | Bacteria | 4681 |
| 599 | Ga0207428_10031371 | 3300027907 | Bacteria | 4385 |
| 600 | Ga0207428_10044623 | 3300027907 | Bacteria | 3576 |
| 601 | Ga0268266_10095906 | 3300028379 | Bacteria | 2605 |
| 602 | Ga0268266_10132873 | 3300028379 | Bacteria | 2227 |
| 603 | Ga0268266_10168755 | 3300028379 | Bacteria | 1985 |
| 604 | Ga0268265_10094234 | 3300028380 | Bacteria | 2401 |
| 605 | Ga0268265_10202796 | 3300028380 | Bacteria | 1722 |
| 606 | Ga0268264_10032681 | 3300028381 | Unclassified | 4270 |
| 607 | Ga0268264_10176359 | 3300028381 | Bacteria | 1937 |
| 608 | Ga0268264_10221327 | 3300028381 | Bacteria | 1742 |
| 609 | Ga0265318_10011303 | 3300028577 | Bacteria | 3848 |
| 610 | Ga0265318_10041206 | 3300028577 | Bacteria | 1756 |
| 611 | Ga0265330_10040994 | 3300031235 | Bacteria | 2054 |
| 612 | Ga0265332_10001271 | 3300031238 | Bacteria | 14439 |
| 613 | Ga0265332_10001357 | 3300031238 | Bacteria | 13884 |
| 614 | Ga0265332_10040462 | 3300031238 | Bacteria | 2018 |
| 615 | Ga0265328_10011152 | 3300031239 | Bacteria | 3598 |
| 616 | Ga0265328_10013797 | 3300031239 | Bacteria | 3191 |
| 617 | Ga0265320_10014112 | 3300031240 | Bacteria | 4567 |
| 618 | Ga0265320_10031292 | 3300031240 | Bacteria | 2734 |
| 619 | Ga0265331_10001190 | 3300031250 | Bacteria | 19692 |
| 620 | Ga0265331_10001292 | 3300031250 | Bacteria | 18634 |
| 621 | Ga0265331_10019878 | 3300031250 | Bacteria | 3458 |
| 622 | Ga0265327_10031784 | 3300031251 | Bacteria | 2962 |
| 623 | Ga0307408_100070885 | 3300031548 | Bacteria | 2575 |
| 624 | Ga0265314_10005591 | 3300031711 | Bacteria | 11295 |
| 625 | Ga0265314_10019279 | 3300031711 | Bacteria | 5287 |
| 626 | Ga0265342_10023351 | 3300031712 | Bacteria | 3916 |
| 627 | Ga0307405_10048627 | 3300031731 | Bacteria | 2617 |
| 628 | Ga0307407_10095996 | 3300031903 | Bacteria | 1829 |
| 629 | Ga0307407_10186751 | 3300031903 | Bacteria | 1378 |
| 630 | Ga0307409_100255775 | 3300031995 | Bacteria | 1604 |
| 631 | Ga0307411_10069604 | 3300032005 | Bacteria | 2377 |
| 632 | Ga0307411_10343262 | 3300032005 | Bacteria | 1214 |
| 633 | Ga0307415_100091150 | 3300032126 | Unclassified | 2207 |
| 634 | Ga0307415_100195180 | 3300032126 | Bacteria | 1601 |
| 635 | Ga0373948_0026202 | 3300034817 | Bacteria | 1148 |
| 636 | Ga0373926_0000756 | 3300035083 | Bacteria | 9030 |
| 637 | Ga0373934_0002091 | 3300035086 | Bacteria | 7321 |
| 638 | Ga0373940_0098795 | 3300035088 | Bacteria | 884 |
| 639 | Ga0373944_0006381 | 3300035089 | Bacteria | 3130 |
| 640 | Ga0373951_0029130 | 3300035091 | Bacteria | 1296 |
| 641 | Ga0373952_0043051 | 3300035092 | Bacteria | 1051 |
| 642 | Ga0373936_0004203 | 3300035113 | Bacteria | 5428 |
| 643 | Ga0373956_0004147 | 3300035119 | Bacteria | 5815 |
| 644 | Ga0373955_0012701 | 3300035172 | Bacteria | 4055 |
| 645 | Ga0373931_0136655 | 3300035691 | Bacteria | 1416 |
| 646 | Ga0373931_0204148 | 3300035691 | Bacteria | 1182 |
| 647 | Ga0373931_0220396 | 3300035691 | Bacteria | 1142 |
| 648 | Ga0373935_0001314 | 3300035692 | Bacteria | 13745 |
| 649 | Ga0373935_0318566 | 3300035692 | Bacteria | 1103 |
| 650 | Ga0373927_0049563 | 3300035695 | Bacteria | 2715 |
| 651 | Ga0373933_0028194 | 3300035724 | Bacteria | 3238 |
| 652 | Ga0373947_0029423 | 3300035725 | Bacteria | 3223 |
| 653 | Ga0373937_0019176 | 3300036401 | Bacteria | 6122 |
| 654 | Ga0373925_0007447 | 3300037068 | Bacteria | 7986 |
| 655 | Ga0395899_0160266 | 3300037312 | Unclassified | 1590 |
| 656 | Ga0395898_0043767 | 3300037466 | Bacteria | 4411 |
| 657 | Ga0395901_0153886 | 3300038443 | Bacteria | 2415 |
| 658 | Ga0436360_0004950 | 3300039438 | Bacteria | 1080 |
| 659 | Ga0439465_0055117 | 3300041413 | Bacteria | 1309 |
| 660 | Ga0439441_014203 | 3300042001 | Bacteria | 1392 |
| 661 | Ga0450911_008045 | 3300042115 | Bacteria | 1512 |
| 662 | Ga0439435_0014487 | 3300042436 | Bacteria | 1949 |
| 663 | Ga0450916_011267 | 3300042530 | Bacteria | 1128 |
| 664 | Ga0451577_0226919 | 3300042876 | Bacteria | 1689 |
| 665 | Ga0451577_0760300 | 3300042876 | Unclassified | 876 |
| 666 | Ga0466957_0040678 | 3300044842 | Bacteria | 2809 |
| 667 | Ga0451576_0011227 | 3300045051 | Bacteria | 10203 |
| 668 | Ga0451576_0026777 | 3300045051 | Bacteria | 6197 |
| 669 | Ga0451576_0127667 | 3300045051 | Unclassified | 2650 |
| 670 | Ga0451576_0162512 | 3300045051 | Bacteria | 2331 |
| 671 | Ga0466958_0199976 | 3300045836 | Bacteria | 1272 |
| 672 | Ga0495592_0121257 | 3300046454 | Bacteria | 1839 |
| 673 | Ga0495603_0004289 | 3300046455 | Bacteria | 8499 |
| 674 | Ga0495603_0208850 | 3300046455 | Bacteria | 1128 |
| 675 | Ga0495582_0015951 | 3300046473 | Bacteria | 4119 |
| 676 | Ga0495639_0011222 | 3300046475 | Bacteria | 3860 |
| 677 | Ga0495663_0043214 | 3300046525 | Unclassified | 1376 |
| 678 | Ga0495642_0013141 | 3300046528 | Bacteria | 3199 |
| 679 | Ga0495642_0110305 | 3300046528 | Unclassified | 1176 |
| 680 | Ga0495665_0010642 | 3300046531 | Bacteria | 4983 |
| 681 | Ga0495586_0025846 | 3300046535 | Bacteria | 3141 |
| 682 | Ga0495598_0014722 | 3300046537 | Bacteria | 1960 |
| 683 | Ga0495621_0017879 | 3300046539 | Bacteria | 2297 |
| 684 | Ga0495659_0039725 | 3300046664 | Bacteria | 1674 |
| 685 | Ga0495588_0038166 | 3300046674 | Bacteria | 2443 |
| 686 | Ga0495599_0208122 | 3300046678 | Bacteria | 1200 |
| 687 | Ga0495647_0005067 | 3300046681 | Bacteria | 4314 |
| 688 | Ga0495658_0045769 | 3300046683 | Bacteria | 2457 |
| 689 | Ga0495658_0084336 | 3300046683 | Bacteria | 1870 |
| 690 | Ga0495658_0212791 | 3300046683 | Bacteria | 1208 |
| 691 | Ga0495669_0012847 | 3300046684 | Bacteria | 3565 |
| 692 | Ga0495669_0018200 | 3300046684 | Bacteria | 3019 |
| 693 | Ga0495669_0038755 | 3300046684 | Unclassified | 2111 |
| 694 | Ga0495669_0040535 | 3300046684 | Bacteria | 2066 |
| 695 | Ga0495636_0051064 | 3300047318 | Bacteria | 1733 |
| 696 | Ga0495636_0058925 | 3300047318 | Bacteria | 1620 |
| 697 | Ga0495676_0106934 | 3300047321 | Bacteria | 2060 |
| 698 | Ga0495684_0345303 | 3300047471 | Bacteria | 1058 |
| 699 | Ga0495614_0110808 | 3300048089 | Bacteria | 1205 |
| 700 | Ga0496101_0014428 | 3300048904 | Bacteria | 5311 |
| 701 | Ga0496101_0053523 | 3300048904 | Bacteria | 2913 |
| 702 | Ga0496102_0264037 | 3300048905 | Bacteria | 1623 |
| 703 | Ga0496102_0640270 | 3300048905 | Bacteria | 986 |
| 704 | Ga0496104_0161421 | 3300048907 | Bacteria | 2150 |
| 705 | Ga0496104_0216286 | 3300048907 | Unclassified | 1828 |
| 706 | Ga0496106_0158479 | 3300048909 | Bacteria | 1789 |
| 707 | Ga0496108_0016448 | 3300048911 | Bacteria | 6034 |
| 708 | Ga0496108_0026594 | 3300048911 | Bacteria | 4773 |
| 709 | Ga0496108_0069581 | 3300048911 | Unclassified | 2970 |
| 710 | Ga0496108_0279729 | 3300048911 | Bacteria | 1453 |
| 711 | Ga0496109_0071934 | 3300048912 | Bacteria | 3176 |
| 712 | Ga0496109_0079918 | 3300048912 | Bacteria | 3013 |
| 713 | Ga0496109_0233233 | 3300048912 | Bacteria | 1732 |
| 714 | Ga0496110_0002686 | 3300048913 | Bacteria | 13433 |
| 715 | Ga0496110_0012852 | 3300048913 | Bacteria | 6899 |
| 716 | Ga0496110_0022962 | 3300048913 | Bacteria | 5302 |
| 717 | Ga0496110_0077301 | 3300048913 | Bacteria | 2961 |
| 718 | Ga0496111_0015962 | 3300048914 | Bacteria | 5167 |
| 719 | Ga0496114_0106406 | 3300048917 | Bacteria | 2400 |
| 720 | Ga0496121_0003189 | 3300048924 | Bacteria | 23644 |
| 721 | Ga0496125_0023065 | 3300048928 | Bacteria | 5758 |
| 722 | Ga0496126_0261173 | 3300048929 | Bacteria | 1440 |
| 723 | Ga0501034_0000757 | 3300049571 | Bacteria | 48585 |
| 724 | Ga0501034_0366251 | 3300049571 | Bacteria | 1368 |
| 725 | Ga0501036_0023503 | 3300049572 | Bacteria | 5193 |
| 726 | Ga0501037_0102615 | 3300049573 | Bacteria | 2063 |
| 727 | Ga0501039_0012598 | 3300049575 | Bacteria | 6462 |
| 728 | Ga0501039_0047730 | 3300049575 | Bacteria | 3310 |
| 729 | Ga0501042_0032146 | 3300049578 | Bacteria | 3715 |
| 730 | Ga0501043_0025169 | 3300049579 | Bacteria | 4669 |
| 731 | Ga0501048_0081578 | 3300049582 | Bacteria | 2282 |
| 732 | Ga0501048_0125939 | 3300049582 | Bacteria | 1811 |
| 733 | Ga0501068_0027764 | 3300049584 | Bacteria | 3344 |
| 734 | Ga0501068_0111011 | 3300049584 | Bacteria | 1705 |
| 735 | Ga0501069_0014446 | 3300049585 | Bacteria | 4224 |
| 736 | Ga0501070_0036662 | 3300049586 | Bacteria | 4095 |
| 737 | Ga0501071_0011568 | 3300049587 | Bacteria | 5954 |
| 738 | Ga0501071_0021374 | 3300049587 | Bacteria | 4505 |
| 739 | Ga0501074_0063465 | 3300049590 | Bacteria | 2661 |
| 740 | Ga0501075_0008008 | 3300049591 | Bacteria | 7343 |
| 741 | Ga0501076_0004738 | 3300049592 | Bacteria | 9706 |
| 742 | Ga0501076_0341904 | 3300049592 | Bacteria | 1228 |
| 743 | Ga0501080_0003555 | 3300049742 | Bacteria | 13722 |
| 744 | Ga0501081_0004989 | 3300049743 | Bacteria | 8544 |
| 745 | Ga0501081_0013808 | 3300049743 | Bacteria | 5315 |
| 746 | Ga0501083_0100134 | 3300049744 | Bacteria | 1911 |
| 747 | Ga0501044_0058415 | 3300049823 | Bacteria | 3956 |
| 748 | Ga0501045_0012534 | 3300049824 | Bacteria | 5971 |
| 749 | Ga0501045_0108351 | 3300049824 | Bacteria | 2059 |
| 750 | Ga0501045_0140929 | 3300049824 | Bacteria | 1793 |
| 751 | nmdc:mga03683_52895_c1 | 3300050489 | Bacteria | 1698 |
| 752 | nmdc:mga0yw44_137659_c1 | 3300050492 | Bacteria | 1585 |
| 753 | nmdc:mga06z11_4551_c1 | 3300050494 | Bacteria | 5463 |
| 754 | nmdc:mga06z11_52052_c1 | 3300050494 | Bacteria | 2099 |
| 755 | nmdc:mga07m45_2091_c2 | 3300050496 | Bacteria | 8751 |
| 756 | nmdc:mga05p37_116824_c1 | 3300050507 | Bacteria | 3279 |
| 757 | nmdc:mga05p37_365445_c1 | 3300050507 | Bacteria | 1695 |
| 758 | nmdc:mga05p37_720265_c1 | 3300050507 | Bacteria | 1105 |
| 759 | nmdc:mga05p37_96388_c1 | 3300050507 | Bacteria | 2951 |
| 760 | nmdc:mga09592_10327_c1 | 3300050508 | Bacteria | 7596 |
| 761 | nmdc:mga09592_16139_c1 | 3300050508 | Bacteria | 6104 |
| 762 | nmdc:mga09592_21940_c1 | 3300050508 | Bacteria | 5266 |
| 763 | nmdc:mga09592_221083_c1 | 3300050508 | Bacteria | 1641 |
| 764 | nmdc:mga09592_23470_c1 | 3300050508 | Bacteria | 5095 |
| 765 | nmdc:mga09592_40461_c1 | 3300050508 | Bacteria | 3916 |
| 766 | nmdc:mga09592_81116_c1 | 3300050508 | Bacteria | 2764 |
| 767 | nmdc:mga0qj67_173175_c1 | 3300050509 | Bacteria | 1753 |
| 768 | nmdc:mga0qj67_237557_c1 | 3300050509 | Bacteria | 1478 |
| 769 | nmdc:mga0qj67_324463_c1 | 3300050509 | Bacteria | 1246 |
| 770 | nmdc:mga0qj67_38194_c1 | 3300050509 | Bacteria | 3766 |
| 771 | nmdc:mga0qj67_53926_c1 | 3300050509 | Bacteria | 3183 |
| 772 | nmdc:mga0qj67_78345_c1 | 3300050509 | Bacteria | 2645 |
| 773 | nmdc:mga06r32_11524_c1 | 3300050510 | Bacteria | 7965 |
| 774 | nmdc:mga06r32_2431_c1 | 3300050510 | Bacteria | 16666 |
| 775 | nmdc:mga06r32_77532_c1 | 3300050510 | Bacteria | 3229 |
| 776 | nmdc:mga08y16_14449_c1 | 3300050511 | Bacteria | 8305 |
| 777 | nmdc:mga08y16_1491_c1 | 3300050511 | Bacteria | 23546 |
| 778 | nmdc:mga08y16_224691_c1 | 3300050511 | Bacteria | 1943 |
| 779 | nmdc:mga08y16_23154_c1 | 3300050511 | Bacteria | 6558 |
| 780 | nmdc:mga08y16_2516_c1 | 3300050511 | Bacteria | 18835 |
| 781 | nmdc:mga08y16_274053_c1 | 3300050511 | Unclassified | 1741 |
| 782 | nmdc:mga08y16_324312_c1 | 3300050511 | Bacteria | 1585 |
| 783 | nmdc:mga08y16_37579_c1 | 3300050511 | Bacteria | 5084 |
| 784 | nmdc:mga08y16_72372_c1 | 3300050511 | Bacteria | 3592 |
| 785 | nmdc:mga0n895_308466_c1 | 3300050512 | Bacteria | 1604 |
| 786 | nmdc:mga0rr50_123286_c1 | 3300050513 | Bacteria | 2066 |
| 787 | nmdc:mga0rr50_173907_c1 | 3300050513 | Bacteria | 1756 |
| 788 | nmdc:mga08x19_123972_c1 | 3300050514 | Bacteria | 1734 |
| 789 | nmdc:mga08x19_35077_c1 | 3300050514 | Bacteria | 3173 |
| 790 | nmdc:mga0a205_239165_c1 | 3300050515 | Bacteria | 1697 |
| 791 | nmdc:mga0a205_278289_c1 | 3300050515 | Bacteria | 1549 |
| 792 | nmdc:mga0sz30_629_c1 | 3300050516 | Bacteria | 13076 |
| 793 | Ga0500651_0201372 | 3300053093 | Bacteria | 1174 |
| 794 | Ga0500641_0002167 | 3300053096 | Bacteria | 6960 |
| 795 | Ga0500616_0001277 | 3300053153 | Bacteria | 25156 |
| 796 | Ga0500552_000068 | 3300053733 | Bacteria | 8540 |
| 797 | Ga0501082_0000529 | 3300060353 | Bacteria | 33995 |
| 798 | Ga0501082_0097640 | 3300060353 | Bacteria | 2540 |
| 799 | Ga0501082_0366927 | 3300060353 | Bacteria | 1256 |
| 800 | Ga0530510_0061007 | 3300061734 | Bacteria | 2730 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035088 | Ga0373940_0098795 | Ga0373940_0098795_40_846 | 252 |
| 2 | 3300048905 | Ga0496102_0640270 | Ga0496102_0640270_13_855 | 252 |
| 3 | 3300005338 | Ga0068868_100036427 | Ga0068868_1000364274 | 255 |
| 4 | 3300005353 | Ga0070669_100016792 | Ga0070669_1000167923 | 255 |
| 5 | 3300005354 | Ga0070675_100005907 | Ga0070675_1000059075 | 255 |
| 6 | 3300005355 | Ga0070671_100012134 | Ga0070671_1000121344 | 255 |
| 7 | 3300005356 | Ga0070674_100017437 | Ga0070674_1000174372 | 255 |
| 8 | 3300005367 | Ga0070667_100067791 | Ga0070667_1000677913 | 255 |
| 9 | 3300005456 | Ga0070678_100000701 | Ga0070678_10000070110 | 255 |
| 10 | 3300005539 | Ga0068853_100093077 | Ga0068853_1000930772 | 255 |
| 11 | 3300006358 | Ga0068871_100010723 | Ga0068871_1000107232 | 255 |
| 12 | 3300006881 | Ga0068865_100071529 | Ga0068865_1000715293 | 255 |
| 13 | 3300013306 | Ga0163162_10047449 | Ga0163162_100474493 | 255 |
| 14 | 3300013308 | Ga0157375_10143108 | Ga0157375_101431083 | 255 |
| 15 | 3300025903 | Ga0207680_10230901 | Ga0207680_102309011 | 255 |
| 16 | 3300025923 | Ga0207681_10040677 | Ga0207681_100406772 | 255 |
| 17 | 3300025986 | Ga0207658_10101518 | Ga0207658_101015181 | 255 |
| 18 | 3300026023 | Ga0207677_10234361 | Ga0207677_102343612 | 255 |
| 19 | 3300026041 | Ga0207639_10067006 | Ga0207639_100670063 | 255 |
| 20 | 3300026121 | Ga0207683_10006786 | Ga0207683_100067868 | 255 |
| 21 | 3300005364 | Ga0070673_100010295 | Ga0070673_1000102955 | 256 |
| 22 | 3300005564 | Ga0070664_100189974 | Ga0070664_1001899742 | 256 |
| 23 | 3300025960 | Ga0207651_10023286 | Ga0207651_100232863 | 256 |
| 24 | 3300025933 | Ga0207706_10403831 | Ga0207706_104038311 | 269 |
| 25 | 3300046455 | Ga0495603_0208850 | Ga0495603_0208850_280_1110 | 276 |
| 26 | 3300050509 | nmdc:mga0qj67_237557_c1 | nmdc:mga0qj67_237557_c1_174_1004 | 276 |
| 27 | 3300042876 | Ga0451577_0760300 | Ga0451577_0760300_29_865 | 277 |
| 28 | 3300005719 | Ga0068861_100186214 | Ga0068861_1001862142 | 280 |
| 29 | 3300009148 | Ga0105243_10431390 | Ga0105243_104313901 | 280 |
| 30 | 3300025918 | Ga0207662_10069334 | Ga0207662_100693343 | 281 |
| 31 | 3300045051 | Ga0451576_0011227 | Ga0451576_0011227_5748_6686 | 281 |
| 32 | 3300006852 | Ga0075433_10107914 | Ga0075433_101079143 | 282 |
| 33 | 3300007076 | Ga0075435_100006662 | Ga0075435_1000066629 | 282 |
| 34 | 3300050515 | nmdc:mga0a205_278289_c1 | nmdc:mga0a205_278289_c1_337_1281 | 282 |
| 35 | 3300035091 | Ga0373951_0029130 | Ga0373951_0029130_317_1267 | 283 |
| 36 | 3300005718 | Ga0068866_10028078 | Ga0068866_100280783 | 284 |
| 37 | 3300028381 | Ga0268264_10221327 | Ga0268264_102213272 | 285 |
| 38 | 3300034817 | Ga0373948_0026202 | Ga0373948_0026202_12_947 | 285 |
| 39 | 3300035092 | Ga0373952_0043051 | Ga0373952_0043051_97_1032 | 285 |
| 40 | 3300050507 | nmdc:mga05p37_116824_c1 | nmdc:mga05p37_116824_c1_285_1196 | 285 |
| 41 | 3300060353 | Ga0501082_0097640 | Ga0501082_0097640_1438_2406 | 285 |
| 42 | 3300006847 | Ga0075431_100007754 | Ga0075431_10000775410 | 286 |
| 43 | 3300009551 | Ga0105238_10117235 | Ga0105238_101172351 | 286 |
| 44 | 3300013296 | Ga0157374_10020612 | Ga0157374_100206126 | 286 |
| 45 | 3300013297 | Ga0157378_10011956 | Ga0157378_100119566 | 286 |
| 46 | 3300013306 | Ga0163162_10015389 | Ga0163162_100153894 | 286 |
| 47 | 3300013308 | Ga0157375_10002228 | Ga0157375_100022283 | 286 |
| 48 | 3300014969 | Ga0157376_10006789 | Ga0157376_100067893 | 286 |
| 49 | 3300048911 | Ga0496108_0016448 | Ga0496108_0016448_3904_4764 | 286 |
| 50 | 3300048912 | Ga0496109_0071934 | Ga0496109_0071934_608_1468 | 286 |
| 51 | 3300048913 | Ga0496110_0012852 | Ga0496110_0012852_389_1249 | 286 |
| 52 | 3300050509 | nmdc:mga0qj67_173175_c1 | nmdc:mga0qj67_173175_c1_846_1706 | 286 |
| 53 | 3300050510 | nmdc:mga06r32_11524_c1 | nmdc:mga06r32_11524_c1_3764_4624 | 286 |
| 54 | 3300005328 | Ga0070676_10055984 | Ga0070676_100559842 | 287 |
| 55 | 3300005335 | Ga0070666_10017090 | Ga0070666_100170904 | 287 |
| 56 | 3300005356 | Ga0070674_100081161 | Ga0070674_1000811612 | 287 |
| 57 | 3300005367 | Ga0070667_100001848 | Ga0070667_1000018485 | 287 |
| 58 | 3300005456 | Ga0070678_100003716 | Ga0070678_1000037166 | 287 |
| 59 | 3300005459 | Ga0068867_100009787 | Ga0068867_1000097873 | 287 |
| 60 | 3300005543 | Ga0070672_100031926 | Ga0070672_1000319264 | 287 |
| 61 | 3300005548 | Ga0070665_100002513 | Ga0070665_1000025134 | 287 |
| 62 | 3300009094 | Ga0111539_10061458 | Ga0111539_100614584 | 287 |
| 63 | 3300009147 | Ga0114129_10019617 | Ga0114129_100196177 | 287 |
| 64 | 3300025903 | Ga0207680_10039735 | Ga0207680_100397353 | 287 |
| 65 | 3300025907 | Ga0207645_10118801 | Ga0207645_101188012 | 287 |
| 66 | 3300025921 | Ga0207652_10353694 | Ga0207652_103536942 | 287 |
| 67 | 3300025940 | Ga0207691_10003996 | Ga0207691_1000399611 | 287 |
| 68 | 3300026121 | Ga0207683_10001935 | Ga0207683_1000193511 | 287 |
| 69 | 3300028379 | Ga0268266_10095906 | Ga0268266_100959063 | 287 |
| 70 | 3300045051 | Ga0451576_0026777 | Ga0451576_0026777_38_985 | 287 |
| 71 | 3300050508 | nmdc:mga09592_221083_c1 | nmdc:mga09592_221083_c1_555_1418 | 287 |
| 72 | 3300050511 | nmdc:mga08y16_37579_c1 | nmdc:mga08y16_37579_c1_3018_3881 | 287 |
| 73 | 3300050513 | nmdc:mga0rr50_123286_c1 | nmdc:mga0rr50_123286_c1_15_962 | 287 |
| 74 | 3300050509 | nmdc:mga0qj67_324463_c1 | nmdc:mga0qj67_324463_c1_190_1056 | 288 |
| 75 | 3300005549 | Ga0070704_100059510 | Ga0070704_1000595101 | 289 |
| 76 | 3300042436 | Ga0439435_0014487 | Ga0439435_0014487_599_1564 | 289 |
| 77 | 3300032126 | Ga0307415_100091150 | Ga0307415_1000911503 | 290 |
| 78 | 3300032126 | Ga0307415_100195180 | Ga0307415_1001951802 | 290 |
| 79 | 3300050515 | nmdc:mga0a205_239165_c1 | nmdc:mga0a205_239165_c1_625_1557 | 291 |
| 80 | 3300005334 | Ga0068869_100173131 | Ga0068869_1001731312 | 292 |
| 81 | 3300005459 | Ga0068867_100279118 | Ga0068867_1002791181 | 292 |
| 82 | 3300025942 | Ga0207689_10022167 | Ga0207689_100221671 | 292 |
| 83 | 3300046539 | Ga0495621_0017879 | Ga0495621_0017879_471_1352 | 292 |
| 84 | 3300046683 | Ga0495658_0045769 | Ga0495658_0045769_1157_2038 | 292 |
| 85 | 3300046684 | Ga0495669_0040535 | Ga0495669_0040535_865_1746 | 292 |
| 86 | 3300048907 | Ga0496104_0161421 | Ga0496104_0161421_33_911 | 292 |
| 87 | 3300048913 | Ga0496110_0077301 | Ga0496110_0077301_67_1035 | 292 |
| 88 | 3300009094 | Ga0111539_10045031 | Ga0111539_100450316 | 293 |
| 89 | 3300042001 | Ga0439441_014203 | Ga0439441_014203_139_1104 | 293 |
| 90 | 3300049572 | Ga0501036_0023503 | Ga0501036_0023503_107_1111 | 293 |
| 91 | 3300049573 | Ga0501037_0102615 | Ga0501037_0102615_537_1541 | 293 |
| 92 | 3300049575 | Ga0501039_0012598 | Ga0501039_0012598_5435_6439 | 293 |
| 93 | 3300049578 | Ga0501042_0032146 | Ga0501042_0032146_504_1508 | 293 |
| 94 | 3300049579 | Ga0501043_0025169 | Ga0501043_0025169_56_1060 | 293 |
| 95 | 3300049582 | Ga0501048_0125939 | Ga0501048_0125939_335_1339 | 293 |
| 96 | 3300049584 | Ga0501068_0027764 | Ga0501068_0027764_361_1365 | 293 |
| 97 | 3300049585 | Ga0501069_0014446 | Ga0501069_0014446_2207_3148 | 293 |
| 98 | 3300049587 | Ga0501071_0011568 | Ga0501071_0011568_4164_5168 | 293 |
| 99 | 3300049591 | Ga0501075_0008008 | Ga0501075_0008008_3933_4937 | 293 |
| 100 | 3300049592 | Ga0501076_0004738 | Ga0501076_0004738_2161_3165 | 293 |
| 101 | 3300049742 | Ga0501080_0003555 | Ga0501080_0003555_2439_3443 | 293 |
| 102 | 3300049743 | Ga0501081_0004989 | Ga0501081_0004989_1569_2573 | 293 |
| 103 | 3300049744 | Ga0501083_0100134 | Ga0501083_0100134_556_1560 | 293 |
| 104 | 3300049824 | Ga0501045_0012534 | Ga0501045_0012534_250_1254 | 293 |
| 105 | 3300060353 | Ga0501082_0000529 | Ga0501082_0000529_2000_3004 | 293 |
| 106 | 3300050507 | nmdc:mga05p37_720265_c1 | nmdc:mga05p37_720265_c1_35_919 | 294 |
| 107 | 3300005536 | Ga0070697_100043501 | Ga0070697_1000435012 | 295 |
| 108 | 3300005545 | Ga0070695_100008105 | Ga0070695_1000081053 | 295 |
| 109 | 3300005546 | Ga0070696_100025217 | Ga0070696_1000252174 | 295 |
| 110 | 3300005545 | Ga0070695_100178905 | Ga0070695_1001789052 | 296 |
| 111 | 3300009098 | Ga0105245_10476048 | Ga0105245_104760482 | 296 |
| 112 | 3300013297 | Ga0157378_10058465 | Ga0157378_100584652 | 296 |
| 113 | 3300014969 | Ga0157376_10451998 | Ga0157376_104519982 | 296 |
| 114 | 3300025942 | Ga0207689_10006278 | Ga0207689_1000627813 | 296 |
| 115 | 3300026035 | Ga0207703_10217135 | Ga0207703_102171352 | 296 |
| 116 | 3300026075 | Ga0207708_10336285 | Ga0207708_103362852 | 296 |
| 117 | 3300026118 | Ga0207675_100503378 | Ga0207675_1005033781 | 296 |
| 118 | 3300005615 | Ga0070702_100073639 | Ga0070702_1000736392 | 297 |
| 119 | 3300006173 | Ga0070716_100001401 | Ga0070716_1000014015 | 297 |
| 120 | 3300009176 | Ga0105242_10112289 | Ga0105242_101122891 | 297 |
| 121 | 3300025939 | Ga0207665_10003318 | Ga0207665_100033185 | 297 |
| 122 | 3300035083 | Ga0373926_0000756 | Ga0373926_0000756_4227_5168 | 297 |
| 123 | 3300035089 | Ga0373944_0006381 | Ga0373944_0006381_507_1448 | 297 |
| 124 | 3300035113 | Ga0373936_0004203 | Ga0373936_0004203_1199_2140 | 297 |
| 125 | 3300035692 | Ga0373935_0001314 | Ga0373935_0001314_5070_6011 | 297 |
| 126 | 3300035695 | Ga0373927_0049563 | Ga0373927_0049563_1245_2186 | 297 |
| 127 | 3300035725 | Ga0373947_0029423 | Ga0373947_0029423_507_1448 | 297 |
| 128 | 3300037068 | Ga0373925_0007447 | Ga0373925_0007447_6411_7352 | 297 |
| 129 | 3300046455 | Ga0495603_0004289 | Ga0495603_0004289_5030_5971 | 297 |
| 130 | 3300046473 | Ga0495582_0015951 | Ga0495582_0015951_1625_2566 | 297 |
| 131 | 3300046475 | Ga0495639_0011222 | Ga0495639_0011222_2448_3389 | 297 |
| 132 | 3300046531 | Ga0495665_0010642 | Ga0495665_0010642_819_1760 | 297 |
| 133 | 3300046535 | Ga0495586_0025846 | Ga0495586_0025846_1876_2817 | 297 |
| 134 | 3300046674 | Ga0495588_0038166 | Ga0495588_0038166_756_1697 | 297 |
| 135 | 3300046681 | Ga0495647_0005067 | Ga0495647_0005067_3217_4158 | 297 |
| 136 | 3300046683 | Ga0495658_0084336 | Ga0495658_0084336_489_1430 | 297 |
| 137 | 3300047321 | Ga0495676_0106934 | Ga0495676_0106934_1095_2036 | 297 |
| 138 | 3300048089 | Ga0495614_0110808 | Ga0495614_0110808_39_980 | 297 |
| 139 | 3300005353 | Ga0070669_100182247 | Ga0070669_1001822472 | 298 |
| 140 | 3300006914 | Ga0075436_100020610 | Ga0075436_1000206103 | 298 |
| 141 | 3300007265 | Ga0099794_10022852 | Ga0099794_100228523 | 298 |
| 142 | 3300007265 | Ga0099794_10053843 | Ga0099794_100538432 | 298 |
| 143 | 3300050514 | nmdc:mga08x19_123972_c1 | nmdc:mga08x19_123972_c1_291_1232 | 298 |
| 144 | 3300007265 | Ga0099794_10022778 | Ga0099794_100227782 | 301 |
| 145 | 3300005438 | Ga0070701_10100119 | Ga0070701_101001192 | 302 |
| 146 | 3300005842 | Ga0068858_100186819 | Ga0068858_1001868192 | 302 |
| 147 | 3300026023 | Ga0207677_10155305 | Ga0207677_101553051 | 302 |
| 148 | 3300026089 | Ga0207648_10000663 | Ga0207648_100006631 | 302 |
| 149 | 3300031995 | Ga0307409_100255775 | Ga0307409_1002557751 | 302 |
| 150 | 3300049592 | Ga0501076_0341904 | Ga0501076_0341904_287_1195 | 302 |
| 151 | 3300007788 | Ga0099795_10025500 | Ga0099795_100255002 | 303 |
| 152 | 3300025912 | Ga0207707_10120268 | Ga0207707_101202682 | 303 |
| 153 | 3300035691 | Ga0373931_0204148 | Ga0373931_0204148_154_1125 | 303 |
| 154 | 3300014969 | Ga0157376_10357802 | Ga0157376_103578022 | 304 |
| 155 | 3300027876 | Ga0209974_10022144 | Ga0209974_100221442 | 304 |
| 156 | 3300005340 | Ga0070689_100265045 | Ga0070689_1002650452 | 305 |
| 157 | 3300009553 | Ga0105249_10133150 | Ga0105249_101331504 | 305 |
| 158 | 3300013306 | Ga0163162_10222961 | Ga0163162_102229612 | 305 |
| 159 | 3300025936 | Ga0207670_10173335 | Ga0207670_101733352 | 305 |
| 160 | 3300025961 | Ga0207712_10100181 | Ga0207712_101001812 | 305 |
| 161 | 3300026095 | Ga0207676_10068165 | Ga0207676_100681653 | 305 |
| 162 | 3300027462 | Ga0210000_1000438 | Ga0210000_10004382 | 305 |
| 163 | 3300035086 | Ga0373934_0002091 | Ga0373934_0002091_3299_4243 | 305 |
| 164 | 3300035119 | Ga0373956_0004147 | Ga0373956_0004147_2730_3674 | 305 |
| 165 | 3300035172 | Ga0373955_0012701 | Ga0373955_0012701_2327_3271 | 305 |
| 166 | 3300035724 | Ga0373933_0028194 | Ga0373933_0028194_1875_2819 | 305 |
| 167 | 3300036401 | Ga0373937_0019176 | Ga0373937_0019176_4004_4948 | 305 |
| 168 | 3300046525 | Ga0495663_0043214 | Ga0495663_0043214_276_1196 | 305 |
| 169 | 3300046528 | Ga0495642_0110305 | Ga0495642_0110305_79_999 | 305 |
| 170 | 3300046684 | Ga0495669_0038755 | Ga0495669_0038755_380_1300 | 305 |
| 171 | 3300005336 | Ga0070680_100388808 | Ga0070680_1003888081 | 306 |
| 172 | 3300005458 | Ga0070681_10055432 | Ga0070681_100554325 | 306 |
| 173 | 3300005467 | Ga0070706_100086903 | Ga0070706_1000869033 | 306 |
| 174 | 3300005468 | Ga0070707_100092583 | Ga0070707_1000925832 | 306 |
| 175 | 3300005549 | Ga0070704_100195752 | Ga0070704_1001957521 | 306 |
| 176 | 3300006871 | Ga0075434_100096576 | Ga0075434_1000965762 | 306 |
| 177 | 3300006880 | Ga0075429_100028009 | Ga0075429_1000280094 | 306 |
| 178 | 3300007076 | Ga0075435_100140791 | Ga0075435_1001407912 | 306 |
| 179 | 3300009094 | Ga0111539_10030251 | Ga0111539_100302512 | 306 |
| 180 | 3300027907 | Ga0207428_10031371 | Ga0207428_100313711 | 306 |
| 181 | 3300048912 | Ga0496109_0079918 | Ga0496109_0079918_551_1558 | 306 |
| 182 | 3300050508 | nmdc:mga09592_10327_c1 | nmdc:mga09592_10327_c1_1818_2744 | 306 |
| 183 | 3300050509 | nmdc:mga0qj67_53926_c1 | nmdc:mga0qj67_53926_c1_1623_2552 | 306 |
| 184 | 3300050511 | nmdc:mga08y16_2516_c1 | nmdc:mga08y16_2516_c1_3549_4475 | 306 |
| 185 | 3300005330 | Ga0070690_100074882 | Ga0070690_1000748822 | 307 |
| 186 | 3300005343 | Ga0070687_100053678 | Ga0070687_1000536782 | 307 |
| 187 | 3300005456 | Ga0070678_100059588 | Ga0070678_1000595882 | 307 |
| 188 | 3300005459 | Ga0068867_100008650 | Ga0068867_1000086502 | 307 |
| 189 | 3300005718 | Ga0068866_10084268 | Ga0068866_100842682 | 307 |
| 190 | 3300005843 | Ga0068860_100128216 | Ga0068860_1001282162 | 307 |
| 191 | 3300006237 | Ga0097621_100068795 | Ga0097621_1000687952 | 307 |
| 192 | 3300009148 | Ga0105243_10042758 | Ga0105243_100427583 | 307 |
| 193 | 3300009176 | Ga0105242_10182831 | Ga0105242_101828312 | 307 |
| 194 | 3300014968 | Ga0157379_10113279 | Ga0157379_101132792 | 307 |
| 195 | 3300017792 | Ga0163161_10010635 | Ga0163161_100106354 | 307 |
| 196 | 3300025899 | Ga0207642_10034423 | Ga0207642_100344232 | 307 |
| 197 | 3300025934 | Ga0207686_10062766 | Ga0207686_100627662 | 307 |
| 198 | 3300025938 | Ga0207704_10021683 | Ga0207704_100216832 | 307 |
| 199 | 3300025940 | Ga0207691_10109654 | Ga0207691_101096542 | 307 |
| 200 | 3300025960 | Ga0207651_10150097 | Ga0207651_101500972 | 307 |
| 201 | 3300026075 | Ga0207708_10103459 | Ga0207708_101034592 | 307 |
| 202 | 3300026089 | Ga0207648_10003622 | Ga0207648_100036226 | 307 |
| 203 | 3300026118 | Ga0207675_100234074 | Ga0207675_1002340742 | 307 |
| 204 | 3300026121 | Ga0207683_10032720 | Ga0207683_100327204 | 307 |
| 205 | 3300005334 | Ga0068869_100034372 | Ga0068869_1000343721 | 308 |
| 206 | 3300005343 | Ga0070687_100088813 | Ga0070687_1000888131 | 308 |
| 207 | 3300005440 | Ga0070705_100026095 | Ga0070705_1000260953 | 308 |
| 208 | 3300005456 | Ga0070678_100079281 | Ga0070678_1000792813 | 308 |
| 209 | 3300005458 | Ga0070681_10036424 | Ga0070681_100364245 | 308 |
| 210 | 3300005459 | Ga0068867_100137478 | Ga0068867_1001374782 | 308 |
| 211 | 3300005467 | Ga0070706_100109456 | Ga0070706_1001094562 | 308 |
| 212 | 3300005536 | Ga0070697_100013262 | Ga0070697_1000132624 | 308 |
| 213 | 3300005543 | Ga0070672_100127568 | Ga0070672_1001275682 | 308 |
| 214 | 3300005545 | Ga0070695_100191469 | Ga0070695_1001914691 | 308 |
| 215 | 3300005547 | Ga0070693_100040794 | Ga0070693_1000407942 | 308 |
| 216 | 3300005843 | Ga0068860_100121034 | Ga0068860_1001210342 | 308 |
| 217 | 3300005844 | Ga0068862_100256979 | Ga0068862_1002569792 | 308 |
| 218 | 3300007076 | Ga0075435_100122597 | Ga0075435_1001225972 | 308 |
| 219 | 3300007265 | Ga0099794_10025794 | Ga0099794_100257943 | 308 |
| 220 | 3300025893 | Ga0207682_10002135 | Ga0207682_100021357 | 308 |
| 221 | 3300025899 | Ga0207642_10059380 | Ga0207642_100593802 | 308 |
| 222 | 3300025907 | Ga0207645_10006895 | Ga0207645_100068953 | 308 |
| 223 | 3300025910 | Ga0207684_10223392 | Ga0207684_102233922 | 308 |
| 224 | 3300025912 | Ga0207707_10019952 | Ga0207707_100199528 | 308 |
| 225 | 3300025922 | Ga0207646_10106785 | Ga0207646_101067854 | 308 |
| 226 | 3300025931 | Ga0207644_10090564 | Ga0207644_100905642 | 308 |
| 227 | 3300025933 | Ga0207706_10040534 | Ga0207706_100405342 | 308 |
| 228 | 3300026089 | Ga0207648_10012278 | Ga0207648_100122786 | 308 |
| 229 | 3300026118 | Ga0207675_100008190 | Ga0207675_1000081902 | 308 |
| 230 | 3300028380 | Ga0268265_10094234 | Ga0268265_100942342 | 308 |
| 231 | 3300046454 | Ga0495592_0121257 | Ga0495592_0121257_377_1333 | 308 |
| 232 | 3300046678 | Ga0495599_0208122 | Ga0495599_0208122_179_1135 | 308 |
| 233 | 3300050512 | nmdc:mga0n895_308466_c1 | nmdc:mga0n895_308466_c1_131_1069 | 308 |
| 234 | 3300005354 | Ga0070675_100333367 | Ga0070675_1003333672 | 309 |
| 235 | 3300009094 | Ga0111539_10035779 | Ga0111539_100357794 | 309 |
| 236 | 3300027471 | Ga0209995_1005811 | Ga0209995_10058112 | 309 |
| 237 | 3300027665 | Ga0209983_1028771 | Ga0209983_10287711 | 309 |
| 238 | 3300039438 | Ga0436360_0004950 | Ga0436360_0004950_67_1032 | 309 |
| 239 | 3300047318 | Ga0495636_0051064 | Ga0495636_0051064_598_1617 | 309 |
| 240 | 3300047318 | Ga0495636_0058925 | Ga0495636_0058925_193_1221 | 309 |
| 241 | 3300050508 | nmdc:mga09592_21940_c1 | nmdc:mga09592_21940_c1_2120_3058 | 309 |
| 242 | 3300005435 | Ga0070714_100022417 | Ga0070714_1000224173 | 310 |
| 243 | 3300005458 | Ga0070681_10007773 | Ga0070681_100077734 | 310 |
| 244 | 3300005458 | Ga0070681_10012078 | Ga0070681_100120783 | 310 |
| 245 | 3300005467 | Ga0070706_100007041 | Ga0070706_1000070413 | 310 |
| 246 | 3300005467 | Ga0070706_100340103 | Ga0070706_1003401032 | 310 |
| 247 | 3300005468 | Ga0070707_100013180 | Ga0070707_1000131802 | 310 |
| 248 | 3300005530 | Ga0070679_100042295 | Ga0070679_1000422952 | 310 |
| 249 | 3300005545 | Ga0070695_100069972 | Ga0070695_1000699722 | 310 |
| 250 | 3300005844 | Ga0068862_100189171 | Ga0068862_1001891712 | 310 |
| 251 | 3300006846 | Ga0075430_100229313 | Ga0075430_1002293132 | 310 |
| 252 | 3300006847 | Ga0075431_100001415 | Ga0075431_10000141512 | 310 |
| 253 | 3300006871 | Ga0075434_100327861 | Ga0075434_1003278612 | 310 |
| 254 | 3300006880 | Ga0075429_100029527 | Ga0075429_1000295272 | 310 |
| 255 | 3300013297 | Ga0157378_10222622 | Ga0157378_102226222 | 310 |
| 256 | 3300025910 | Ga0207684_10122878 | Ga0207684_101228781 | 310 |
| 257 | 3300025912 | Ga0207707_10033160 | Ga0207707_100331605 | 310 |
| 258 | 3300025912 | Ga0207707_10072705 | Ga0207707_100727052 | 310 |
| 259 | 3300025921 | Ga0207652_10069494 | Ga0207652_100694943 | 310 |
| 260 | 3300025921 | Ga0207652_10362936 | Ga0207652_103629361 | 310 |
| 261 | 3300031238 | Ga0265332_10040462 | Ga0265332_100404621 | 310 |
| 262 | 3300035692 | Ga0373935_0318566 | Ga0373935_0318566_124_1059 | 310 |
| 263 | 3300042876 | Ga0451577_0226919 | Ga0451577_0226919_73_1032 | 310 |
| 264 | 3300045051 | Ga0451576_0127667 | Ga0451576_0127667_73_1050 | 310 |
| 265 | 3300050508 | nmdc:mga09592_23470_c1 | nmdc:mga09592_23470_c1_3352_4332 | 310 |
| 266 | 3300050509 | nmdc:mga0qj67_78345_c1 | nmdc:mga0qj67_78345_c1_33_1013 | 310 |
| 267 | 3300050510 | nmdc:mga06r32_2431_c1 | nmdc:mga06r32_2431_c1_5640_6620 | 310 |
| 268 | 3300005331 | Ga0070670_100003991 | Ga0070670_1000039914 | 311 |
| 269 | 3300005331 | Ga0070670_100005246 | Ga0070670_1000052465 | 311 |
| 270 | 3300005333 | Ga0070677_10001359 | Ga0070677_100013596 | 311 |
| 271 | 3300005333 | Ga0070677_10004286 | Ga0070677_100042862 | 311 |
| 272 | 3300005334 | Ga0068869_100045460 | Ga0068869_1000454601 | 311 |
| 273 | 3300005334 | Ga0068869_100102771 | Ga0068869_1001027712 | 311 |
| 274 | 3300005335 | Ga0070666_10003778 | Ga0070666_100037787 | 311 |
| 275 | 3300005335 | Ga0070666_10018150 | Ga0070666_100181501 | 311 |
| 276 | 3300005338 | Ga0068868_100000544 | Ga0068868_10000054414 | 311 |
| 277 | 3300005338 | Ga0068868_100025660 | Ga0068868_1000256607 | 311 |
| 278 | 3300005340 | Ga0070689_100031295 | Ga0070689_1000312952 | 311 |
| 279 | 3300005344 | Ga0070661_100011278 | Ga0070661_1000112784 | 311 |
| 280 | 3300005345 | Ga0070692_10087247 | Ga0070692_100872473 | 311 |
| 281 | 3300005347 | Ga0070668_100037336 | Ga0070668_1000373362 | 311 |
| 282 | 3300005353 | Ga0070669_100084505 | Ga0070669_1000845053 | 311 |
| 283 | 3300005354 | Ga0070675_100001594 | Ga0070675_1000015946 | 311 |
| 284 | 3300005354 | Ga0070675_100036749 | Ga0070675_1000367492 | 311 |
| 285 | 3300005355 | Ga0070671_100013744 | Ga0070671_1000137445 | 311 |
| 286 | 3300005355 | Ga0070671_100056542 | Ga0070671_1000565422 | 311 |
| 287 | 3300005356 | Ga0070674_100021230 | Ga0070674_1000212306 | 311 |
| 288 | 3300005364 | Ga0070673_100006483 | Ga0070673_1000064836 | 311 |
| 289 | 3300005364 | Ga0070673_100046006 | Ga0070673_1000460062 | 311 |
| 290 | 3300005365 | Ga0070688_100044115 | Ga0070688_1000441153 | 311 |
| 291 | 3300005367 | Ga0070667_100073068 | Ga0070667_1000730683 | 311 |
| 292 | 3300005367 | Ga0070667_100085974 | Ga0070667_1000859742 | 311 |
| 293 | 3300005438 | Ga0070701_10038810 | Ga0070701_100388102 | 311 |
| 294 | 3300005441 | Ga0070700_100018163 | Ga0070700_1000181635 | 311 |
| 295 | 3300005456 | Ga0070678_100000281 | Ga0070678_1000002818 | 311 |
| 296 | 3300005456 | Ga0070678_100022358 | Ga0070678_1000223582 | 311 |
| 297 | 3300005457 | Ga0070662_100031021 | Ga0070662_1000310212 | 311 |
| 298 | 3300005457 | Ga0070662_100069338 | Ga0070662_1000693383 | 311 |
| 299 | 3300005459 | Ga0068867_100011002 | Ga0068867_1000110029 | 311 |
| 300 | 3300005466 | Ga0070685_10052239 | Ga0070685_100522392 | 311 |
| 301 | 3300005543 | Ga0070672_100001056 | Ga0070672_1000010562 | 311 |
| 302 | 3300005544 | Ga0070686_100067046 | Ga0070686_1000670462 | 311 |
| 303 | 3300005546 | Ga0070696_100129137 | Ga0070696_1001291372 | 311 |
| 304 | 3300005564 | Ga0070664_100000329 | Ga0070664_10000032926 | 311 |
| 305 | 3300005564 | Ga0070664_100089901 | Ga0070664_1000899012 | 311 |
| 306 | 3300005615 | Ga0070702_100128147 | Ga0070702_1001281472 | 311 |
| 307 | 3300005616 | Ga0068852_100000200 | Ga0068852_10000020021 | 311 |
| 308 | 3300005618 | Ga0068864_100005962 | Ga0068864_1000059627 | 311 |
| 309 | 3300005618 | Ga0068864_100093333 | Ga0068864_1000933333 | 311 |
| 310 | 3300005841 | Ga0068863_100153418 | Ga0068863_1001534182 | 311 |
| 311 | 3300005842 | Ga0068858_100014277 | Ga0068858_1000142771 | 311 |
| 312 | 3300005843 | Ga0068860_100060532 | Ga0068860_1000605323 | 311 |
| 313 | 3300005844 | Ga0068862_100073405 | Ga0068862_1000734052 | 311 |
| 314 | 3300005985 | Ga0081539_10001828 | Ga0081539_1000182819 | 311 |
| 315 | 3300006237 | Ga0097621_100004924 | Ga0097621_1000049242 | 311 |
| 316 | 3300006237 | Ga0097621_100039222 | Ga0097621_1000392226 | 311 |
| 317 | 3300006358 | Ga0068871_100000447 | Ga0068871_10000044718 | 311 |
| 318 | 3300006358 | Ga0068871_100012469 | Ga0068871_1000124698 | 311 |
| 319 | 3300006844 | Ga0075428_100012504 | Ga0075428_1000125044 | 311 |
| 320 | 3300006844 | Ga0075428_100139966 | Ga0075428_1001399664 | 311 |
| 321 | 3300006846 | Ga0075430_100051035 | Ga0075430_1000510352 | 311 |
| 322 | 3300006847 | Ga0075431_100025203 | Ga0075431_1000252034 | 311 |
| 323 | 3300006880 | Ga0075429_100026726 | Ga0075429_1000267265 | 311 |
| 324 | 3300009094 | Ga0111539_10001180 | Ga0111539_100011807 | 311 |
| 325 | 3300009098 | Ga0105245_10026682 | Ga0105245_100266822 | 311 |
| 326 | 3300009101 | Ga0105247_10198235 | Ga0105247_101982352 | 311 |
| 327 | 3300009147 | Ga0114129_10493654 | Ga0114129_104936542 | 311 |
| 328 | 3300009148 | Ga0105243_10059257 | Ga0105243_100592573 | 311 |
| 329 | 3300009176 | Ga0105242_10004388 | Ga0105242_1000438812 | 311 |
| 330 | 3300009177 | Ga0105248_10068598 | Ga0105248_100685982 | 311 |
| 331 | 3300009553 | Ga0105249_10072198 | Ga0105249_100721981 | 311 |
| 332 | 3300013296 | Ga0157374_10000653 | Ga0157374_1000065314 | 311 |
| 333 | 3300013297 | Ga0157378_10018221 | Ga0157378_100182212 | 311 |
| 334 | 3300013297 | Ga0157378_10033333 | Ga0157378_100333337 | 311 |
| 335 | 3300013306 | Ga0163162_10015710 | Ga0163162_100157107 | 311 |
| 336 | 3300013308 | Ga0157375_10000621 | Ga0157375_100006216 | 311 |
| 337 | 3300013308 | Ga0157375_10432767 | Ga0157375_104327672 | 311 |
| 338 | 3300014325 | Ga0163163_10036631 | Ga0163163_100366315 | 311 |
| 339 | 3300014326 | Ga0157380_10044574 | Ga0157380_100445744 | 311 |
| 340 | 3300014968 | Ga0157379_10019658 | Ga0157379_100196588 | 311 |
| 341 | 3300014969 | Ga0157376_10031688 | Ga0157376_100316885 | 311 |
| 342 | 3300017792 | Ga0163161_10029881 | Ga0163161_100298812 | 311 |
| 343 | 3300025893 | Ga0207682_10001994 | Ga0207682_1000199411 | 311 |
| 344 | 3300025893 | Ga0207682_10005871 | Ga0207682_100058712 | 311 |
| 345 | 3300025899 | Ga0207642_10013949 | Ga0207642_100139493 | 311 |
| 346 | 3300025901 | Ga0207688_10007041 | Ga0207688_100070417 | 311 |
| 347 | 3300025901 | Ga0207688_10236022 | Ga0207688_102360221 | 311 |
| 348 | 3300025903 | Ga0207680_10003125 | Ga0207680_100031256 | 311 |
| 349 | 3300025907 | Ga0207645_10048125 | Ga0207645_100481252 | 311 |
| 350 | 3300025908 | Ga0207643_10005914 | Ga0207643_100059145 | 311 |
| 351 | 3300025925 | Ga0207650_10001197 | Ga0207650_100011973 | 311 |
| 352 | 3300025925 | Ga0207650_10043667 | Ga0207650_100436673 | 311 |
| 353 | 3300025926 | Ga0207659_10018737 | Ga0207659_100187375 | 311 |
| 354 | 3300025927 | Ga0207687_10060985 | Ga0207687_100609853 | 311 |
| 355 | 3300025931 | Ga0207644_10000669 | Ga0207644_1000066913 | 311 |
| 356 | 3300025931 | Ga0207644_10003503 | Ga0207644_100035034 | 311 |
| 357 | 3300025933 | Ga0207706_10012515 | Ga0207706_100125152 | 311 |
| 358 | 3300025934 | Ga0207686_10035958 | Ga0207686_100359582 | 311 |
| 359 | 3300025936 | Ga0207670_10005745 | Ga0207670_100057452 | 311 |
| 360 | 3300025937 | Ga0207669_10045357 | Ga0207669_100453573 | 311 |
| 361 | 3300025938 | Ga0207704_10018258 | Ga0207704_100182582 | 311 |
| 362 | 3300025940 | Ga0207691_10000470 | Ga0207691_1000047025 | 311 |
| 363 | 3300025940 | Ga0207691_10014920 | Ga0207691_100149205 | 311 |
| 364 | 3300025942 | Ga0207689_10034477 | Ga0207689_100344774 | 311 |
| 365 | 3300025942 | Ga0207689_10108625 | Ga0207689_101086253 | 311 |
| 366 | 3300025944 | Ga0207661_10002744 | Ga0207661_100027442 | 311 |
| 367 | 3300025945 | Ga0207679_10015095 | Ga0207679_100150953 | 311 |
| 368 | 3300025960 | Ga0207651_10005066 | Ga0207651_100050662 | 311 |
| 369 | 3300025981 | Ga0207640_10030183 | Ga0207640_100301833 | 311 |
| 370 | 3300025986 | Ga0207658_10014281 | Ga0207658_100142812 | 311 |
| 371 | 3300025986 | Ga0207658_10031982 | Ga0207658_100319822 | 311 |
| 372 | 3300026023 | Ga0207677_10001517 | Ga0207677_100015178 | 311 |
| 373 | 3300026035 | Ga0207703_10128534 | Ga0207703_101285341 | 311 |
| 374 | 3300026075 | Ga0207708_10014517 | Ga0207708_100145178 | 311 |
| 375 | 3300026088 | Ga0207641_10037194 | Ga0207641_100371945 | 311 |
| 376 | 3300026089 | Ga0207648_10019268 | Ga0207648_100192687 | 311 |
| 377 | 3300026095 | Ga0207676_10007149 | Ga0207676_100071492 | 311 |
| 378 | 3300026095 | Ga0207676_10027081 | Ga0207676_100270816 | 311 |
| 379 | 3300026118 | Ga0207675_100012673 | Ga0207675_10001267310 | 311 |
| 380 | 3300026121 | Ga0207683_10000581 | Ga0207683_1000058123 | 311 |
| 381 | 3300026121 | Ga0207683_10002874 | Ga0207683_100028744 | 311 |
| 382 | 3300027360 | Ga0209969_1001471 | Ga0209969_10014712 | 311 |
| 383 | 3300027364 | Ga0209967_1000706 | Ga0209967_10007063 | 311 |
| 384 | 3300027462 | Ga0210000_1000480 | Ga0210000_10004805 | 311 |
| 385 | 3300027471 | Ga0209995_1002576 | Ga0209995_10025762 | 311 |
| 386 | 3300027682 | Ga0209971_1020908 | Ga0209971_10209082 | 311 |
| 387 | 3300027907 | Ga0207428_10005229 | Ga0207428_100052296 | 311 |
| 388 | 3300027907 | Ga0207428_10044623 | Ga0207428_100446233 | 311 |
| 389 | 3300028379 | Ga0268266_10132873 | Ga0268266_101328733 | 311 |
| 390 | 3300042530 | Ga0450916_011267 | Ga0450916_011267_69_1043 | 311 |
| 391 | 3300048904 | Ga0496101_0014428 | Ga0496101_0014428_3007_3981 | 311 |
| 392 | 3300048905 | Ga0496102_0264037 | Ga0496102_0264037_11_985 | 311 |
| 393 | 3300048909 | Ga0496106_0158479 | Ga0496106_0158479_259_1233 | 311 |
| 394 | 3300048911 | Ga0496108_0026594 | Ga0496108_0026594_2712_3686 | 311 |
| 395 | 3300048913 | Ga0496110_0002686 | Ga0496110_0002686_8239_9213 | 311 |
| 396 | 3300048914 | Ga0496111_0015962 | Ga0496111_0015962_2787_3761 | 311 |
| 397 | 3300048917 | Ga0496114_0106406 | Ga0496114_0106406_972_1931 | 311 |
| 398 | 3300050508 | nmdc:mga09592_40461_c1 | nmdc:mga09592_40461_c1_202_1167 | 311 |
| 399 | 3300050509 | nmdc:mga0qj67_38194_c1 | nmdc:mga0qj67_38194_c1_719_1681 | 311 |
| 400 | 3300050510 | nmdc:mga06r32_77532_c1 | nmdc:mga06r32_77532_c1_2164_3126 | 311 |
| 401 | 3300050511 | nmdc:mga08y16_1491_c1 | nmdc:mga08y16_1491_c1_16501_17466 | 311 |
| 402 | 3300050511 | nmdc:mga08y16_224691_c1 | nmdc:mga08y16_224691_c1_465_1424 | 311 |
| 403 | 3300005290 | Ga0065712_10135169 | Ga0065712_101351691 | 312 |
| 404 | 3300005329 | Ga0070683_100013594 | Ga0070683_1000135944 | 312 |
| 405 | 3300005331 | Ga0070670_100000483 | Ga0070670_10000048324 | 312 |
| 406 | 3300005338 | Ga0068868_100000421 | Ga0068868_1000004215 | 312 |
| 407 | 3300005340 | Ga0070689_100102376 | Ga0070689_1001023762 | 312 |
| 408 | 3300005344 | Ga0070661_100002938 | Ga0070661_1000029387 | 312 |
| 409 | 3300005347 | Ga0070668_100304915 | Ga0070668_1003049151 | 312 |
| 410 | 3300005354 | Ga0070675_100135125 | Ga0070675_1001351252 | 312 |
| 411 | 3300005354 | Ga0070675_100277660 | Ga0070675_1002776602 | 312 |
| 412 | 3300005364 | Ga0070673_100008587 | Ga0070673_1000085876 | 312 |
| 413 | 3300005367 | Ga0070667_100209236 | Ga0070667_1002092362 | 312 |
| 414 | 3300005444 | Ga0070694_100094041 | Ga0070694_1000940412 | 312 |
| 415 | 3300005456 | Ga0070678_100002597 | Ga0070678_1000025979 | 312 |
| 416 | 3300005456 | Ga0070678_100056346 | Ga0070678_1000563462 | 312 |
| 417 | 3300005458 | Ga0070681_10044687 | Ga0070681_100446873 | 312 |
| 418 | 3300005459 | Ga0068867_100015279 | Ga0068867_1000152794 | 312 |
| 419 | 3300005467 | Ga0070706_100060112 | Ga0070706_1000601123 | 312 |
| 420 | 3300005468 | Ga0070707_100017332 | Ga0070707_1000173327 | 312 |
| 421 | 3300005536 | Ga0070697_100173121 | Ga0070697_1001731211 | 312 |
| 422 | 3300005543 | Ga0070672_100000856 | Ga0070672_1000008563 | 312 |
| 423 | 3300005544 | Ga0070686_100171091 | Ga0070686_1001710911 | 312 |
| 424 | 3300005548 | Ga0070665_100263154 | Ga0070665_1002631542 | 312 |
| 425 | 3300005564 | Ga0070664_100369932 | Ga0070664_1003699321 | 312 |
| 426 | 3300005578 | Ga0068854_100011066 | Ga0068854_1000110665 | 312 |
| 427 | 3300005615 | Ga0070702_100038175 | Ga0070702_1000381752 | 312 |
| 428 | 3300005616 | Ga0068852_100010934 | Ga0068852_1000109342 | 312 |
| 429 | 3300005617 | Ga0068859_100398820 | Ga0068859_1003988202 | 312 |
| 430 | 3300005618 | Ga0068864_100032913 | Ga0068864_1000329132 | 312 |
| 431 | 3300005618 | Ga0068864_100051979 | Ga0068864_1000519792 | 312 |
| 432 | 3300005834 | Ga0068851_10120327 | Ga0068851_101203272 | 312 |
| 433 | 3300005841 | Ga0068863_100143398 | Ga0068863_1001433982 | 312 |
| 434 | 3300006163 | Ga0070715_10095912 | Ga0070715_100959122 | 312 |
| 435 | 3300006173 | Ga0070716_100001401 | Ga0070716_1000014014 | 312 |
| 436 | 3300006237 | Ga0097621_100008507 | Ga0097621_1000085075 | 312 |
| 437 | 3300006237 | Ga0097621_100210972 | Ga0097621_1002109722 | 312 |
| 438 | 3300006358 | Ga0068871_100000437 | Ga0068871_10000043723 | 312 |
| 439 | 3300006931 | Ga0097620_100398850 | Ga0097620_1003988502 | 312 |
| 440 | 3300009094 | Ga0111539_10237065 | Ga0111539_102370652 | 312 |
| 441 | 3300009094 | Ga0111539_10374209 | Ga0111539_103742092 | 312 |
| 442 | 3300009098 | Ga0105245_10493467 | Ga0105245_104934671 | 312 |
| 443 | 3300009148 | Ga0105243_10093022 | Ga0105243_100930222 | 312 |
| 444 | 3300009176 | Ga0105242_10113883 | Ga0105242_101138832 | 312 |
| 445 | 3300009553 | Ga0105249_10035327 | Ga0105249_100353273 | 312 |
| 446 | 3300011119 | Ga0105246_10331506 | Ga0105246_103315062 | 312 |
| 447 | 3300013296 | Ga0157374_10140639 | Ga0157374_101406393 | 312 |
| 448 | 3300013296 | Ga0157374_10391766 | Ga0157374_103917661 | 312 |
| 449 | 3300013297 | Ga0157378_10161624 | Ga0157378_101616242 | 312 |
| 450 | 3300014969 | Ga0157376_10688514 | Ga0157376_106885141 | 312 |
| 451 | 3300017792 | Ga0163161_10326356 | Ga0163161_103263562 | 312 |
| 452 | 3300025321 | Ga0207656_10090936 | Ga0207656_100909361 | 312 |
| 453 | 3300025901 | Ga0207688_10091329 | Ga0207688_100913291 | 312 |
| 454 | 3300025905 | Ga0207685_10118635 | Ga0207685_101186351 | 312 |
| 455 | 3300025907 | Ga0207645_10030250 | Ga0207645_100302503 | 312 |
| 456 | 3300025908 | Ga0207643_10057136 | Ga0207643_100571362 | 312 |
| 457 | 3300025912 | Ga0207707_10088495 | Ga0207707_100884952 | 312 |
| 458 | 3300025925 | Ga0207650_10003351 | Ga0207650_100033514 | 312 |
| 459 | 3300025926 | Ga0207659_10000560 | Ga0207659_100005602 | 312 |
| 460 | 3300025926 | Ga0207659_10013837 | Ga0207659_100138374 | 312 |
| 461 | 3300025939 | Ga0207665_10003318 | Ga0207665_100033184 | 312 |
| 462 | 3300025940 | Ga0207691_10001135 | Ga0207691_1000113519 | 312 |
| 463 | 3300025940 | Ga0207691_10244947 | Ga0207691_102449472 | 312 |
| 464 | 3300025942 | Ga0207689_10016087 | Ga0207689_100160874 | 312 |
| 465 | 3300025944 | Ga0207661_10100171 | Ga0207661_101001712 | 312 |
| 466 | 3300025945 | Ga0207679_10310384 | Ga0207679_103103842 | 312 |
| 467 | 3300025960 | Ga0207651_10029360 | Ga0207651_100293602 | 312 |
| 468 | 3300025972 | Ga0207668_10318300 | Ga0207668_103183002 | 312 |
| 469 | 3300025981 | Ga0207640_10126403 | Ga0207640_101264032 | 312 |
| 470 | 3300026035 | Ga0207703_10161203 | Ga0207703_101612032 | 312 |
| 471 | 3300026075 | Ga0207708_10032394 | Ga0207708_100323943 | 312 |
| 472 | 3300026089 | Ga0207648_10051455 | Ga0207648_100514553 | 312 |
| 473 | 3300026095 | Ga0207676_10001530 | Ga0207676_100015306 | 312 |
| 474 | 3300026095 | Ga0207676_10010953 | Ga0207676_100109535 | 312 |
| 475 | 3300026116 | Ga0207674_10256706 | Ga0207674_102567062 | 312 |
| 476 | 3300026121 | Ga0207683_10000394 | Ga0207683_1000039431 | 312 |
| 477 | 3300026121 | Ga0207683_10319053 | Ga0207683_103190532 | 312 |
| 478 | 3300028577 | Ga0265318_10011303 | Ga0265318_100113033 | 312 |
| 479 | 3300028577 | Ga0265318_10041206 | Ga0265318_100412062 | 312 |
| 480 | 3300031235 | Ga0265330_10040994 | Ga0265330_100409941 | 312 |
| 481 | 3300031238 | Ga0265332_10001271 | Ga0265332_1000127116 | 312 |
| 482 | 3300031238 | Ga0265332_10001357 | Ga0265332_100013572 | 312 |
| 483 | 3300031239 | Ga0265328_10011152 | Ga0265328_100111523 | 312 |
| 484 | 3300031239 | Ga0265328_10013797 | Ga0265328_100137972 | 312 |
| 485 | 3300031240 | Ga0265320_10014112 | Ga0265320_100141123 | 312 |
| 486 | 3300031240 | Ga0265320_10031292 | Ga0265320_100312922 | 312 |
| 487 | 3300031250 | Ga0265331_10001190 | Ga0265331_100011904 | 312 |
| 488 | 3300031250 | Ga0265331_10001292 | Ga0265331_100012927 | 312 |
| 489 | 3300031250 | Ga0265331_10019878 | Ga0265331_100198783 | 312 |
| 490 | 3300031251 | Ga0265327_10031784 | Ga0265327_100317843 | 312 |
| 491 | 3300031711 | Ga0265314_10005591 | Ga0265314_100055913 | 312 |
| 492 | 3300031711 | Ga0265314_10019279 | Ga0265314_100192792 | 312 |
| 493 | 3300031712 | Ga0265342_10023351 | Ga0265342_100233512 | 312 |
| 494 | 3300045051 | Ga0451576_0162512 | Ga0451576_0162512_340_1320 | 312 |
| 495 | 3300045836 | Ga0466958_0199976 | Ga0466958_0199976_152_1126 | 312 |
| 496 | 3300046537 | Ga0495598_0014722 | Ga0495598_0014722_298_1278 | 312 |
| 497 | 3300046664 | Ga0495659_0039725 | Ga0495659_0039725_202_1203 | 312 |
| 498 | 3300046684 | Ga0495669_0012847 | Ga0495669_0012847_270_1250 | 312 |
| 499 | 3300050511 | nmdc:mga08y16_324312_c1 | nmdc:mga08y16_324312_c1_563_1525 | 312 |
| 500 | 3300050513 | nmdc:mga0rr50_173907_c1 | nmdc:mga0rr50_173907_c1_51_1031 | 312 |
| 501 | 3300005329 | Ga0070683_100009923 | Ga0070683_10000992310 | 313 |
| 502 | 3300005330 | Ga0070690_100143099 | Ga0070690_1001430992 | 313 |
| 503 | 3300005331 | Ga0070670_100037537 | Ga0070670_1000375372 | 313 |
| 504 | 3300005331 | Ga0070670_100185270 | Ga0070670_1001852702 | 313 |
| 505 | 3300005333 | Ga0070677_10024668 | Ga0070677_100246682 | 313 |
| 506 | 3300005335 | Ga0070666_10017096 | Ga0070666_100170962 | 313 |
| 507 | 3300005338 | Ga0068868_100006019 | Ga0068868_10000601911 | 313 |
| 508 | 3300005338 | Ga0068868_100011660 | Ga0068868_1000116603 | 313 |
| 509 | 3300005339 | Ga0070660_100085657 | Ga0070660_1000856572 | 313 |
| 510 | 3300005347 | Ga0070668_100193293 | Ga0070668_1001932932 | 313 |
| 511 | 3300005354 | Ga0070675_100029057 | Ga0070675_1000290572 | 313 |
| 512 | 3300005355 | Ga0070671_100010384 | Ga0070671_1000103844 | 313 |
| 513 | 3300005355 | Ga0070671_100026402 | Ga0070671_1000264023 | 313 |
| 514 | 3300005356 | Ga0070674_100020518 | Ga0070674_1000205182 | 313 |
| 515 | 3300005364 | Ga0070673_100129300 | Ga0070673_1001293002 | 313 |
| 516 | 3300005364 | Ga0070673_100181856 | Ga0070673_1001818562 | 313 |
| 517 | 3300005365 | Ga0070688_100100052 | Ga0070688_1001000522 | 313 |
| 518 | 3300005441 | Ga0070700_100026460 | Ga0070700_1000264601 | 313 |
| 519 | 3300005444 | Ga0070694_100179028 | Ga0070694_1001790282 | 313 |
| 520 | 3300005456 | Ga0070678_100003940 | Ga0070678_1000039404 | 313 |
| 521 | 3300005456 | Ga0070678_100172825 | Ga0070678_1001728251 | 313 |
| 522 | 3300005456 | Ga0070678_100243805 | Ga0070678_1002438052 | 313 |
| 523 | 3300005457 | Ga0070662_100333670 | Ga0070662_1003336701 | 313 |
| 524 | 3300005458 | Ga0070681_10133033 | Ga0070681_101330332 | 313 |
| 525 | 3300005467 | Ga0070706_100023816 | Ga0070706_1000238165 | 313 |
| 526 | 3300005535 | Ga0070684_100198522 | Ga0070684_1001985222 | 313 |
| 527 | 3300005536 | Ga0070697_100224505 | Ga0070697_1002245052 | 313 |
| 528 | 3300005543 | Ga0070672_100088638 | Ga0070672_1000886382 | 313 |
| 529 | 3300005564 | Ga0070664_100092960 | Ga0070664_1000929603 | 313 |
| 530 | 3300005578 | Ga0068854_100004773 | Ga0068854_1000047732 | 313 |
| 531 | 3300005578 | Ga0068854_100398249 | Ga0068854_1003982491 | 313 |
| 532 | 3300005616 | Ga0068852_100058250 | Ga0068852_1000582504 | 313 |
| 533 | 3300005617 | Ga0068859_100072696 | Ga0068859_1000726963 | 313 |
| 534 | 3300005718 | Ga0068866_10023077 | Ga0068866_100230773 | 313 |
| 535 | 3300005719 | Ga0068861_100049628 | Ga0068861_1000496282 | 313 |
| 536 | 3300005840 | Ga0068870_10045907 | Ga0068870_100459072 | 313 |
| 537 | 3300005840 | Ga0068870_10162374 | Ga0068870_101623742 | 313 |
| 538 | 3300005842 | Ga0068858_100059116 | Ga0068858_1000591163 | 313 |
| 539 | 3300005844 | Ga0068862_100109561 | Ga0068862_1001095612 | 313 |
| 540 | 3300006237 | Ga0097621_100071128 | Ga0097621_1000711282 | 313 |
| 541 | 3300006358 | Ga0068871_100010311 | Ga0068871_1000103114 | 313 |
| 542 | 3300006844 | Ga0075428_100002635 | Ga0075428_1000026353 | 313 |
| 543 | 3300006844 | Ga0075428_100006285 | Ga0075428_1000062858 | 313 |
| 544 | 3300006880 | Ga0075429_100005895 | Ga0075429_10000589511 | 313 |
| 545 | 3300006880 | Ga0075429_100041179 | Ga0075429_1000411792 | 313 |
| 546 | 3300006914 | Ga0075436_100029510 | Ga0075436_1000295102 | 313 |
| 547 | 3300006931 | Ga0097620_100072698 | Ga0097620_1000726982 | 313 |
| 548 | 3300007076 | Ga0075435_100317543 | Ga0075435_1003175431 | 313 |
| 549 | 3300009094 | Ga0111539_10001180 | Ga0111539_1000118022 | 313 |
| 550 | 3300009094 | Ga0111539_10002096 | Ga0111539_1000209634 | 313 |
| 551 | 3300009094 | Ga0111539_10017884 | Ga0111539_100178846 | 313 |
| 552 | 3300009098 | Ga0105245_10052676 | Ga0105245_100526763 | 313 |
| 553 | 3300009147 | Ga0114129_10133238 | Ga0114129_101332382 | 313 |
| 554 | 3300009148 | Ga0105243_10021111 | Ga0105243_100211113 | 313 |
| 555 | 3300009176 | Ga0105242_10003850 | Ga0105242_100038506 | 313 |
| 556 | 3300009177 | Ga0105248_10133730 | Ga0105248_101337302 | 313 |
| 557 | 3300011119 | Ga0105246_10087302 | Ga0105246_100873022 | 313 |
| 558 | 3300013296 | Ga0157374_10074917 | Ga0157374_100749173 | 313 |
| 559 | 3300013296 | Ga0157374_10199794 | Ga0157374_101997941 | 313 |
| 560 | 3300013296 | Ga0157374_10538577 | Ga0157374_105385771 | 313 |
| 561 | 3300013297 | Ga0157378_10225251 | Ga0157378_102252512 | 313 |
| 562 | 3300013306 | Ga0163162_10441658 | Ga0163162_104416582 | 313 |
| 563 | 3300013308 | Ga0157375_10056907 | Ga0157375_100569074 | 313 |
| 564 | 3300014325 | Ga0163163_10255438 | Ga0163163_102554381 | 313 |
| 565 | 3300014326 | Ga0157380_10624835 | Ga0157380_106248351 | 313 |
| 566 | 3300014969 | Ga0157376_10151113 | Ga0157376_101511131 | 313 |
| 567 | 3300014969 | Ga0157376_10206101 | Ga0157376_102061012 | 313 |
| 568 | 3300025315 | Ga0207697_10009842 | Ga0207697_100098424 | 313 |
| 569 | 3300025893 | Ga0207682_10000357 | Ga0207682_1000035718 | 313 |
| 570 | 3300025901 | Ga0207688_10011506 | Ga0207688_100115064 | 313 |
| 571 | 3300025907 | Ga0207645_10004168 | Ga0207645_100041683 | 313 |
| 572 | 3300025908 | Ga0207643_10048771 | Ga0207643_100487713 | 313 |
| 573 | 3300025910 | Ga0207684_10020818 | Ga0207684_100208183 | 313 |
| 574 | 3300025912 | Ga0207707_10121135 | Ga0207707_101211352 | 313 |
| 575 | 3300025918 | Ga0207662_10002375 | Ga0207662_100023756 | 313 |
| 576 | 3300025919 | Ga0207657_10127936 | Ga0207657_101279362 | 313 |
| 577 | 3300025922 | Ga0207646_10215205 | Ga0207646_102152051 | 313 |
| 578 | 3300025923 | Ga0207681_10435155 | Ga0207681_104351551 | 313 |
| 579 | 3300025925 | Ga0207650_10004207 | Ga0207650_100042073 | 313 |
| 580 | 3300025925 | Ga0207650_10117285 | Ga0207650_101172852 | 313 |
| 581 | 3300025926 | Ga0207659_10010536 | Ga0207659_100105363 | 313 |
| 582 | 3300025931 | Ga0207644_10018134 | Ga0207644_100181344 | 313 |
| 583 | 3300025937 | Ga0207669_10037446 | Ga0207669_100374462 | 313 |
| 584 | 3300025940 | Ga0207691_10148708 | Ga0207691_101487083 | 313 |
| 585 | 3300025941 | Ga0207711_10220645 | Ga0207711_102206452 | 313 |
| 586 | 3300025942 | Ga0207689_10104955 | Ga0207689_101049552 | 313 |
| 587 | 3300025944 | Ga0207661_10004804 | Ga0207661_100048045 | 313 |
| 588 | 3300025960 | Ga0207651_10099193 | Ga0207651_100991932 | 313 |
| 589 | 3300025960 | Ga0207651_10163784 | Ga0207651_101637841 | 313 |
| 590 | 3300025961 | Ga0207712_10081065 | Ga0207712_100810653 | 313 |
| 591 | 3300025972 | Ga0207668_10239559 | Ga0207668_102395592 | 313 |
| 592 | 3300025981 | Ga0207640_10006330 | Ga0207640_100063302 | 313 |
| 593 | 3300026023 | Ga0207677_10008476 | Ga0207677_100084765 | 313 |
| 594 | 3300026023 | Ga0207677_10290309 | Ga0207677_102903092 | 313 |
| 595 | 3300026035 | Ga0207703_10191819 | Ga0207703_101918192 | 313 |
| 596 | 3300026075 | Ga0207708_10015469 | Ga0207708_100154693 | 313 |
| 597 | 3300026089 | Ga0207648_10081090 | Ga0207648_100810904 | 313 |
| 598 | 3300026095 | Ga0207676_10009887 | Ga0207676_100098873 | 313 |
| 599 | 3300026095 | Ga0207676_10077278 | Ga0207676_100772783 | 313 |
| 600 | 3300026116 | Ga0207674_10029837 | Ga0207674_100298374 | 313 |
| 601 | 3300026118 | Ga0207675_100034340 | Ga0207675_1000343402 | 313 |
| 602 | 3300026121 | Ga0207683_10000838 | Ga0207683_1000083817 | 313 |
| 603 | 3300026121 | Ga0207683_10210851 | Ga0207683_102108512 | 313 |
| 604 | 3300026142 | Ga0207698_10103902 | Ga0207698_101039022 | 313 |
| 605 | 3300027907 | Ga0207428_10008952 | Ga0207428_100089523 | 313 |
| 606 | 3300027907 | Ga0207428_10028036 | Ga0207428_100280362 | 313 |
| 607 | 3300035691 | Ga0373931_0220396 | Ga0373931_0220396_32_1006 | 313 |
| 608 | 3300046683 | Ga0495658_0212791 | Ga0495658_0212791_207_1169 | 313 |
| 609 | 3300047471 | Ga0495684_0345303 | Ga0495684_0345303_40_1014 | 313 |
| 610 | 3300048907 | Ga0496104_0216286 | Ga0496104_0216286_256_1281 | 313 |
| 611 | 3300048911 | Ga0496108_0069581 | Ga0496108_0069581_1432_2457 | 313 |
| 612 | 3300048911 | Ga0496108_0279729 | Ga0496108_0279729_406_1371 | 313 |
| 613 | 3300048913 | Ga0496110_0022962 | Ga0496110_0022962_1129_2154 | 313 |
| 614 | 3300050507 | nmdc:mga05p37_96388_c1 | nmdc:mga05p37_96388_c1_293_1333 | 313 |
| 615 | 3300050508 | nmdc:mga09592_81116_c1 | nmdc:mga09592_81116_c1_726_1766 | 313 |
| 616 | 3300050511 | nmdc:mga08y16_14449_c1 | nmdc:mga08y16_14449_c1_6146_7186 | 313 |
| 617 | 3300050514 | nmdc:mga08x19_35077_c1 | nmdc:mga08x19_35077_c1_2076_3050 | 313 |
| 618 | iso_pu_bacteria | 2881101125 | 2881105363 | 313 |
| 619 | 3300005343 | Ga0070687_100189671 | Ga0070687_1001896712 | 314 |
| 620 | 3300005354 | Ga0070675_100062904 | Ga0070675_1000629042 | 314 |
| 621 | 3300005458 | Ga0070681_10063499 | Ga0070681_100634991 | 314 |
| 622 | 3300005471 | Ga0070698_100000120 | Ga0070698_10000012034 | 314 |
| 623 | 3300005544 | Ga0070686_100271527 | Ga0070686_1002715271 | 314 |
| 624 | 3300005617 | Ga0068859_100607429 | Ga0068859_1006074292 | 314 |
| 625 | 3300005937 | Ga0081455_10000164 | Ga0081455_100001648 | 314 |
| 626 | 3300005937 | Ga0081455_10001486 | Ga0081455_1000148616 | 314 |
| 627 | 3300005985 | Ga0081539_10007960 | Ga0081539_100079607 | 314 |
| 628 | 3300006038 | Ga0075365_10232852 | Ga0075365_102328522 | 314 |
| 629 | 3300006048 | Ga0075363_100029258 | Ga0075363_1000292583 | 314 |
| 630 | 3300006177 | Ga0075362_10011395 | Ga0075362_100113952 | 314 |
| 631 | 3300006178 | Ga0075367_10010209 | Ga0075367_100102094 | 314 |
| 632 | 3300006186 | Ga0075369_10065672 | Ga0075369_100656722 | 314 |
| 633 | 3300006195 | Ga0075366_10045257 | Ga0075366_100452572 | 314 |
| 634 | 3300006353 | Ga0075370_10096697 | Ga0075370_100966972 | 314 |
| 635 | 3300006844 | Ga0075428_100112140 | Ga0075428_1001121402 | 314 |
| 636 | 3300006846 | Ga0075430_100313143 | Ga0075430_1003131432 | 314 |
| 637 | 3300006931 | Ga0097620_100607488 | Ga0097620_1006074881 | 314 |
| 638 | 3300007265 | Ga0099794_10138818 | Ga0099794_101388181 | 314 |
| 639 | 3300009094 | Ga0111539_10011072 | Ga0111539_100110726 | 314 |
| 640 | 3300009094 | Ga0111539_10412471 | Ga0111539_104124712 | 314 |
| 641 | 3300025910 | Ga0207684_10064722 | Ga0207684_100647222 | 314 |
| 642 | 3300025926 | Ga0207659_10134348 | Ga0207659_101343482 | 314 |
| 643 | 3300026116 | Ga0207674_10498384 | Ga0207674_104983842 | 314 |
| 644 | 3300027907 | Ga0207428_10004110 | Ga0207428_100041105 | 314 |
| 645 | 3300028380 | Ga0268265_10202796 | Ga0268265_102027962 | 314 |
| 646 | 3300035691 | Ga0373931_0136655 | Ga0373931_0136655_208_1167 | 314 |
| 647 | 3300041413 | Ga0439465_0055117 | Ga0439465_0055117_116_1075 | 314 |
| 648 | 3300042115 | Ga0450911_008045 | Ga0450911_008045_191_1180 | 314 |
| 649 | 3300044842 | Ga0466957_0040678 | Ga0466957_0040678_1075_2061 | 314 |
| 650 | 3300049571 | Ga0501034_0000757 | Ga0501034_0000757_3417_4376 | 314 |
| 651 | 3300049586 | Ga0501070_0036662 | Ga0501070_0036662_413_1390 | 314 |
| 652 | 3300049590 | Ga0501074_0063465 | Ga0501074_0063465_422_1399 | 314 |
| 653 | 3300049824 | Ga0501045_0140929 | Ga0501045_0140929_594_1577 | 314 |
| 654 | 3300050489 | nmdc:mga03683_52895_c1 | nmdc:mga03683_52895_c1_455_1414 | 314 |
| 655 | 3300050492 | nmdc:mga0yw44_137659_c1 | nmdc:mga0yw44_137659_c1_341_1300 | 314 |
| 656 | 3300050494 | nmdc:mga06z11_52052_c1 | nmdc:mga06z11_52052_c1_717_1676 | 314 |
| 657 | 3300050507 | nmdc:mga05p37_365445_c1 | nmdc:mga05p37_365445_c1_12_977 | 314 |
| 658 | 3300050508 | nmdc:mga09592_16139_c1 | nmdc:mga09592_16139_c1_4145_5110 | 314 |
| 659 | 3300050511 | nmdc:mga08y16_23154_c1 | nmdc:mga08y16_23154_c1_3529_4494 | 314 |
| 660 | 3300053093 | Ga0500651_0201372 | Ga0500651_0201372_159_1118 | 314 |
| 661 | 3300053096 | Ga0500641_0002167 | Ga0500641_0002167_921_1883 | 314 |
| 662 | 3300053153 | Ga0500616_0001277 | Ga0500616_0001277_16887_17846 | 314 |
| 663 | 3300053733 | Ga0500552_000068 | Ga0500552_000068_1815_2774 | 314 |
| 664 | 3300005333 | Ga0070677_10015234 | Ga0070677_100152343 | 315 |
| 665 | 3300005335 | Ga0070666_10039114 | Ga0070666_100391145 | 315 |
| 666 | 3300005338 | Ga0068868_100108964 | Ga0068868_1001089642 | 315 |
| 667 | 3300005340 | Ga0070689_100360338 | Ga0070689_1003603381 | 315 |
| 668 | 3300005347 | Ga0070668_100218808 | Ga0070668_1002188082 | 315 |
| 669 | 3300005355 | Ga0070671_100052140 | Ga0070671_1000521403 | 315 |
| 670 | 3300005367 | Ga0070667_100300881 | Ga0070667_1003008811 | 315 |
| 671 | 3300005441 | Ga0070700_100078837 | Ga0070700_1000788372 | 315 |
| 672 | 3300005456 | Ga0070678_100313418 | Ga0070678_1003134182 | 315 |
| 673 | 3300005457 | Ga0070662_100089304 | Ga0070662_1000893042 | 315 |
| 674 | 3300005543 | Ga0070672_100040680 | Ga0070672_1000406804 | 315 |
| 675 | 3300005547 | Ga0070693_100252069 | Ga0070693_1002520691 | 315 |
| 676 | 3300005548 | Ga0070665_100059038 | Ga0070665_1000590381 | 315 |
| 677 | 3300005564 | Ga0070664_100337333 | Ga0070664_1003373331 | 315 |
| 678 | 3300005578 | Ga0068854_100048908 | Ga0068854_1000489082 | 315 |
| 679 | 3300005618 | Ga0068864_100085741 | Ga0068864_1000857412 | 315 |
| 680 | 3300005718 | Ga0068866_10174747 | Ga0068866_101747471 | 315 |
| 681 | 3300005719 | Ga0068861_100027261 | Ga0068861_1000272614 | 315 |
| 682 | 3300005840 | Ga0068870_10027623 | Ga0068870_100276233 | 315 |
| 683 | 3300005841 | Ga0068863_100101849 | Ga0068863_1001018492 | 315 |
| 684 | 3300005843 | Ga0068860_100229119 | Ga0068860_1002291192 | 315 |
| 685 | 3300005844 | Ga0068862_100077340 | Ga0068862_1000773402 | 315 |
| 686 | 3300006178 | Ga0075367_10027710 | Ga0075367_100277104 | 315 |
| 687 | 3300006186 | Ga0075369_10000327 | Ga0075369_1000032715 | 315 |
| 688 | 3300006237 | Ga0097621_100059196 | Ga0097621_1000591963 | 315 |
| 689 | 3300006353 | Ga0075370_10010206 | Ga0075370_100102064 | 315 |
| 690 | 3300006358 | Ga0068871_100031597 | Ga0068871_1000315974 | 315 |
| 691 | 3300006881 | Ga0068865_100037331 | Ga0068865_1000373312 | 315 |
| 692 | 3300009094 | Ga0111539_10209544 | Ga0111539_102095443 | 315 |
| 693 | 3300009177 | Ga0105248_10218854 | Ga0105248_102188542 | 315 |
| 694 | 3300009553 | Ga0105249_10129402 | Ga0105249_101294022 | 315 |
| 695 | 3300013308 | Ga0157375_10228828 | Ga0157375_102288282 | 315 |
| 696 | 3300014326 | Ga0157380_10257517 | Ga0157380_102575172 | 315 |
| 697 | 3300014969 | Ga0157376_10150259 | Ga0157376_101502592 | 315 |
| 698 | 3300025302 | Ga0207426_1025807 | Ga0207426_10258072 | 315 |
| 699 | 3300025315 | Ga0207697_10010166 | Ga0207697_100101662 | 315 |
| 700 | 3300025321 | Ga0207656_10059441 | Ga0207656_100594412 | 315 |
| 701 | 3300025893 | Ga0207682_10005572 | Ga0207682_100055722 | 315 |
| 702 | 3300025899 | Ga0207642_10017872 | Ga0207642_100178722 | 315 |
| 703 | 3300025907 | Ga0207645_10007892 | Ga0207645_100078921 | 315 |
| 704 | 3300025918 | Ga0207662_10025381 | Ga0207662_100253814 | 315 |
| 705 | 3300025927 | Ga0207687_10165451 | Ga0207687_101654512 | 315 |
| 706 | 3300025934 | Ga0207686_10018785 | Ga0207686_100187854 | 315 |
| 707 | 3300025945 | Ga0207679_10140576 | Ga0207679_101405761 | 315 |
| 708 | 3300025981 | Ga0207640_10014232 | Ga0207640_100142322 | 315 |
| 709 | 3300026075 | Ga0207708_10088231 | Ga0207708_100882312 | 315 |
| 710 | 3300026088 | Ga0207641_10077131 | Ga0207641_100771313 | 315 |
| 711 | 3300026089 | Ga0207648_10057495 | Ga0207648_100574954 | 315 |
| 712 | 3300026095 | Ga0207676_10001708 | Ga0207676_1000170814 | 315 |
| 713 | 3300026118 | Ga0207675_100390126 | Ga0207675_1003901262 | 315 |
| 714 | 3300026121 | Ga0207683_10000419 | Ga0207683_100004192 | 315 |
| 715 | 3300027360 | Ga0209969_1003060 | Ga0209969_10030602 | 315 |
| 716 | 3300027364 | Ga0209967_1015138 | Ga0209967_10151382 | 315 |
| 717 | 3300027471 | Ga0209995_1000757 | Ga0209995_10007575 | 315 |
| 718 | 3300027526 | Ga0209968_1005253 | Ga0209968_10052532 | 315 |
| 719 | 3300027543 | Ga0209999_1007031 | Ga0209999_10070313 | 315 |
| 720 | 3300027682 | Ga0209971_1016569 | Ga0209971_10165693 | 315 |
| 721 | 3300027876 | Ga0209974_10009049 | Ga0209974_100090493 | 315 |
| 722 | 3300028379 | Ga0268266_10168755 | Ga0268266_101687552 | 315 |
| 723 | 3300028381 | Ga0268264_10176359 | Ga0268264_101763594 | 315 |
| 724 | 3300031903 | Ga0307407_10186751 | Ga0307407_101867511 | 315 |
| 725 | 3300046528 | Ga0495642_0013141 | Ga0495642_0013141_1183_2175 | 315 |
| 726 | 3300046684 | Ga0495669_0018200 | Ga0495669_0018200_1066_2058 | 315 |
| 727 | 3300048912 | Ga0496109_0233233 | Ga0496109_0233233_77_1045 | 315 |
| 728 | 3300050494 | nmdc:mga06z11_4551_c1 | nmdc:mga06z11_4551_c1_1798_2760 | 315 |
| 729 | 3300050496 | nmdc:mga07m45_2091_c2 | nmdc:mga07m45_2091_c2_2042_3004 | 315 |
| 730 | 3300050516 | nmdc:mga0sz30_629_c1 | nmdc:mga0sz30_629_c1_8233_9195 | 315 |
| 731 | 3300003792 | Ga0055540_1000654 | Ga0055540_100065415 | 316 |
| 732 | 3300005328 | Ga0070676_10027201 | Ga0070676_100272013 | 316 |
| 733 | 3300005330 | Ga0070690_100020953 | Ga0070690_1000209531 | 316 |
| 734 | 3300005333 | Ga0070677_10007754 | Ga0070677_100077543 | 316 |
| 735 | 3300005334 | Ga0068869_100166393 | Ga0068869_1001663932 | 316 |
| 736 | 3300005335 | Ga0070666_10031393 | Ga0070666_100313932 | 316 |
| 737 | 3300005347 | Ga0070668_100027916 | Ga0070668_1000279162 | 316 |
| 738 | 3300005353 | Ga0070669_100095430 | Ga0070669_1000954302 | 316 |
| 739 | 3300005355 | Ga0070671_100030090 | Ga0070671_1000300901 | 316 |
| 740 | 3300005364 | Ga0070673_100024852 | Ga0070673_1000248523 | 316 |
| 741 | 3300005365 | Ga0070688_100012765 | Ga0070688_1000127654 | 316 |
| 742 | 3300005367 | Ga0070667_100304079 | Ga0070667_1003040791 | 316 |
| 743 | 3300005440 | Ga0070705_100115222 | Ga0070705_1001152222 | 316 |
| 744 | 3300005441 | Ga0070700_100011392 | Ga0070700_1000113922 | 316 |
| 745 | 3300005456 | Ga0070678_100010672 | Ga0070678_1000106723 | 316 |
| 746 | 3300005543 | Ga0070672_100057319 | Ga0070672_1000573192 | 316 |
| 747 | 3300005615 | Ga0070702_100013023 | Ga0070702_1000130232 | 316 |
| 748 | 3300005840 | Ga0068870_10026086 | Ga0068870_100260862 | 316 |
| 749 | 3300005841 | Ga0068863_100043608 | Ga0068863_1000436083 | 316 |
| 750 | 3300005843 | Ga0068860_100066252 | Ga0068860_1000662523 | 316 |
| 751 | 3300006237 | Ga0097621_100097369 | Ga0097621_1000973692 | 316 |
| 752 | 3300006881 | Ga0068865_100063041 | Ga0068865_1000630413 | 316 |
| 753 | 3300009094 | Ga0111539_10312331 | Ga0111539_103123312 | 316 |
| 754 | 3300017792 | Ga0163161_10060246 | Ga0163161_100602461 | 316 |
| 755 | 3300025284 | Ga0209130_1029636 | Ga0209130_10296361 | 316 |
| 756 | 3300025315 | Ga0207697_10016138 | Ga0207697_100161383 | 316 |
| 757 | 3300025893 | Ga0207682_10003947 | Ga0207682_100039476 | 316 |
| 758 | 3300025908 | Ga0207643_10010167 | Ga0207643_100101673 | 316 |
| 759 | 3300025925 | Ga0207650_10283183 | Ga0207650_102831832 | 316 |
| 760 | 3300025931 | Ga0207644_10322348 | Ga0207644_103223482 | 316 |
| 761 | 3300025933 | Ga0207706_10204627 | Ga0207706_102046272 | 316 |
| 762 | 3300025935 | Ga0207709_10156843 | Ga0207709_101568431 | 316 |
| 763 | 3300025936 | Ga0207670_10079597 | Ga0207670_100795972 | 316 |
| 764 | 3300025940 | Ga0207691_10256133 | Ga0207691_102561332 | 316 |
| 765 | 3300025942 | Ga0207689_10063485 | Ga0207689_100634851 | 316 |
| 766 | 3300026075 | Ga0207708_10068726 | Ga0207708_100687262 | 316 |
| 767 | 3300026088 | Ga0207641_10036559 | Ga0207641_100365593 | 316 |
| 768 | 3300026089 | Ga0207648_10029616 | Ga0207648_100296164 | 316 |
| 769 | 3300026095 | Ga0207676_10056986 | Ga0207676_100569862 | 316 |
| 770 | 3300026118 | Ga0207675_100079449 | Ga0207675_1000794493 | 316 |
| 771 | 3300026121 | Ga0207683_10009959 | Ga0207683_100099597 | 316 |
| 772 | 3300028381 | Ga0268264_10032681 | Ga0268264_100326813 | 316 |
| 773 | 3300037312 | Ga0395899_0160266 | Ga0395899_0160266_567_1541 | 316 |
| 774 | 3300037466 | Ga0395898_0043767 | Ga0395898_0043767_1211_2185 | 316 |
| 775 | 3300038443 | Ga0395901_0153886 | Ga0395901_0153886_813_1787 | 316 |
| 776 | 3300049823 | Ga0501044_0058415 | Ga0501044_0058415_2177_3151 | 316 |
| 777 | 3300050511 | nmdc:mga08y16_72372_c1 | nmdc:mga08y16_72372_c1_633_1598 | 316 |
| 778 | 3300031903 | Ga0307407_10095996 | Ga0307407_100959962 | 317 |
| 779 | 3300032005 | Ga0307411_10069604 | Ga0307411_100696042 | 317 |
| 780 | 3300048928 | Ga0496125_0023065 | Ga0496125_0023065_1895_2890 | 317 |
| 781 | 3300048929 | Ga0496126_0261173 | Ga0496126_0261173_42_1037 | 317 |
| 782 | iso_pu_bacteria | 2929199973 | 2929200058 | 317 |
| 783 | iso_pu_bacteria | 8055909800 | 8055915326 | 317 |
| 784 | 3300009094 | Ga0111539_10076202 | Ga0111539_100762023 | 318 |
| 785 | 3300009148 | Ga0105243_10058198 | Ga0105243_100581982 | 318 |
| 786 | 3300009176 | Ga0105242_10037532 | Ga0105242_100375323 | 318 |
| 787 | 3300013297 | Ga0157378_10083852 | Ga0157378_100838522 | 318 |
| 788 | 3300013306 | Ga0163162_10145969 | Ga0163162_101459691 | 318 |
| 789 | 3300025907 | Ga0207645_10003942 | Ga0207645_100039429 | 318 |
| 790 | 3300031548 | Ga0307408_100070885 | Ga0307408_1000708854 | 318 |
| 791 | 3300031731 | Ga0307405_10048627 | Ga0307405_100486272 | 318 |
| 792 | 3300032005 | Ga0307411_10343262 | Ga0307411_103432622 | 318 |
| 793 | 3300048924 | Ga0496121_0003189 | Ga0496121_0003189_3151_4170 | 318 |
| 794 | 3300049575 | Ga0501039_0047730 | Ga0501039_0047730_1622_2623 | 318 |
| 795 | 3300049582 | Ga0501048_0081578 | Ga0501048_0081578_405_1406 | 318 |
| 796 | 3300049584 | Ga0501068_0111011 | Ga0501068_0111011_574_1575 | 318 |
| 797 | 3300049587 | Ga0501071_0021374 | Ga0501071_0021374_1417_2418 | 318 |
| 798 | 3300049743 | Ga0501081_0013808 | Ga0501081_0013808_688_1689 | 318 |
| 799 | 3300049824 | Ga0501045_0108351 | Ga0501045_0108351_252_1253 | 318 |
| 800 | 3300050511 | nmdc:mga08y16_274053_c1 | nmdc:mga08y16_274053_c1_18_1010 | 318 |
| 801 | 3300060353 | Ga0501082_0366927 | Ga0501082_0366927_61_1062 | 318 |
| 802 | 3300061734 | Ga0530510_0061007 | Ga0530510_0061007_721_1722 | 318 |
| 803 | 3300049571 | Ga0501034_0366251 | Ga0501034_0366251_298_1305 | 319 |
| 804 | 3300048904 | Ga0496101_0053523 | Ga0496101_0053523_642_1652 | 320 |
| 805 | 3300003203 | JGI25406J46586_10000707 | JGI25406J46586_100007079 | 323 |
| 806 | 3300005985 | Ga0081539_10000054 | Ga0081539_10000054201 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9519 | 27 | 323 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9488 | 27 | 323 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9474 | 26 | 323 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9443 | 26 | 323 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.9328 | 30 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9501 | 125 | 248 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9429 | 125 | 248 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9425 | 125 | 248 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9357 | 125 | 248 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9286 | 125 | 248 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1YI10-F1-model_v4 | Tripartite-type tricarboxylate transporter receptor subunit TctC | 0.9755 | 92 | 323 |
|
| AF-A0A7H0GIP4-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9724 | 51 | 323 |
|
| AF-A0A536XT46-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9705 | 55 | 323 |
|
| AF-J2SVG2-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9696 | 53 | 323 |
|
| AF-A0A439F197-F1-model_v4 | deleted | 0.9681 | 80 | 323 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar