F481645

General Info

Members Datasets Scaffolds Average Seq Length
806 289 800 318

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10099193|Ga0207651_100991932
Length 350
Sequence VGLNPRNARCAAIKTRFIAPCHDEAVVMRYLFDCAAIAITLTASSTSTLAQTYPVKPLRIIAAQSAGGVTDMLARTLAQKFNESWKQPAVVENRPGAGGAIGTEVAAKSAPDGYTLLLSSAGPIVINQYLYPSLAYDPLRDLQPIAFIASSPLILVTHPSVPARSVRELIALARAKPDKLSYGSGGSGSPPHLTAELFKTTTGVRMVHVPYKGSAPSVLALVAGQVDLSFSTVVITLPQIKAGRLHALAVTSPKRSRVVPDLPTMEEAGVAGFESQQWFGLFAPAGLAQDIVSKIYAETTRVIQSPQIRDRLANEGGEPDTLTPDQFAAFIRRDAARWAKVVKDSGATAD

Samples

Sample ID Description Type Environment
1 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
2 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0
Rhizoplane 2.48
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000707 3300003203 Bacteria 15594
2 Ga0055540_1000654 3300003792 Bacteria 24325
3 Ga0065712_10135169 3300005290 Bacteria 1505
4 Ga0070676_10027201 3300005328 Bacteria 3242
5 Ga0070676_10055984 3300005328 Bacteria 2329
6 Ga0070683_100009923 3300005329 Bacteria 8162
7 Ga0070683_100013594 3300005329 Bacteria 7103
8 Ga0070690_100020953 3300005330 Bacteria 3988
9 Ga0070690_100074882 3300005330 Bacteria 2206
10 Ga0070690_100143099 3300005330 Bacteria 1625
11 Ga0070670_100000483 3300005331 Bacteria 31999
12 Ga0070670_100003991 3300005331 Bacteria 12315
13 Ga0070670_100005246 3300005331 Bacteria 10911
14 Ga0070670_100037537 3300005331 Bacteria 4168
15 Ga0070670_100185270 3300005331 Bacteria 1807
16 Ga0070677_10001359 3300005333 Bacteria 7813
17 Ga0070677_10004286 3300005333 Bacteria 4643
18 Ga0070677_10007754 3300005333 Unclassified 3594
19 Ga0070677_10015234 3300005333 Bacteria 2721
20 Ga0070677_10024668 3300005333 Bacteria 2238
21 Ga0068869_100034372 3300005334 Bacteria 3585
22 Ga0068869_100045460 3300005334 Bacteria 3161
23 Ga0068869_100102771 3300005334 Bacteria 2164
24 Ga0068869_100166393 3300005334 Unclassified 1720
25 Ga0068869_100173131 3300005334 Bacteria 1687
26 Ga0070666_10003778 3300005335 Bacteria 9180
27 Ga0070666_10017090 3300005335 Bacteria 4648
28 Ga0070666_10017096 3300005335 Bacteria 4646
29 Ga0070666_10018150 3300005335 Bacteria 4519
30 Ga0070666_10031393 3300005335 Unclassified 3507
31 Ga0070666_10039114 3300005335 Bacteria 3159
32 Ga0070680_100388808 3300005336 Bacteria 1188
33 Ga0068868_100000421 3300005338 Bacteria 28678
34 Ga0068868_100000544 3300005338 Bacteria 25315
35 Ga0068868_100006019 3300005338 Bacteria 8565
36 Ga0068868_100011660 3300005338 Bacteria 6404
37 Ga0068868_100025660 3300005338 Bacteria 4485
38 Ga0068868_100036427 3300005338 Bacteria 3808
39 Ga0068868_100108964 3300005338 Unclassified 2249
40 Ga0070660_100085657 3300005339 Unclassified 2479
41 Ga0070689_100031295 3300005340 Bacteria 4043
42 Ga0070689_100102376 3300005340 Bacteria 2268
43 Ga0070689_100265045 3300005340 Bacteria 1421
44 Ga0070689_100360338 3300005340 Bacteria 1222
45 Ga0070687_100053678 3300005343 Bacteria 2097
46 Ga0070687_100088813 3300005343 Bacteria 1705
47 Ga0070687_100189671 3300005343 Bacteria 1238
48 Ga0070661_100002938 3300005344 Bacteria 11761
49 Ga0070661_100011278 3300005344 Bacteria 6227
50 Ga0070692_10087247 3300005345 Bacteria 1690
51 Ga0070668_100027916 3300005347 Bacteria 4284
52 Ga0070668_100037336 3300005347 Bacteria 3709
53 Ga0070668_100193293 3300005347 Bacteria 1668
54 Ga0070668_100218808 3300005347 Bacteria 1570
55 Ga0070668_100304915 3300005347 Bacteria 1336
56 Ga0070669_100016792 3300005353 Bacteria 5224
57 Ga0070669_100084505 3300005353 Bacteria 2368
58 Ga0070669_100095430 3300005353 Unclassified 2236
59 Ga0070669_100182247 3300005353 Bacteria 1643
60 Ga0070675_100001594 3300005354 Bacteria 16751
61 Ga0070675_100005907 3300005354 Bacteria 9376
62 Ga0070675_100029057 3300005354 Bacteria 4455
63 Ga0070675_100036749 3300005354 Bacteria 3987
64 Ga0070675_100062904 3300005354 Bacteria 3067
65 Ga0070675_100135125 3300005354 Bacteria 2104
66 Ga0070675_100277660 3300005354 Bacteria 1471
67 Ga0070675_100333367 3300005354 Bacteria 1342
68 Ga0070671_100010384 3300005355 Bacteria 7469
69 Ga0070671_100012134 3300005355 Bacteria 6934
70 Ga0070671_100013744 3300005355 Bacteria 6530
71 Ga0070671_100026402 3300005355 Bacteria 4772
72 Ga0070671_100030090 3300005355 Unclassified 4480
73 Ga0070671_100052140 3300005355 Bacteria 3402
74 Ga0070671_100056542 3300005355 Bacteria 3264
75 Ga0070674_100017437 3300005356 Bacteria 4518
76 Ga0070674_100020518 3300005356 Bacteria 4225
77 Ga0070674_100021230 3300005356 Bacteria 4164
78 Ga0070674_100081161 3300005356 Bacteria 2317
79 Ga0070673_100006483 3300005364 Bacteria 7609
80 Ga0070673_100008587 3300005364 Bacteria 6802
81 Ga0070673_100010295 3300005364 Bacteria 6326
82 Ga0070673_100024852 3300005364 Bacteria 4398
83 Ga0070673_100046006 3300005364 Bacteria 3387
84 Ga0070673_100129300 3300005364 Unclassified 2117
85 Ga0070673_100181856 3300005364 Bacteria 1800
86 Ga0070688_100012765 3300005365 Bacteria 4717
87 Ga0070688_100044115 3300005365 Bacteria 2751
88 Ga0070688_100100052 3300005365 Bacteria 1910
89 Ga0070667_100001848 3300005367 Bacteria 18822
90 Ga0070667_100067791 3300005367 Bacteria 3035
91 Ga0070667_100073068 3300005367 Bacteria 2924
92 Ga0070667_100085974 3300005367 Bacteria 2698
93 Ga0070667_100209236 3300005367 Bacteria 1733
94 Ga0070667_100300881 3300005367 Unclassified 1444
95 Ga0070667_100304079 3300005367 Unclassified 1436
96 Ga0070714_100022417 3300005435 Bacteria 5179
97 Ga0070701_10038810 3300005438 Bacteria 2412
98 Ga0070701_10100119 3300005438 Bacteria 1604
99 Ga0070705_100026095 3300005440 Bacteria 3177
100 Ga0070705_100115222 3300005440 Unclassified 1725
101 Ga0070700_100011392 3300005441 Unclassified 4925
102 Ga0070700_100018163 3300005441 Bacteria 4038
103 Ga0070700_100026460 3300005441 Bacteria 3426
104 Ga0070700_100078837 3300005441 Bacteria 2121
105 Ga0070694_100094041 3300005444 Unclassified 2108
106 Ga0070694_100179028 3300005444 Unclassified 1567
107 Ga0070678_100000281 3300005456 Bacteria 23641
108 Ga0070678_100000701 3300005456 Bacteria 16588
109 Ga0070678_100002597 3300005456 Bacteria 9929
110 Ga0070678_100003716 3300005456 Bacteria 8541
111 Ga0070678_100003940 3300005456 Bacteria 8341
112 Ga0070678_100010672 3300005456 Bacteria 5625
113 Ga0070678_100022358 3300005456 Bacteria 4189
114 Ga0070678_100056346 3300005456 Bacteria 2874
115 Ga0070678_100059588 3300005456 Bacteria 2806
116 Ga0070678_100079281 3300005456 Bacteria 2483
117 Ga0070678_100172825 3300005456 Bacteria 1761
118 Ga0070678_100243805 3300005456 Bacteria 1504
119 Ga0070678_100313418 3300005456 Unclassified 1337
120 Ga0070662_100031021 3300005457 Bacteria 3747
121 Ga0070662_100069338 3300005457 Bacteria 2594
122 Ga0070662_100089304 3300005457 Bacteria 2311
123 Ga0070662_100333670 3300005457 Bacteria 1239
124 Ga0070681_10007773 3300005458 Bacteria 10481
125 Ga0070681_10012078 3300005458 Bacteria 8564
126 Ga0070681_10036424 3300005458 Bacteria 4940
127 Ga0070681_10044687 3300005458 Unclassified 4434
128 Ga0070681_10055432 3300005458 Bacteria 3946
129 Ga0070681_10063499 3300005458 Bacteria 3665
130 Ga0070681_10133033 3300005458 Bacteria 2419
131 Ga0068867_100008650 3300005459 Bacteria 7189
132 Ga0068867_100009787 3300005459 Bacteria 6756
133 Ga0068867_100011002 3300005459 Bacteria 6379
134 Ga0068867_100015279 3300005459 Bacteria 5442
135 Ga0068867_100137478 3300005459 Bacteria 1906
136 Ga0068867_100279118 3300005459 Bacteria 1369
137 Ga0070685_10052239 3300005466 Bacteria 2365
138 Ga0070706_100007041 3300005467 Bacteria 10604
139 Ga0070706_100023816 3300005467 Bacteria 5637
140 Ga0070706_100060112 3300005467 Bacteria 3507
141 Ga0070706_100086903 3300005467 Unclassified 2898
142 Ga0070706_100109456 3300005467 Bacteria 2571
143 Ga0070706_100340103 3300005467 Bacteria 1399
144 Ga0070707_100013180 3300005468 Bacteria 7729
145 Ga0070707_100017332 3300005468 Bacteria 6771
146 Ga0070707_100092583 3300005468 Bacteria 2927
147 Ga0070698_100000120 3300005471 Bacteria 67569
148 Ga0070679_100042295 3300005530 Bacteria 4537
149 Ga0070684_100198522 3300005535 Unclassified 1827
150 Ga0070697_100013262 3300005536 Bacteria 6463
151 Ga0070697_100043501 3300005536 Bacteria 3637
152 Ga0070697_100173121 3300005536 Bacteria 1828
153 Ga0070697_100224505 3300005536 Bacteria 1601
154 Ga0068853_100093077 3300005539 Bacteria 2653
155 Ga0070672_100000856 3300005543 Bacteria 18175
156 Ga0070672_100001056 3300005543 Bacteria 16805
157 Ga0070672_100031926 3300005543 Bacteria 3970
158 Ga0070672_100040680 3300005543 Bacteria 3568
159 Ga0070672_100057319 3300005543 Bacteria 3057
160 Ga0070672_100088638 3300005543 Unclassified 2491
161 Ga0070672_100127568 3300005543 Bacteria 2088
162 Ga0070686_100067046 3300005544 Bacteria 2336
163 Ga0070686_100171091 3300005544 Bacteria 1536
164 Ga0070686_100271527 3300005544 Bacteria 1247
165 Ga0070695_100008105 3300005545 Bacteria 6225
166 Ga0070695_100069972 3300005545 Bacteria 2294
167 Ga0070695_100178905 3300005545 Bacteria 1501
168 Ga0070695_100191469 3300005545 Bacteria 1456
169 Ga0070696_100025217 3300005546 Bacteria 4041
170 Ga0070696_100129137 3300005546 Bacteria 1837
171 Ga0070693_100040794 3300005547 Bacteria 2608
172 Ga0070693_100252069 3300005547 Unclassified 1170
173 Ga0070665_100002513 3300005548 Bacteria 20153
174 Ga0070665_100059038 3300005548 Bacteria 3845
175 Ga0070665_100263154 3300005548 Bacteria 1726
176 Ga0070704_100059510 3300005549 Unclassified 2726
177 Ga0070704_100195752 3300005549 Unclassified 1628
178 Ga0070664_100000329 3300005564 Bacteria 34409
179 Ga0070664_100089901 3300005564 Bacteria 2657
180 Ga0070664_100092960 3300005564 Bacteria 2613
181 Ga0070664_100189974 3300005564 Bacteria 1830
182 Ga0070664_100337333 3300005564 Bacteria 1369
183 Ga0070664_100369932 3300005564 Bacteria 1306
184 Ga0068854_100004773 3300005578 Bacteria 8546
185 Ga0068854_100011066 3300005578 Bacteria 5856
186 Ga0068854_100048908 3300005578 Bacteria 3019
187 Ga0068854_100398249 3300005578 Bacteria 1139
188 Ga0070702_100013023 3300005615 Bacteria 4188
189 Ga0070702_100038175 3300005615 Bacteria 2672
190 Ga0070702_100073639 3300005615 Bacteria 2024
191 Ga0070702_100128147 3300005615 Bacteria 1599
192 Ga0068852_100000200 3300005616 Bacteria 40742
193 Ga0068852_100010934 3300005616 Bacteria 6802
194 Ga0068852_100058250 3300005616 Unclassified 3345
195 Ga0068859_100072696 3300005617 Bacteria 3476
196 Ga0068859_100398820 3300005617 Bacteria 1471
197 Ga0068859_100607429 3300005617 Bacteria 1187
198 Ga0068864_100005962 3300005618 Bacteria 9999
199 Ga0068864_100032913 3300005618 Bacteria 4406
200 Ga0068864_100051979 3300005618 Bacteria 3531
201 Ga0068864_100085741 3300005618 Bacteria 2769
202 Ga0068864_100093333 3300005618 Bacteria 2658
203 Ga0068866_10023077 3300005718 Unclassified 2889
204 Ga0068866_10028078 3300005718 Bacteria 2678
205 Ga0068866_10084268 3300005718 Bacteria 1715
206 Ga0068866_10174747 3300005718 Bacteria 1264
207 Ga0068861_100027261 3300005719 Bacteria 4159
208 Ga0068861_100049628 3300005719 Bacteria 3178
209 Ga0068861_100186214 3300005719 Bacteria 1731
210 Ga0068851_10120327 3300005834 Bacteria 1410
211 Ga0068870_10026086 3300005840 Unclassified 2909
212 Ga0068870_10027623 3300005840 Bacteria 2840
213 Ga0068870_10045907 3300005840 Bacteria 2289
214 Ga0068870_10162374 3300005840 Bacteria 1326
215 Ga0068863_100043608 3300005841 Unclassified 4257
216 Ga0068863_100101849 3300005841 Bacteria 2730
217 Ga0068863_100143398 3300005841 Bacteria 2284
218 Ga0068863_100153418 3300005841 Bacteria 2204
219 Ga0068858_100014277 3300005842 Bacteria 7489
220 Ga0068858_100059116 3300005842 Bacteria 3543
221 Ga0068858_100186819 3300005842 Bacteria 1957
222 Ga0068860_100060532 3300005843 Bacteria 3598
223 Ga0068860_100066252 3300005843 Unclassified 3430
224 Ga0068860_100121034 3300005843 Bacteria 2506
225 Ga0068860_100128216 3300005843 Bacteria 2433
226 Ga0068860_100229119 3300005843 Bacteria 1805
227 Ga0068862_100073405 3300005844 Bacteria 2956
228 Ga0068862_100077340 3300005844 Bacteria 2881
229 Ga0068862_100109561 3300005844 Bacteria 2422
230 Ga0068862_100189171 3300005844 Unclassified 1851
231 Ga0068862_100256979 3300005844 Bacteria 1593
232 Ga0081455_10000164 3300005937 Bacteria 81995
233 Ga0081455_10001486 3300005937 Bacteria 29017
234 Ga0081539_10000054 3300005985 Bacteria 259053
235 Ga0081539_10001828 3300005985 Bacteria 33585
236 Ga0081539_10007960 3300005985 Bacteria 9425
237 Ga0075365_10232852 3300006038 Bacteria 1293
238 Ga0075363_100029258 3300006048 Bacteria 2842
239 Ga0070715_10095912 3300006163 Bacteria 1374
240 Ga0070716_100001401 3300006173 Bacteria 10690
241 Ga0075362_10011395 3300006177 Bacteria 3501
242 Ga0075367_10010209 3300006178 Bacteria 4925
243 Ga0075367_10027710 3300006178 Bacteria 3225
244 Ga0075369_10000327 3300006186 Bacteria 14203
245 Ga0075369_10065672 3300006186 Bacteria 1591
246 Ga0075366_10045257 3300006195 Bacteria 2608
247 Ga0097621_100004924 3300006237 Bacteria 9368
248 Ga0097621_100008507 3300006237 Bacteria 7389
249 Ga0097621_100039222 3300006237 Bacteria 3803
250 Ga0097621_100059196 3300006237 Bacteria 3135
251 Ga0097621_100068795 3300006237 Bacteria 2921
252 Ga0097621_100071128 3300006237 Bacteria 2874
253 Ga0097621_100097369 3300006237 Bacteria 2470
254 Ga0097621_100210972 3300006237 Bacteria 1690
255 Ga0075370_10010206 3300006353 Bacteria 4899
256 Ga0075370_10096697 3300006353 Bacteria 1707
257 Ga0068871_100000437 3300006358 Bacteria 28701
258 Ga0068871_100000447 3300006358 Bacteria 28376
259 Ga0068871_100010311 3300006358 Bacteria 6813
260 Ga0068871_100010723 3300006358 Bacteria 6701
261 Ga0068871_100012469 3300006358 Bacteria 6268
262 Ga0068871_100031597 3300006358 Bacteria 4176
263 Ga0075428_100002635 3300006844 Bacteria 19521
264 Ga0075428_100006285 3300006844 Bacteria 13204
265 Ga0075428_100012504 3300006844 Bacteria 9440
266 Ga0075428_100112140 3300006844 Bacteria 2970
267 Ga0075428_100139966 3300006844 Bacteria 2631
268 Ga0075430_100051035 3300006846 Bacteria 3487
269 Ga0075430_100229313 3300006846 Bacteria 1540
270 Ga0075430_100313143 3300006846 Bacteria 1298
271 Ga0075431_100001415 3300006847 Bacteria 22040
272 Ga0075431_100007754 3300006847 Bacteria 10692
273 Ga0075431_100025203 3300006847 Bacteria 6097
274 Ga0075433_10107914 3300006852 Bacteria 2469
275 Ga0075434_100096576 3300006871 Bacteria 2960
276 Ga0075434_100327861 3300006871 Bacteria 1551
277 Ga0075429_100005895 3300006880 Bacteria 10576
278 Ga0075429_100026726 3300006880 Bacteria 5011
279 Ga0075429_100028009 3300006880 Bacteria 4890
280 Ga0075429_100029527 3300006880 Bacteria 4762
281 Ga0075429_100041179 3300006880 Bacteria 4023
282 Ga0068865_100037331 3300006881 Unclassified 3279
283 Ga0068865_100063041 3300006881 Bacteria 2604
284 Ga0068865_100071529 3300006881 Bacteria 2461
285 Ga0075436_100020610 3300006914 Bacteria 4524
286 Ga0075436_100029510 3300006914 Bacteria 3772
287 Ga0097620_100072698 3300006931 Bacteria 3476
288 Ga0097620_100398850 3300006931 Bacteria 1471
289 Ga0097620_100607488 3300006931 Bacteria 1187
290 Ga0075435_100006662 3300007076 Bacteria 8187
291 Ga0075435_100122597 3300007076 Bacteria 2170
292 Ga0075435_100140791 3300007076 Bacteria 2024
293 Ga0075435_100317543 3300007076 Bacteria 1333
294 Ga0099794_10022778 3300007265 Bacteria 2858
295 Ga0099794_10022852 3300007265 Bacteria 2855
296 Ga0099794_10025794 3300007265 Bacteria 2711
297 Ga0099794_10053843 3300007265 Bacteria 1941
298 Ga0099794_10138818 3300007265 Bacteria 1230
299 Ga0099795_10025500 3300007788 Bacteria 1983
300 Ga0111539_10001180 3300009094 Bacteria 34688
301 Ga0111539_10002096 3300009094 Bacteria 26642
302 Ga0111539_10011072 3300009094 Bacteria 11348
303 Ga0111539_10017884 3300009094 Bacteria 8779
304 Ga0111539_10030251 3300009094 Bacteria 6585
305 Ga0111539_10035779 3300009094 Bacteria 6011
306 Ga0111539_10045031 3300009094 Bacteria 5283
307 Ga0111539_10061458 3300009094 Bacteria 4450
308 Ga0111539_10076202 3300009094 Bacteria 3949
309 Ga0111539_10209544 3300009094 Bacteria 2271
310 Ga0111539_10237065 3300009094 Bacteria 2124
311 Ga0111539_10312331 3300009094 Bacteria 1829
312 Ga0111539_10374209 3300009094 Unclassified 1658
313 Ga0111539_10412471 3300009094 Bacteria 1573
314 Ga0105245_10026682 3300009098 Bacteria 5086
315 Ga0105245_10052676 3300009098 Bacteria 3650
316 Ga0105245_10476048 3300009098 Bacteria 1261
317 Ga0105245_10493467 3300009098 Bacteria 1239
318 Ga0105247_10198235 3300009101 Bacteria 1347
319 Ga0114129_10019617 3300009147 Bacteria 9625
320 Ga0114129_10133238 3300009147 Bacteria 3412
321 Ga0114129_10493654 3300009147 Bacteria 1600
322 Ga0105243_10021111 3300009148 Bacteria 4942
323 Ga0105243_10042758 3300009148 Bacteria 3548
324 Ga0105243_10058198 3300009148 Unclassified 3079
325 Ga0105243_10059257 3300009148 Bacteria 3055
326 Ga0105243_10093022 3300009148 Bacteria 2487
327 Ga0105243_10431390 3300009148 Bacteria 1232
328 Ga0105242_10003850 3300009176 Bacteria 11669
329 Ga0105242_10004388 3300009176 Bacteria 10975
330 Ga0105242_10037532 3300009176 Unclassified 3892
331 Ga0105242_10112289 3300009176 Bacteria 2325
332 Ga0105242_10113883 3300009176 Bacteria 2310
333 Ga0105242_10182831 3300009176 Bacteria 1851
334 Ga0105248_10068598 3300009177 Bacteria 3981
335 Ga0105248_10133730 3300009177 Bacteria 2798
336 Ga0105248_10218854 3300009177 Bacteria 2144
337 Ga0105238_10117235 3300009551 Bacteria 2643
338 Ga0105249_10035327 3300009553 Bacteria 4533
339 Ga0105249_10072198 3300009553 Bacteria 3190
340 Ga0105249_10129402 3300009553 Bacteria 2408
341 Ga0105249_10133150 3300009553 Bacteria 2375
342 Ga0105246_10087302 3300011119 Bacteria 2238
343 Ga0105246_10331506 3300011119 Bacteria 1240
344 Ga0157374_10000653 3300013296 Bacteria 30599
345 Ga0157374_10020612 3300013296 Bacteria 5854
346 Ga0157374_10074917 3300013296 Unclassified 3198
347 Ga0157374_10140639 3300013296 Bacteria 2343
348 Ga0157374_10199794 3300013296 Bacteria 1957
349 Ga0157374_10391766 3300013296 Bacteria 1385
350 Ga0157374_10538577 3300013296 Unclassified 1175
351 Ga0157378_10011956 3300013297 Bacteria 7601
352 Ga0157378_10018221 3300013297 Bacteria 6163
353 Ga0157378_10033333 3300013297 Bacteria 4552
354 Ga0157378_10058465 3300013297 Bacteria 3439
355 Ga0157378_10083852 3300013297 Bacteria 2885
356 Ga0157378_10161624 3300013297 Bacteria 2095
357 Ga0157378_10222622 3300013297 Bacteria 1794
358 Ga0157378_10225251 3300013297 Bacteria 1784
359 Ga0163162_10015389 3300013306 Bacteria 7473
360 Ga0163162_10015710 3300013306 Bacteria 7397
361 Ga0163162_10047449 3300013306 Bacteria 4305
362 Ga0163162_10145969 3300013306 Unclassified 2482
363 Ga0163162_10222961 3300013306 Bacteria 2015
364 Ga0163162_10441658 3300013306 Unclassified 1433
365 Ga0157375_10000621 3300013308 Bacteria 31483
366 Ga0157375_10002228 3300013308 Bacteria 16782
367 Ga0157375_10056907 3300013308 Bacteria 3863
368 Ga0157375_10143108 3300013308 Bacteria 2520
369 Ga0157375_10228828 3300013308 Bacteria 2018
370 Ga0157375_10432767 3300013308 Bacteria 1481
371 Ga0163163_10036631 3300014325 Bacteria 4767
372 Ga0163163_10255438 3300014325 Unclassified 1803
373 Ga0157380_10044574 3300014326 Bacteria 3477
374 Ga0157380_10257517 3300014326 Bacteria 1583
375 Ga0157380_10624835 3300014326 Bacteria 1070
376 Ga0157379_10019658 3300014968 Bacteria 5967
377 Ga0157379_10113279 3300014968 Bacteria 2438
378 Ga0157376_10006789 3300014969 Bacteria 8104
379 Ga0157376_10031688 3300014969 Bacteria 4237
380 Ga0157376_10150259 3300014969 Bacteria 2100
381 Ga0157376_10151113 3300014969 Unclassified 2094
382 Ga0157376_10206101 3300014969 Bacteria 1812
383 Ga0157376_10357802 3300014969 Bacteria 1399
384 Ga0157376_10451998 3300014969 Bacteria 1253
385 Ga0157376_10688514 3300014969 Bacteria 1026
386 Ga0163161_10010635 3300017792 Bacteria 6372
387 Ga0163161_10029881 3300017792 Bacteria 3874
388 Ga0163161_10060246 3300017792 Bacteria 2762
389 Ga0163161_10326356 3300017792 Bacteria 1214
390 Ga0209130_1029636 3300025284 Bacteria 1138
391 Ga0207426_1025807 3300025302 Bacteria 1975
392 Ga0207697_10009842 3300025315 Bacteria 4110
393 Ga0207697_10010166 3300025315 Bacteria 4034
394 Ga0207697_10016138 3300025315 Unclassified 3080
395 Ga0207656_10059441 3300025321 Unclassified 1673
396 Ga0207656_10090936 3300025321 Bacteria 1385
397 Ga0207682_10000357 3300025893 Bacteria 20976
398 Ga0207682_10001994 3300025893 Bacteria 9238
399 Ga0207682_10002135 3300025893 Bacteria 8970
400 Ga0207682_10003947 3300025893 Bacteria 6321
401 Ga0207682_10005572 3300025893 Bacteria 5120
402 Ga0207682_10005871 3300025893 Bacteria 4977
403 Ga0207642_10013949 3300025899 Bacteria 2948
404 Ga0207642_10017872 3300025899 Bacteria 2708
405 Ga0207642_10034423 3300025899 Bacteria 2154
406 Ga0207642_10059380 3300025899 Bacteria 1768
407 Ga0207688_10007041 3300025901 Bacteria 6116
408 Ga0207688_10011506 3300025901 Bacteria 4816
409 Ga0207688_10091329 3300025901 Bacteria 1749
410 Ga0207688_10236022 3300025901 Bacteria 1105
411 Ga0207680_10003125 3300025903 Bacteria 7779
412 Ga0207680_10039735 3300025903 Bacteria 2732
413 Ga0207680_10230901 3300025903 Bacteria 1272
414 Ga0207685_10118635 3300025905 Bacteria 1158
415 Ga0207645_10003942 3300025907 Bacteria 11082
416 Ga0207645_10004168 3300025907 Bacteria 10735
417 Ga0207645_10006895 3300025907 Bacteria 8102
418 Ga0207645_10007892 3300025907 Bacteria 7483
419 Ga0207645_10030250 3300025907 Bacteria 3489
420 Ga0207645_10048125 3300025907 Bacteria 2722
421 Ga0207645_10118801 3300025907 Bacteria 1715
422 Ga0207643_10005914 3300025908 Bacteria 6535
423 Ga0207643_10010167 3300025908 Bacteria 5059
424 Ga0207643_10048771 3300025908 Bacteria 2399
425 Ga0207643_10057136 3300025908 Bacteria 2221
426 Ga0207684_10020818 3300025910 Bacteria 5603
427 Ga0207684_10064722 3300025910 Bacteria 3104
428 Ga0207684_10122878 3300025910 Bacteria 2226
429 Ga0207684_10223392 3300025910 Bacteria 1625
430 Ga0207707_10019952 3300025912 Bacteria 5850
431 Ga0207707_10033160 3300025912 Bacteria 4519
432 Ga0207707_10072705 3300025912 Bacteria 2997
433 Ga0207707_10088495 3300025912 Unclassified 2705
434 Ga0207707_10120268 3300025912 Bacteria 2296
435 Ga0207707_10121135 3300025912 Bacteria 2287
436 Ga0207662_10002375 3300025918 Bacteria 9429
437 Ga0207662_10025381 3300025918 Bacteria 3413
438 Ga0207662_10069334 3300025918 Bacteria 2130
439 Ga0207657_10127936 3300025919 Unclassified 2084
440 Ga0207652_10069494 3300025921 Bacteria 3057
441 Ga0207652_10353694 3300025921 Bacteria 1326
442 Ga0207652_10362936 3300025921 Bacteria 1307
443 Ga0207646_10106785 3300025922 Bacteria 2511
444 Ga0207646_10215205 3300025922 Bacteria 1735
445 Ga0207681_10040677 3300025923 Bacteria 3095
446 Ga0207681_10435155 3300025923 Bacteria 1065
447 Ga0207650_10001197 3300025925 Bacteria 19048
448 Ga0207650_10003351 3300025925 Bacteria 11021
449 Ga0207650_10004207 3300025925 Bacteria 9836
450 Ga0207650_10043667 3300025925 Bacteria 3291
451 Ga0207650_10117285 3300025925 Bacteria 2068
452 Ga0207650_10283183 3300025925 Unclassified 1350
453 Ga0207659_10000560 3300025926 Bacteria 22349
454 Ga0207659_10010536 3300025926 Bacteria 5811
455 Ga0207659_10013837 3300025926 Bacteria 5184
456 Ga0207659_10018737 3300025926 Bacteria 4542
457 Ga0207659_10134348 3300025926 Bacteria 1913
458 Ga0207687_10060985 3300025927 Bacteria 2662
459 Ga0207687_10165451 3300025927 Unclassified 1701
460 Ga0207644_10000669 3300025931 Bacteria 21644
461 Ga0207644_10003503 3300025931 Bacteria 10157
462 Ga0207644_10018134 3300025931 Bacteria 4759
463 Ga0207644_10090564 3300025931 Bacteria 2279
464 Ga0207644_10322348 3300025931 Unclassified 1249
465 Ga0207706_10012515 3300025933 Bacteria 7729
466 Ga0207706_10040534 3300025933 Bacteria 4127
467 Ga0207706_10204627 3300025933 Unclassified 1731
468 Ga0207706_10403831 3300025933 Bacteria 1184
469 Ga0207686_10018785 3300025934 Bacteria 3919
470 Ga0207686_10035958 3300025934 Bacteria 2977
471 Ga0207686_10062766 3300025934 Bacteria 2360
472 Ga0207709_10156843 3300025935 Unclassified 1583
473 Ga0207670_10005745 3300025936 Bacteria 6844
474 Ga0207670_10079597 3300025936 Unclassified 2288
475 Ga0207670_10173335 3300025936 Bacteria 1619
476 Ga0207669_10037446 3300025937 Unclassified 2783
477 Ga0207669_10045357 3300025937 Bacteria 2589
478 Ga0207704_10018258 3300025938 Bacteria 3658
479 Ga0207704_10021683 3300025938 Bacteria 3426
480 Ga0207665_10003318 3300025939 Bacteria 10779
481 Ga0207691_10000470 3300025940 Bacteria 39893
482 Ga0207691_10001135 3300025940 Bacteria 26436
483 Ga0207691_10003996 3300025940 Bacteria 14303
484 Ga0207691_10014920 3300025940 Bacteria 7404
485 Ga0207691_10109654 3300025940 Bacteria 2456
486 Ga0207691_10148708 3300025940 Bacteria 2060
487 Ga0207691_10244947 3300025940 Bacteria 1549
488 Ga0207691_10256133 3300025940 Unclassified 1509
489 Ga0207711_10220645 3300025941 Unclassified 1734
490 Ga0207689_10006278 3300025942 Bacteria 10531
491 Ga0207689_10016087 3300025942 Bacteria 6331
492 Ga0207689_10022167 3300025942 Bacteria 5341
493 Ga0207689_10034477 3300025942 Bacteria 4204
494 Ga0207689_10063485 3300025942 Bacteria 3039
495 Ga0207689_10104955 3300025942 Bacteria 2322
496 Ga0207689_10108625 3300025942 Bacteria 2280
497 Ga0207661_10002744 3300025944 Bacteria 12121
498 Ga0207661_10004804 3300025944 Bacteria 9460
499 Ga0207661_10100171 3300025944 Bacteria 2431
500 Ga0207679_10015095 3300025945 Bacteria 5094
501 Ga0207679_10140576 3300025945 Bacteria 1951
502 Ga0207679_10310384 3300025945 Bacteria 1362
503 Ga0207651_10005066 3300025960 Bacteria 6721
504 Ga0207651_10023286 3300025960 Bacteria 3806
505 Ga0207651_10029360 3300025960 Bacteria 3483
506 Ga0207651_10099193 3300025960 Bacteria 2156
507 Ga0207651_10150097 3300025960 Bacteria 1813
508 Ga0207651_10163784 3300025960 Unclassified 1746
509 Ga0207712_10081065 3300025961 Bacteria 2362
510 Ga0207712_10100181 3300025961 Bacteria 2152
511 Ga0207668_10239559 3300025972 Bacteria 1467
512 Ga0207668_10318300 3300025972 Bacteria 1290
513 Ga0207640_10006330 3300025981 Bacteria 6493
514 Ga0207640_10014232 3300025981 Unclassified 4575
515 Ga0207640_10030183 3300025981 Bacteria 3336
516 Ga0207640_10126403 3300025981 Bacteria 1841
517 Ga0207658_10014281 3300025986 Bacteria 5438
518 Ga0207658_10031982 3300025986 Bacteria 3741
519 Ga0207658_10101518 3300025986 Bacteria 2254
520 Ga0207677_10001517 3300026023 Bacteria 12270
521 Ga0207677_10008476 3300026023 Bacteria 5747
522 Ga0207677_10155305 3300026023 Bacteria 1771
523 Ga0207677_10234361 3300026023 Bacteria 1481
524 Ga0207677_10290309 3300026023 Bacteria 1347
525 Ga0207703_10128534 3300026035 Bacteria 2185
526 Ga0207703_10161203 3300026035 Bacteria 1964
527 Ga0207703_10191819 3300026035 Bacteria 1810
528 Ga0207703_10217135 3300026035 Bacteria 1708
529 Ga0207639_10067006 3300026041 Bacteria 2793
530 Ga0207708_10014517 3300026075 Bacteria 5895
531 Ga0207708_10015469 3300026075 Bacteria 5722
532 Ga0207708_10032394 3300026075 Bacteria 3970
533 Ga0207708_10068726 3300026075 Unclassified 2711
534 Ga0207708_10088231 3300026075 Bacteria 2389
535 Ga0207708_10103459 3300026075 Bacteria 2206
536 Ga0207708_10336285 3300026075 Bacteria 1235
537 Ga0207641_10036559 3300026088 Unclassified 4100
538 Ga0207641_10037194 3300026088 Bacteria 4064
539 Ga0207641_10077131 3300026088 Unclassified 2883
540 Ga0207648_10000663 3300026089 Bacteria 38545
541 Ga0207648_10003622 3300026089 Bacteria 16152
542 Ga0207648_10012278 3300026089 Bacteria 8020
543 Ga0207648_10019268 3300026089 Bacteria 6159
544 Ga0207648_10029616 3300026089 Unclassified 4854
545 Ga0207648_10051455 3300026089 Bacteria 3600
546 Ga0207648_10057495 3300026089 Unclassified 3393
547 Ga0207648_10081090 3300026089 Bacteria 2830
548 Ga0207676_10001530 3300026095 Bacteria 17068
549 Ga0207676_10001708 3300026095 Bacteria 16184
550 Ga0207676_10007149 3300026095 Bacteria 7906
551 Ga0207676_10009887 3300026095 Bacteria 6787
552 Ga0207676_10010953 3300026095 Bacteria 6473
553 Ga0207676_10027081 3300026095 Bacteria 4266
554 Ga0207676_10056986 3300026095 Unclassified 3075
555 Ga0207676_10068165 3300026095 Bacteria 2845
556 Ga0207676_10077278 3300026095 Bacteria 2692
557 Ga0207674_10029837 3300026116 Bacteria 5738
558 Ga0207674_10256706 3300026116 Bacteria 1695
559 Ga0207674_10498384 3300026116 Bacteria 1177
560 Ga0207675_100008190 3300026118 Bacteria 9848
561 Ga0207675_100012673 3300026118 Bacteria 7879
562 Ga0207675_100034340 3300026118 Bacteria 4728
563 Ga0207675_100079449 3300026118 Bacteria 3074
564 Ga0207675_100234074 3300026118 Bacteria 1773
565 Ga0207675_100390126 3300026118 Bacteria 1370
566 Ga0207675_100503378 3300026118 Bacteria 1206
567 Ga0207683_10000394 3300026121 Bacteria 40159
568 Ga0207683_10000419 3300026121 Bacteria 39170
569 Ga0207683_10000581 3300026121 Bacteria 33773
570 Ga0207683_10000838 3300026121 Bacteria 28142
571 Ga0207683_10001935 3300026121 Bacteria 18332
572 Ga0207683_10002874 3300026121 Bacteria 15015
573 Ga0207683_10006786 3300026121 Bacteria 9801
574 Ga0207683_10009959 3300026121 Bacteria 8108
575 Ga0207683_10032720 3300026121 Bacteria 4517
576 Ga0207683_10210851 3300026121 Unclassified 1768
577 Ga0207683_10319053 3300026121 Bacteria 1423
578 Ga0207698_10103902 3300026142 Unclassified 2362
579 Ga0209969_1001471 3300027360 Bacteria 3252
580 Ga0209969_1003060 3300027360 Bacteria 2312
581 Ga0209967_1000706 3300027364 Bacteria 4306
582 Ga0209967_1015138 3300027364 Bacteria 1103
583 Ga0210000_1000438 3300027462 Bacteria 5727
584 Ga0210000_1000480 3300027462 Bacteria 5464
585 Ga0209995_1000757 3300027471 Bacteria 4966
586 Ga0209995_1002576 3300027471 Bacteria 2868
587 Ga0209995_1005811 3300027471 Bacteria 1984
588 Ga0209968_1005253 3300027526 Bacteria 1946
589 Ga0209999_1007031 3300027543 Bacteria 2023
590 Ga0209983_1028771 3300027665 Bacteria 1180
591 Ga0209971_1016569 3300027682 Bacteria 1747
592 Ga0209971_1020908 3300027682 Bacteria 1556
593 Ga0209974_10009049 3300027876 Bacteria 3386
594 Ga0209974_10022144 3300027876 Bacteria 2104
595 Ga0207428_10004110 3300027907 Bacteria 13948
596 Ga0207428_10005229 3300027907 Bacteria 12133
597 Ga0207428_10008952 3300027907 Bacteria 9016
598 Ga0207428_10028036 3300027907 Bacteria 4681
599 Ga0207428_10031371 3300027907 Bacteria 4385
600 Ga0207428_10044623 3300027907 Bacteria 3576
601 Ga0268266_10095906 3300028379 Bacteria 2605
602 Ga0268266_10132873 3300028379 Bacteria 2227
603 Ga0268266_10168755 3300028379 Bacteria 1985
604 Ga0268265_10094234 3300028380 Bacteria 2401
605 Ga0268265_10202796 3300028380 Bacteria 1722
606 Ga0268264_10032681 3300028381 Unclassified 4270
607 Ga0268264_10176359 3300028381 Bacteria 1937
608 Ga0268264_10221327 3300028381 Bacteria 1742
609 Ga0265318_10011303 3300028577 Bacteria 3848
610 Ga0265318_10041206 3300028577 Bacteria 1756
611 Ga0265330_10040994 3300031235 Bacteria 2054
612 Ga0265332_10001271 3300031238 Bacteria 14439
613 Ga0265332_10001357 3300031238 Bacteria 13884
614 Ga0265332_10040462 3300031238 Bacteria 2018
615 Ga0265328_10011152 3300031239 Bacteria 3598
616 Ga0265328_10013797 3300031239 Bacteria 3191
617 Ga0265320_10014112 3300031240 Bacteria 4567
618 Ga0265320_10031292 3300031240 Bacteria 2734
619 Ga0265331_10001190 3300031250 Bacteria 19692
620 Ga0265331_10001292 3300031250 Bacteria 18634
621 Ga0265331_10019878 3300031250 Bacteria 3458
622 Ga0265327_10031784 3300031251 Bacteria 2962
623 Ga0307408_100070885 3300031548 Bacteria 2575
624 Ga0265314_10005591 3300031711 Bacteria 11295
625 Ga0265314_10019279 3300031711 Bacteria 5287
626 Ga0265342_10023351 3300031712 Bacteria 3916
627 Ga0307405_10048627 3300031731 Bacteria 2617
628 Ga0307407_10095996 3300031903 Bacteria 1829
629 Ga0307407_10186751 3300031903 Bacteria 1378
630 Ga0307409_100255775 3300031995 Bacteria 1604
631 Ga0307411_10069604 3300032005 Bacteria 2377
632 Ga0307411_10343262 3300032005 Bacteria 1214
633 Ga0307415_100091150 3300032126 Unclassified 2207
634 Ga0307415_100195180 3300032126 Bacteria 1601
635 Ga0373948_0026202 3300034817 Bacteria 1148
636 Ga0373926_0000756 3300035083 Bacteria 9030
637 Ga0373934_0002091 3300035086 Bacteria 7321
638 Ga0373940_0098795 3300035088 Bacteria 884
639 Ga0373944_0006381 3300035089 Bacteria 3130
640 Ga0373951_0029130 3300035091 Bacteria 1296
641 Ga0373952_0043051 3300035092 Bacteria 1051
642 Ga0373936_0004203 3300035113 Bacteria 5428
643 Ga0373956_0004147 3300035119 Bacteria 5815
644 Ga0373955_0012701 3300035172 Bacteria 4055
645 Ga0373931_0136655 3300035691 Bacteria 1416
646 Ga0373931_0204148 3300035691 Bacteria 1182
647 Ga0373931_0220396 3300035691 Bacteria 1142
648 Ga0373935_0001314 3300035692 Bacteria 13745
649 Ga0373935_0318566 3300035692 Bacteria 1103
650 Ga0373927_0049563 3300035695 Bacteria 2715
651 Ga0373933_0028194 3300035724 Bacteria 3238
652 Ga0373947_0029423 3300035725 Bacteria 3223
653 Ga0373937_0019176 3300036401 Bacteria 6122
654 Ga0373925_0007447 3300037068 Bacteria 7986
655 Ga0395899_0160266 3300037312 Unclassified 1590
656 Ga0395898_0043767 3300037466 Bacteria 4411
657 Ga0395901_0153886 3300038443 Bacteria 2415
658 Ga0436360_0004950 3300039438 Bacteria 1080
659 Ga0439465_0055117 3300041413 Bacteria 1309
660 Ga0439441_014203 3300042001 Bacteria 1392
661 Ga0450911_008045 3300042115 Bacteria 1512
662 Ga0439435_0014487 3300042436 Bacteria 1949
663 Ga0450916_011267 3300042530 Bacteria 1128
664 Ga0451577_0226919 3300042876 Bacteria 1689
665 Ga0451577_0760300 3300042876 Unclassified 876
666 Ga0466957_0040678 3300044842 Bacteria 2809
667 Ga0451576_0011227 3300045051 Bacteria 10203
668 Ga0451576_0026777 3300045051 Bacteria 6197
669 Ga0451576_0127667 3300045051 Unclassified 2650
670 Ga0451576_0162512 3300045051 Bacteria 2331
671 Ga0466958_0199976 3300045836 Bacteria 1272
672 Ga0495592_0121257 3300046454 Bacteria 1839
673 Ga0495603_0004289 3300046455 Bacteria 8499
674 Ga0495603_0208850 3300046455 Bacteria 1128
675 Ga0495582_0015951 3300046473 Bacteria 4119
676 Ga0495639_0011222 3300046475 Bacteria 3860
677 Ga0495663_0043214 3300046525 Unclassified 1376
678 Ga0495642_0013141 3300046528 Bacteria 3199
679 Ga0495642_0110305 3300046528 Unclassified 1176
680 Ga0495665_0010642 3300046531 Bacteria 4983
681 Ga0495586_0025846 3300046535 Bacteria 3141
682 Ga0495598_0014722 3300046537 Bacteria 1960
683 Ga0495621_0017879 3300046539 Bacteria 2297
684 Ga0495659_0039725 3300046664 Bacteria 1674
685 Ga0495588_0038166 3300046674 Bacteria 2443
686 Ga0495599_0208122 3300046678 Bacteria 1200
687 Ga0495647_0005067 3300046681 Bacteria 4314
688 Ga0495658_0045769 3300046683 Bacteria 2457
689 Ga0495658_0084336 3300046683 Bacteria 1870
690 Ga0495658_0212791 3300046683 Bacteria 1208
691 Ga0495669_0012847 3300046684 Bacteria 3565
692 Ga0495669_0018200 3300046684 Bacteria 3019
693 Ga0495669_0038755 3300046684 Unclassified 2111
694 Ga0495669_0040535 3300046684 Bacteria 2066
695 Ga0495636_0051064 3300047318 Bacteria 1733
696 Ga0495636_0058925 3300047318 Bacteria 1620
697 Ga0495676_0106934 3300047321 Bacteria 2060
698 Ga0495684_0345303 3300047471 Bacteria 1058
699 Ga0495614_0110808 3300048089 Bacteria 1205
700 Ga0496101_0014428 3300048904 Bacteria 5311
701 Ga0496101_0053523 3300048904 Bacteria 2913
702 Ga0496102_0264037 3300048905 Bacteria 1623
703 Ga0496102_0640270 3300048905 Bacteria 986
704 Ga0496104_0161421 3300048907 Bacteria 2150
705 Ga0496104_0216286 3300048907 Unclassified 1828
706 Ga0496106_0158479 3300048909 Bacteria 1789
707 Ga0496108_0016448 3300048911 Bacteria 6034
708 Ga0496108_0026594 3300048911 Bacteria 4773
709 Ga0496108_0069581 3300048911 Unclassified 2970
710 Ga0496108_0279729 3300048911 Bacteria 1453
711 Ga0496109_0071934 3300048912 Bacteria 3176
712 Ga0496109_0079918 3300048912 Bacteria 3013
713 Ga0496109_0233233 3300048912 Bacteria 1732
714 Ga0496110_0002686 3300048913 Bacteria 13433
715 Ga0496110_0012852 3300048913 Bacteria 6899
716 Ga0496110_0022962 3300048913 Bacteria 5302
717 Ga0496110_0077301 3300048913 Bacteria 2961
718 Ga0496111_0015962 3300048914 Bacteria 5167
719 Ga0496114_0106406 3300048917 Bacteria 2400
720 Ga0496121_0003189 3300048924 Bacteria 23644
721 Ga0496125_0023065 3300048928 Bacteria 5758
722 Ga0496126_0261173 3300048929 Bacteria 1440
723 Ga0501034_0000757 3300049571 Bacteria 48585
724 Ga0501034_0366251 3300049571 Bacteria 1368
725 Ga0501036_0023503 3300049572 Bacteria 5193
726 Ga0501037_0102615 3300049573 Bacteria 2063
727 Ga0501039_0012598 3300049575 Bacteria 6462
728 Ga0501039_0047730 3300049575 Bacteria 3310
729 Ga0501042_0032146 3300049578 Bacteria 3715
730 Ga0501043_0025169 3300049579 Bacteria 4669
731 Ga0501048_0081578 3300049582 Bacteria 2282
732 Ga0501048_0125939 3300049582 Bacteria 1811
733 Ga0501068_0027764 3300049584 Bacteria 3344
734 Ga0501068_0111011 3300049584 Bacteria 1705
735 Ga0501069_0014446 3300049585 Bacteria 4224
736 Ga0501070_0036662 3300049586 Bacteria 4095
737 Ga0501071_0011568 3300049587 Bacteria 5954
738 Ga0501071_0021374 3300049587 Bacteria 4505
739 Ga0501074_0063465 3300049590 Bacteria 2661
740 Ga0501075_0008008 3300049591 Bacteria 7343
741 Ga0501076_0004738 3300049592 Bacteria 9706
742 Ga0501076_0341904 3300049592 Bacteria 1228
743 Ga0501080_0003555 3300049742 Bacteria 13722
744 Ga0501081_0004989 3300049743 Bacteria 8544
745 Ga0501081_0013808 3300049743 Bacteria 5315
746 Ga0501083_0100134 3300049744 Bacteria 1911
747 Ga0501044_0058415 3300049823 Bacteria 3956
748 Ga0501045_0012534 3300049824 Bacteria 5971
749 Ga0501045_0108351 3300049824 Bacteria 2059
750 Ga0501045_0140929 3300049824 Bacteria 1793
751 nmdc:mga03683_52895_c1 3300050489 Bacteria 1698
752 nmdc:mga0yw44_137659_c1 3300050492 Bacteria 1585
753 nmdc:mga06z11_4551_c1 3300050494 Bacteria 5463
754 nmdc:mga06z11_52052_c1 3300050494 Bacteria 2099
755 nmdc:mga07m45_2091_c2 3300050496 Bacteria 8751
756 nmdc:mga05p37_116824_c1 3300050507 Bacteria 3279
757 nmdc:mga05p37_365445_c1 3300050507 Bacteria 1695
758 nmdc:mga05p37_720265_c1 3300050507 Bacteria 1105
759 nmdc:mga05p37_96388_c1 3300050507 Bacteria 2951
760 nmdc:mga09592_10327_c1 3300050508 Bacteria 7596
761 nmdc:mga09592_16139_c1 3300050508 Bacteria 6104
762 nmdc:mga09592_21940_c1 3300050508 Bacteria 5266
763 nmdc:mga09592_221083_c1 3300050508 Bacteria 1641
764 nmdc:mga09592_23470_c1 3300050508 Bacteria 5095
765 nmdc:mga09592_40461_c1 3300050508 Bacteria 3916
766 nmdc:mga09592_81116_c1 3300050508 Bacteria 2764
767 nmdc:mga0qj67_173175_c1 3300050509 Bacteria 1753
768 nmdc:mga0qj67_237557_c1 3300050509 Bacteria 1478
769 nmdc:mga0qj67_324463_c1 3300050509 Bacteria 1246
770 nmdc:mga0qj67_38194_c1 3300050509 Bacteria 3766
771 nmdc:mga0qj67_53926_c1 3300050509 Bacteria 3183
772 nmdc:mga0qj67_78345_c1 3300050509 Bacteria 2645
773 nmdc:mga06r32_11524_c1 3300050510 Bacteria 7965
774 nmdc:mga06r32_2431_c1 3300050510 Bacteria 16666
775 nmdc:mga06r32_77532_c1 3300050510 Bacteria 3229
776 nmdc:mga08y16_14449_c1 3300050511 Bacteria 8305
777 nmdc:mga08y16_1491_c1 3300050511 Bacteria 23546
778 nmdc:mga08y16_224691_c1 3300050511 Bacteria 1943
779 nmdc:mga08y16_23154_c1 3300050511 Bacteria 6558
780 nmdc:mga08y16_2516_c1 3300050511 Bacteria 18835
781 nmdc:mga08y16_274053_c1 3300050511 Unclassified 1741
782 nmdc:mga08y16_324312_c1 3300050511 Bacteria 1585
783 nmdc:mga08y16_37579_c1 3300050511 Bacteria 5084
784 nmdc:mga08y16_72372_c1 3300050511 Bacteria 3592
785 nmdc:mga0n895_308466_c1 3300050512 Bacteria 1604
786 nmdc:mga0rr50_123286_c1 3300050513 Bacteria 2066
787 nmdc:mga0rr50_173907_c1 3300050513 Bacteria 1756
788 nmdc:mga08x19_123972_c1 3300050514 Bacteria 1734
789 nmdc:mga08x19_35077_c1 3300050514 Bacteria 3173
790 nmdc:mga0a205_239165_c1 3300050515 Bacteria 1697
791 nmdc:mga0a205_278289_c1 3300050515 Bacteria 1549
792 nmdc:mga0sz30_629_c1 3300050516 Bacteria 13076
793 Ga0500651_0201372 3300053093 Bacteria 1174
794 Ga0500641_0002167 3300053096 Bacteria 6960
795 Ga0500616_0001277 3300053153 Bacteria 25156
796 Ga0500552_000068 3300053733 Bacteria 8540
797 Ga0501082_0000529 3300060353 Bacteria 33995
798 Ga0501082_0097640 3300060353 Bacteria 2540
799 Ga0501082_0366927 3300060353 Bacteria 1256
800 Ga0530510_0061007 3300061734 Bacteria 2730

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035088 Ga0373940_0098795 Ga0373940_0098795_40_846 252
2 3300048905 Ga0496102_0640270 Ga0496102_0640270_13_855 252
3 3300005338 Ga0068868_100036427 Ga0068868_1000364274 255
4 3300005353 Ga0070669_100016792 Ga0070669_1000167923 255
5 3300005354 Ga0070675_100005907 Ga0070675_1000059075 255
6 3300005355 Ga0070671_100012134 Ga0070671_1000121344 255
7 3300005356 Ga0070674_100017437 Ga0070674_1000174372 255
8 3300005367 Ga0070667_100067791 Ga0070667_1000677913 255
9 3300005456 Ga0070678_100000701 Ga0070678_10000070110 255
10 3300005539 Ga0068853_100093077 Ga0068853_1000930772 255
11 3300006358 Ga0068871_100010723 Ga0068871_1000107232 255
12 3300006881 Ga0068865_100071529 Ga0068865_1000715293 255
13 3300013306 Ga0163162_10047449 Ga0163162_100474493 255
14 3300013308 Ga0157375_10143108 Ga0157375_101431083 255
15 3300025903 Ga0207680_10230901 Ga0207680_102309011 255
16 3300025923 Ga0207681_10040677 Ga0207681_100406772 255
17 3300025986 Ga0207658_10101518 Ga0207658_101015181 255
18 3300026023 Ga0207677_10234361 Ga0207677_102343612 255
19 3300026041 Ga0207639_10067006 Ga0207639_100670063 255
20 3300026121 Ga0207683_10006786 Ga0207683_100067868 255
21 3300005364 Ga0070673_100010295 Ga0070673_1000102955 256
22 3300005564 Ga0070664_100189974 Ga0070664_1001899742 256
23 3300025960 Ga0207651_10023286 Ga0207651_100232863 256
24 3300025933 Ga0207706_10403831 Ga0207706_104038311 269
25 3300046455 Ga0495603_0208850 Ga0495603_0208850_280_1110 276
26 3300050509 nmdc:mga0qj67_237557_c1 nmdc:mga0qj67_237557_c1_174_1004 276
27 3300042876 Ga0451577_0760300 Ga0451577_0760300_29_865 277
28 3300005719 Ga0068861_100186214 Ga0068861_1001862142 280
29 3300009148 Ga0105243_10431390 Ga0105243_104313901 280
30 3300025918 Ga0207662_10069334 Ga0207662_100693343 281
31 3300045051 Ga0451576_0011227 Ga0451576_0011227_5748_6686 281
32 3300006852 Ga0075433_10107914 Ga0075433_101079143 282
33 3300007076 Ga0075435_100006662 Ga0075435_1000066629 282
34 3300050515 nmdc:mga0a205_278289_c1 nmdc:mga0a205_278289_c1_337_1281 282
35 3300035091 Ga0373951_0029130 Ga0373951_0029130_317_1267 283
36 3300005718 Ga0068866_10028078 Ga0068866_100280783 284
37 3300028381 Ga0268264_10221327 Ga0268264_102213272 285
38 3300034817 Ga0373948_0026202 Ga0373948_0026202_12_947 285
39 3300035092 Ga0373952_0043051 Ga0373952_0043051_97_1032 285
40 3300050507 nmdc:mga05p37_116824_c1 nmdc:mga05p37_116824_c1_285_1196 285
41 3300060353 Ga0501082_0097640 Ga0501082_0097640_1438_2406 285
42 3300006847 Ga0075431_100007754 Ga0075431_10000775410 286
43 3300009551 Ga0105238_10117235 Ga0105238_101172351 286
44 3300013296 Ga0157374_10020612 Ga0157374_100206126 286
45 3300013297 Ga0157378_10011956 Ga0157378_100119566 286
46 3300013306 Ga0163162_10015389 Ga0163162_100153894 286
47 3300013308 Ga0157375_10002228 Ga0157375_100022283 286
48 3300014969 Ga0157376_10006789 Ga0157376_100067893 286
49 3300048911 Ga0496108_0016448 Ga0496108_0016448_3904_4764 286
50 3300048912 Ga0496109_0071934 Ga0496109_0071934_608_1468 286
51 3300048913 Ga0496110_0012852 Ga0496110_0012852_389_1249 286
52 3300050509 nmdc:mga0qj67_173175_c1 nmdc:mga0qj67_173175_c1_846_1706 286
53 3300050510 nmdc:mga06r32_11524_c1 nmdc:mga06r32_11524_c1_3764_4624 286
54 3300005328 Ga0070676_10055984 Ga0070676_100559842 287
55 3300005335 Ga0070666_10017090 Ga0070666_100170904 287
56 3300005356 Ga0070674_100081161 Ga0070674_1000811612 287
57 3300005367 Ga0070667_100001848 Ga0070667_1000018485 287
58 3300005456 Ga0070678_100003716 Ga0070678_1000037166 287
59 3300005459 Ga0068867_100009787 Ga0068867_1000097873 287
60 3300005543 Ga0070672_100031926 Ga0070672_1000319264 287
61 3300005548 Ga0070665_100002513 Ga0070665_1000025134 287
62 3300009094 Ga0111539_10061458 Ga0111539_100614584 287
63 3300009147 Ga0114129_10019617 Ga0114129_100196177 287
64 3300025903 Ga0207680_10039735 Ga0207680_100397353 287
65 3300025907 Ga0207645_10118801 Ga0207645_101188012 287
66 3300025921 Ga0207652_10353694 Ga0207652_103536942 287
67 3300025940 Ga0207691_10003996 Ga0207691_1000399611 287
68 3300026121 Ga0207683_10001935 Ga0207683_1000193511 287
69 3300028379 Ga0268266_10095906 Ga0268266_100959063 287
70 3300045051 Ga0451576_0026777 Ga0451576_0026777_38_985 287
71 3300050508 nmdc:mga09592_221083_c1 nmdc:mga09592_221083_c1_555_1418 287
72 3300050511 nmdc:mga08y16_37579_c1 nmdc:mga08y16_37579_c1_3018_3881 287
73 3300050513 nmdc:mga0rr50_123286_c1 nmdc:mga0rr50_123286_c1_15_962 287
74 3300050509 nmdc:mga0qj67_324463_c1 nmdc:mga0qj67_324463_c1_190_1056 288
75 3300005549 Ga0070704_100059510 Ga0070704_1000595101 289
76 3300042436 Ga0439435_0014487 Ga0439435_0014487_599_1564 289
77 3300032126 Ga0307415_100091150 Ga0307415_1000911503 290
78 3300032126 Ga0307415_100195180 Ga0307415_1001951802 290
79 3300050515 nmdc:mga0a205_239165_c1 nmdc:mga0a205_239165_c1_625_1557 291
80 3300005334 Ga0068869_100173131 Ga0068869_1001731312 292
81 3300005459 Ga0068867_100279118 Ga0068867_1002791181 292
82 3300025942 Ga0207689_10022167 Ga0207689_100221671 292
83 3300046539 Ga0495621_0017879 Ga0495621_0017879_471_1352 292
84 3300046683 Ga0495658_0045769 Ga0495658_0045769_1157_2038 292
85 3300046684 Ga0495669_0040535 Ga0495669_0040535_865_1746 292
86 3300048907 Ga0496104_0161421 Ga0496104_0161421_33_911 292
87 3300048913 Ga0496110_0077301 Ga0496110_0077301_67_1035 292
88 3300009094 Ga0111539_10045031 Ga0111539_100450316 293
89 3300042001 Ga0439441_014203 Ga0439441_014203_139_1104 293
90 3300049572 Ga0501036_0023503 Ga0501036_0023503_107_1111 293
91 3300049573 Ga0501037_0102615 Ga0501037_0102615_537_1541 293
92 3300049575 Ga0501039_0012598 Ga0501039_0012598_5435_6439 293
93 3300049578 Ga0501042_0032146 Ga0501042_0032146_504_1508 293
94 3300049579 Ga0501043_0025169 Ga0501043_0025169_56_1060 293
95 3300049582 Ga0501048_0125939 Ga0501048_0125939_335_1339 293
96 3300049584 Ga0501068_0027764 Ga0501068_0027764_361_1365 293
97 3300049585 Ga0501069_0014446 Ga0501069_0014446_2207_3148 293
98 3300049587 Ga0501071_0011568 Ga0501071_0011568_4164_5168 293
99 3300049591 Ga0501075_0008008 Ga0501075_0008008_3933_4937 293
100 3300049592 Ga0501076_0004738 Ga0501076_0004738_2161_3165 293
101 3300049742 Ga0501080_0003555 Ga0501080_0003555_2439_3443 293
102 3300049743 Ga0501081_0004989 Ga0501081_0004989_1569_2573 293
103 3300049744 Ga0501083_0100134 Ga0501083_0100134_556_1560 293
104 3300049824 Ga0501045_0012534 Ga0501045_0012534_250_1254 293
105 3300060353 Ga0501082_0000529 Ga0501082_0000529_2000_3004 293
106 3300050507 nmdc:mga05p37_720265_c1 nmdc:mga05p37_720265_c1_35_919 294
107 3300005536 Ga0070697_100043501 Ga0070697_1000435012 295
108 3300005545 Ga0070695_100008105 Ga0070695_1000081053 295
109 3300005546 Ga0070696_100025217 Ga0070696_1000252174 295
110 3300005545 Ga0070695_100178905 Ga0070695_1001789052 296
111 3300009098 Ga0105245_10476048 Ga0105245_104760482 296
112 3300013297 Ga0157378_10058465 Ga0157378_100584652 296
113 3300014969 Ga0157376_10451998 Ga0157376_104519982 296
114 3300025942 Ga0207689_10006278 Ga0207689_1000627813 296
115 3300026035 Ga0207703_10217135 Ga0207703_102171352 296
116 3300026075 Ga0207708_10336285 Ga0207708_103362852 296
117 3300026118 Ga0207675_100503378 Ga0207675_1005033781 296
118 3300005615 Ga0070702_100073639 Ga0070702_1000736392 297
119 3300006173 Ga0070716_100001401 Ga0070716_1000014015 297
120 3300009176 Ga0105242_10112289 Ga0105242_101122891 297
121 3300025939 Ga0207665_10003318 Ga0207665_100033185 297
122 3300035083 Ga0373926_0000756 Ga0373926_0000756_4227_5168 297
123 3300035089 Ga0373944_0006381 Ga0373944_0006381_507_1448 297
124 3300035113 Ga0373936_0004203 Ga0373936_0004203_1199_2140 297
125 3300035692 Ga0373935_0001314 Ga0373935_0001314_5070_6011 297
126 3300035695 Ga0373927_0049563 Ga0373927_0049563_1245_2186 297
127 3300035725 Ga0373947_0029423 Ga0373947_0029423_507_1448 297
128 3300037068 Ga0373925_0007447 Ga0373925_0007447_6411_7352 297
129 3300046455 Ga0495603_0004289 Ga0495603_0004289_5030_5971 297
130 3300046473 Ga0495582_0015951 Ga0495582_0015951_1625_2566 297
131 3300046475 Ga0495639_0011222 Ga0495639_0011222_2448_3389 297
132 3300046531 Ga0495665_0010642 Ga0495665_0010642_819_1760 297
133 3300046535 Ga0495586_0025846 Ga0495586_0025846_1876_2817 297
134 3300046674 Ga0495588_0038166 Ga0495588_0038166_756_1697 297
135 3300046681 Ga0495647_0005067 Ga0495647_0005067_3217_4158 297
136 3300046683 Ga0495658_0084336 Ga0495658_0084336_489_1430 297
137 3300047321 Ga0495676_0106934 Ga0495676_0106934_1095_2036 297
138 3300048089 Ga0495614_0110808 Ga0495614_0110808_39_980 297
139 3300005353 Ga0070669_100182247 Ga0070669_1001822472 298
140 3300006914 Ga0075436_100020610 Ga0075436_1000206103 298
141 3300007265 Ga0099794_10022852 Ga0099794_100228523 298
142 3300007265 Ga0099794_10053843 Ga0099794_100538432 298
143 3300050514 nmdc:mga08x19_123972_c1 nmdc:mga08x19_123972_c1_291_1232 298
144 3300007265 Ga0099794_10022778 Ga0099794_100227782 301
145 3300005438 Ga0070701_10100119 Ga0070701_101001192 302
146 3300005842 Ga0068858_100186819 Ga0068858_1001868192 302
147 3300026023 Ga0207677_10155305 Ga0207677_101553051 302
148 3300026089 Ga0207648_10000663 Ga0207648_100006631 302
149 3300031995 Ga0307409_100255775 Ga0307409_1002557751 302
150 3300049592 Ga0501076_0341904 Ga0501076_0341904_287_1195 302
151 3300007788 Ga0099795_10025500 Ga0099795_100255002 303
152 3300025912 Ga0207707_10120268 Ga0207707_101202682 303
153 3300035691 Ga0373931_0204148 Ga0373931_0204148_154_1125 303
154 3300014969 Ga0157376_10357802 Ga0157376_103578022 304
155 3300027876 Ga0209974_10022144 Ga0209974_100221442 304
156 3300005340 Ga0070689_100265045 Ga0070689_1002650452 305
157 3300009553 Ga0105249_10133150 Ga0105249_101331504 305
158 3300013306 Ga0163162_10222961 Ga0163162_102229612 305
159 3300025936 Ga0207670_10173335 Ga0207670_101733352 305
160 3300025961 Ga0207712_10100181 Ga0207712_101001812 305
161 3300026095 Ga0207676_10068165 Ga0207676_100681653 305
162 3300027462 Ga0210000_1000438 Ga0210000_10004382 305
163 3300035086 Ga0373934_0002091 Ga0373934_0002091_3299_4243 305
164 3300035119 Ga0373956_0004147 Ga0373956_0004147_2730_3674 305
165 3300035172 Ga0373955_0012701 Ga0373955_0012701_2327_3271 305
166 3300035724 Ga0373933_0028194 Ga0373933_0028194_1875_2819 305
167 3300036401 Ga0373937_0019176 Ga0373937_0019176_4004_4948 305
168 3300046525 Ga0495663_0043214 Ga0495663_0043214_276_1196 305
169 3300046528 Ga0495642_0110305 Ga0495642_0110305_79_999 305
170 3300046684 Ga0495669_0038755 Ga0495669_0038755_380_1300 305
171 3300005336 Ga0070680_100388808 Ga0070680_1003888081 306
172 3300005458 Ga0070681_10055432 Ga0070681_100554325 306
173 3300005467 Ga0070706_100086903 Ga0070706_1000869033 306
174 3300005468 Ga0070707_100092583 Ga0070707_1000925832 306
175 3300005549 Ga0070704_100195752 Ga0070704_1001957521 306
176 3300006871 Ga0075434_100096576 Ga0075434_1000965762 306
177 3300006880 Ga0075429_100028009 Ga0075429_1000280094 306
178 3300007076 Ga0075435_100140791 Ga0075435_1001407912 306
179 3300009094 Ga0111539_10030251 Ga0111539_100302512 306
180 3300027907 Ga0207428_10031371 Ga0207428_100313711 306
181 3300048912 Ga0496109_0079918 Ga0496109_0079918_551_1558 306
182 3300050508 nmdc:mga09592_10327_c1 nmdc:mga09592_10327_c1_1818_2744 306
183 3300050509 nmdc:mga0qj67_53926_c1 nmdc:mga0qj67_53926_c1_1623_2552 306
184 3300050511 nmdc:mga08y16_2516_c1 nmdc:mga08y16_2516_c1_3549_4475 306
185 3300005330 Ga0070690_100074882 Ga0070690_1000748822 307
186 3300005343 Ga0070687_100053678 Ga0070687_1000536782 307
187 3300005456 Ga0070678_100059588 Ga0070678_1000595882 307
188 3300005459 Ga0068867_100008650 Ga0068867_1000086502 307
189 3300005718 Ga0068866_10084268 Ga0068866_100842682 307
190 3300005843 Ga0068860_100128216 Ga0068860_1001282162 307
191 3300006237 Ga0097621_100068795 Ga0097621_1000687952 307
192 3300009148 Ga0105243_10042758 Ga0105243_100427583 307
193 3300009176 Ga0105242_10182831 Ga0105242_101828312 307
194 3300014968 Ga0157379_10113279 Ga0157379_101132792 307
195 3300017792 Ga0163161_10010635 Ga0163161_100106354 307
196 3300025899 Ga0207642_10034423 Ga0207642_100344232 307
197 3300025934 Ga0207686_10062766 Ga0207686_100627662 307
198 3300025938 Ga0207704_10021683 Ga0207704_100216832 307
199 3300025940 Ga0207691_10109654 Ga0207691_101096542 307
200 3300025960 Ga0207651_10150097 Ga0207651_101500972 307
201 3300026075 Ga0207708_10103459 Ga0207708_101034592 307
202 3300026089 Ga0207648_10003622 Ga0207648_100036226 307
203 3300026118 Ga0207675_100234074 Ga0207675_1002340742 307
204 3300026121 Ga0207683_10032720 Ga0207683_100327204 307
205 3300005334 Ga0068869_100034372 Ga0068869_1000343721 308
206 3300005343 Ga0070687_100088813 Ga0070687_1000888131 308
207 3300005440 Ga0070705_100026095 Ga0070705_1000260953 308
208 3300005456 Ga0070678_100079281 Ga0070678_1000792813 308
209 3300005458 Ga0070681_10036424 Ga0070681_100364245 308
210 3300005459 Ga0068867_100137478 Ga0068867_1001374782 308
211 3300005467 Ga0070706_100109456 Ga0070706_1001094562 308
212 3300005536 Ga0070697_100013262 Ga0070697_1000132624 308
213 3300005543 Ga0070672_100127568 Ga0070672_1001275682 308
214 3300005545 Ga0070695_100191469 Ga0070695_1001914691 308
215 3300005547 Ga0070693_100040794 Ga0070693_1000407942 308
216 3300005843 Ga0068860_100121034 Ga0068860_1001210342 308
217 3300005844 Ga0068862_100256979 Ga0068862_1002569792 308
218 3300007076 Ga0075435_100122597 Ga0075435_1001225972 308
219 3300007265 Ga0099794_10025794 Ga0099794_100257943 308
220 3300025893 Ga0207682_10002135 Ga0207682_100021357 308
221 3300025899 Ga0207642_10059380 Ga0207642_100593802 308
222 3300025907 Ga0207645_10006895 Ga0207645_100068953 308
223 3300025910 Ga0207684_10223392 Ga0207684_102233922 308
224 3300025912 Ga0207707_10019952 Ga0207707_100199528 308
225 3300025922 Ga0207646_10106785 Ga0207646_101067854 308
226 3300025931 Ga0207644_10090564 Ga0207644_100905642 308
227 3300025933 Ga0207706_10040534 Ga0207706_100405342 308
228 3300026089 Ga0207648_10012278 Ga0207648_100122786 308
229 3300026118 Ga0207675_100008190 Ga0207675_1000081902 308
230 3300028380 Ga0268265_10094234 Ga0268265_100942342 308
231 3300046454 Ga0495592_0121257 Ga0495592_0121257_377_1333 308
232 3300046678 Ga0495599_0208122 Ga0495599_0208122_179_1135 308
233 3300050512 nmdc:mga0n895_308466_c1 nmdc:mga0n895_308466_c1_131_1069 308
234 3300005354 Ga0070675_100333367 Ga0070675_1003333672 309
235 3300009094 Ga0111539_10035779 Ga0111539_100357794 309
236 3300027471 Ga0209995_1005811 Ga0209995_10058112 309
237 3300027665 Ga0209983_1028771 Ga0209983_10287711 309
238 3300039438 Ga0436360_0004950 Ga0436360_0004950_67_1032 309
239 3300047318 Ga0495636_0051064 Ga0495636_0051064_598_1617 309
240 3300047318 Ga0495636_0058925 Ga0495636_0058925_193_1221 309
241 3300050508 nmdc:mga09592_21940_c1 nmdc:mga09592_21940_c1_2120_3058 309
242 3300005435 Ga0070714_100022417 Ga0070714_1000224173 310
243 3300005458 Ga0070681_10007773 Ga0070681_100077734 310
244 3300005458 Ga0070681_10012078 Ga0070681_100120783 310
245 3300005467 Ga0070706_100007041 Ga0070706_1000070413 310
246 3300005467 Ga0070706_100340103 Ga0070706_1003401032 310
247 3300005468 Ga0070707_100013180 Ga0070707_1000131802 310
248 3300005530 Ga0070679_100042295 Ga0070679_1000422952 310
249 3300005545 Ga0070695_100069972 Ga0070695_1000699722 310
250 3300005844 Ga0068862_100189171 Ga0068862_1001891712 310
251 3300006846 Ga0075430_100229313 Ga0075430_1002293132 310
252 3300006847 Ga0075431_100001415 Ga0075431_10000141512 310
253 3300006871 Ga0075434_100327861 Ga0075434_1003278612 310
254 3300006880 Ga0075429_100029527 Ga0075429_1000295272 310
255 3300013297 Ga0157378_10222622 Ga0157378_102226222 310
256 3300025910 Ga0207684_10122878 Ga0207684_101228781 310
257 3300025912 Ga0207707_10033160 Ga0207707_100331605 310
258 3300025912 Ga0207707_10072705 Ga0207707_100727052 310
259 3300025921 Ga0207652_10069494 Ga0207652_100694943 310
260 3300025921 Ga0207652_10362936 Ga0207652_103629361 310
261 3300031238 Ga0265332_10040462 Ga0265332_100404621 310
262 3300035692 Ga0373935_0318566 Ga0373935_0318566_124_1059 310
263 3300042876 Ga0451577_0226919 Ga0451577_0226919_73_1032 310
264 3300045051 Ga0451576_0127667 Ga0451576_0127667_73_1050 310
265 3300050508 nmdc:mga09592_23470_c1 nmdc:mga09592_23470_c1_3352_4332 310
266 3300050509 nmdc:mga0qj67_78345_c1 nmdc:mga0qj67_78345_c1_33_1013 310
267 3300050510 nmdc:mga06r32_2431_c1 nmdc:mga06r32_2431_c1_5640_6620 310
268 3300005331 Ga0070670_100003991 Ga0070670_1000039914 311
269 3300005331 Ga0070670_100005246 Ga0070670_1000052465 311
270 3300005333 Ga0070677_10001359 Ga0070677_100013596 311
271 3300005333 Ga0070677_10004286 Ga0070677_100042862 311
272 3300005334 Ga0068869_100045460 Ga0068869_1000454601 311
273 3300005334 Ga0068869_100102771 Ga0068869_1001027712 311
274 3300005335 Ga0070666_10003778 Ga0070666_100037787 311
275 3300005335 Ga0070666_10018150 Ga0070666_100181501 311
276 3300005338 Ga0068868_100000544 Ga0068868_10000054414 311
277 3300005338 Ga0068868_100025660 Ga0068868_1000256607 311
278 3300005340 Ga0070689_100031295 Ga0070689_1000312952 311
279 3300005344 Ga0070661_100011278 Ga0070661_1000112784 311
280 3300005345 Ga0070692_10087247 Ga0070692_100872473 311
281 3300005347 Ga0070668_100037336 Ga0070668_1000373362 311
282 3300005353 Ga0070669_100084505 Ga0070669_1000845053 311
283 3300005354 Ga0070675_100001594 Ga0070675_1000015946 311
284 3300005354 Ga0070675_100036749 Ga0070675_1000367492 311
285 3300005355 Ga0070671_100013744 Ga0070671_1000137445 311
286 3300005355 Ga0070671_100056542 Ga0070671_1000565422 311
287 3300005356 Ga0070674_100021230 Ga0070674_1000212306 311
288 3300005364 Ga0070673_100006483 Ga0070673_1000064836 311
289 3300005364 Ga0070673_100046006 Ga0070673_1000460062 311
290 3300005365 Ga0070688_100044115 Ga0070688_1000441153 311
291 3300005367 Ga0070667_100073068 Ga0070667_1000730683 311
292 3300005367 Ga0070667_100085974 Ga0070667_1000859742 311
293 3300005438 Ga0070701_10038810 Ga0070701_100388102 311
294 3300005441 Ga0070700_100018163 Ga0070700_1000181635 311
295 3300005456 Ga0070678_100000281 Ga0070678_1000002818 311
296 3300005456 Ga0070678_100022358 Ga0070678_1000223582 311
297 3300005457 Ga0070662_100031021 Ga0070662_1000310212 311
298 3300005457 Ga0070662_100069338 Ga0070662_1000693383 311
299 3300005459 Ga0068867_100011002 Ga0068867_1000110029 311
300 3300005466 Ga0070685_10052239 Ga0070685_100522392 311
301 3300005543 Ga0070672_100001056 Ga0070672_1000010562 311
302 3300005544 Ga0070686_100067046 Ga0070686_1000670462 311
303 3300005546 Ga0070696_100129137 Ga0070696_1001291372 311
304 3300005564 Ga0070664_100000329 Ga0070664_10000032926 311
305 3300005564 Ga0070664_100089901 Ga0070664_1000899012 311
306 3300005615 Ga0070702_100128147 Ga0070702_1001281472 311
307 3300005616 Ga0068852_100000200 Ga0068852_10000020021 311
308 3300005618 Ga0068864_100005962 Ga0068864_1000059627 311
309 3300005618 Ga0068864_100093333 Ga0068864_1000933333 311
310 3300005841 Ga0068863_100153418 Ga0068863_1001534182 311
311 3300005842 Ga0068858_100014277 Ga0068858_1000142771 311
312 3300005843 Ga0068860_100060532 Ga0068860_1000605323 311
313 3300005844 Ga0068862_100073405 Ga0068862_1000734052 311
314 3300005985 Ga0081539_10001828 Ga0081539_1000182819 311
315 3300006237 Ga0097621_100004924 Ga0097621_1000049242 311
316 3300006237 Ga0097621_100039222 Ga0097621_1000392226 311
317 3300006358 Ga0068871_100000447 Ga0068871_10000044718 311
318 3300006358 Ga0068871_100012469 Ga0068871_1000124698 311
319 3300006844 Ga0075428_100012504 Ga0075428_1000125044 311
320 3300006844 Ga0075428_100139966 Ga0075428_1001399664 311
321 3300006846 Ga0075430_100051035 Ga0075430_1000510352 311
322 3300006847 Ga0075431_100025203 Ga0075431_1000252034 311
323 3300006880 Ga0075429_100026726 Ga0075429_1000267265 311
324 3300009094 Ga0111539_10001180 Ga0111539_100011807 311
325 3300009098 Ga0105245_10026682 Ga0105245_100266822 311
326 3300009101 Ga0105247_10198235 Ga0105247_101982352 311
327 3300009147 Ga0114129_10493654 Ga0114129_104936542 311
328 3300009148 Ga0105243_10059257 Ga0105243_100592573 311
329 3300009176 Ga0105242_10004388 Ga0105242_1000438812 311
330 3300009177 Ga0105248_10068598 Ga0105248_100685982 311
331 3300009553 Ga0105249_10072198 Ga0105249_100721981 311
332 3300013296 Ga0157374_10000653 Ga0157374_1000065314 311
333 3300013297 Ga0157378_10018221 Ga0157378_100182212 311
334 3300013297 Ga0157378_10033333 Ga0157378_100333337 311
335 3300013306 Ga0163162_10015710 Ga0163162_100157107 311
336 3300013308 Ga0157375_10000621 Ga0157375_100006216 311
337 3300013308 Ga0157375_10432767 Ga0157375_104327672 311
338 3300014325 Ga0163163_10036631 Ga0163163_100366315 311
339 3300014326 Ga0157380_10044574 Ga0157380_100445744 311
340 3300014968 Ga0157379_10019658 Ga0157379_100196588 311
341 3300014969 Ga0157376_10031688 Ga0157376_100316885 311
342 3300017792 Ga0163161_10029881 Ga0163161_100298812 311
343 3300025893 Ga0207682_10001994 Ga0207682_1000199411 311
344 3300025893 Ga0207682_10005871 Ga0207682_100058712 311
345 3300025899 Ga0207642_10013949 Ga0207642_100139493 311
346 3300025901 Ga0207688_10007041 Ga0207688_100070417 311
347 3300025901 Ga0207688_10236022 Ga0207688_102360221 311
348 3300025903 Ga0207680_10003125 Ga0207680_100031256 311
349 3300025907 Ga0207645_10048125 Ga0207645_100481252 311
350 3300025908 Ga0207643_10005914 Ga0207643_100059145 311
351 3300025925 Ga0207650_10001197 Ga0207650_100011973 311
352 3300025925 Ga0207650_10043667 Ga0207650_100436673 311
353 3300025926 Ga0207659_10018737 Ga0207659_100187375 311
354 3300025927 Ga0207687_10060985 Ga0207687_100609853 311
355 3300025931 Ga0207644_10000669 Ga0207644_1000066913 311
356 3300025931 Ga0207644_10003503 Ga0207644_100035034 311
357 3300025933 Ga0207706_10012515 Ga0207706_100125152 311
358 3300025934 Ga0207686_10035958 Ga0207686_100359582 311
359 3300025936 Ga0207670_10005745 Ga0207670_100057452 311
360 3300025937 Ga0207669_10045357 Ga0207669_100453573 311
361 3300025938 Ga0207704_10018258 Ga0207704_100182582 311
362 3300025940 Ga0207691_10000470 Ga0207691_1000047025 311
363 3300025940 Ga0207691_10014920 Ga0207691_100149205 311
364 3300025942 Ga0207689_10034477 Ga0207689_100344774 311
365 3300025942 Ga0207689_10108625 Ga0207689_101086253 311
366 3300025944 Ga0207661_10002744 Ga0207661_100027442 311
367 3300025945 Ga0207679_10015095 Ga0207679_100150953 311
368 3300025960 Ga0207651_10005066 Ga0207651_100050662 311
369 3300025981 Ga0207640_10030183 Ga0207640_100301833 311
370 3300025986 Ga0207658_10014281 Ga0207658_100142812 311
371 3300025986 Ga0207658_10031982 Ga0207658_100319822 311
372 3300026023 Ga0207677_10001517 Ga0207677_100015178 311
373 3300026035 Ga0207703_10128534 Ga0207703_101285341 311
374 3300026075 Ga0207708_10014517 Ga0207708_100145178 311
375 3300026088 Ga0207641_10037194 Ga0207641_100371945 311
376 3300026089 Ga0207648_10019268 Ga0207648_100192687 311
377 3300026095 Ga0207676_10007149 Ga0207676_100071492 311
378 3300026095 Ga0207676_10027081 Ga0207676_100270816 311
379 3300026118 Ga0207675_100012673 Ga0207675_10001267310 311
380 3300026121 Ga0207683_10000581 Ga0207683_1000058123 311
381 3300026121 Ga0207683_10002874 Ga0207683_100028744 311
382 3300027360 Ga0209969_1001471 Ga0209969_10014712 311
383 3300027364 Ga0209967_1000706 Ga0209967_10007063 311
384 3300027462 Ga0210000_1000480 Ga0210000_10004805 311
385 3300027471 Ga0209995_1002576 Ga0209995_10025762 311
386 3300027682 Ga0209971_1020908 Ga0209971_10209082 311
387 3300027907 Ga0207428_10005229 Ga0207428_100052296 311
388 3300027907 Ga0207428_10044623 Ga0207428_100446233 311
389 3300028379 Ga0268266_10132873 Ga0268266_101328733 311
390 3300042530 Ga0450916_011267 Ga0450916_011267_69_1043 311
391 3300048904 Ga0496101_0014428 Ga0496101_0014428_3007_3981 311
392 3300048905 Ga0496102_0264037 Ga0496102_0264037_11_985 311
393 3300048909 Ga0496106_0158479 Ga0496106_0158479_259_1233 311
394 3300048911 Ga0496108_0026594 Ga0496108_0026594_2712_3686 311
395 3300048913 Ga0496110_0002686 Ga0496110_0002686_8239_9213 311
396 3300048914 Ga0496111_0015962 Ga0496111_0015962_2787_3761 311
397 3300048917 Ga0496114_0106406 Ga0496114_0106406_972_1931 311
398 3300050508 nmdc:mga09592_40461_c1 nmdc:mga09592_40461_c1_202_1167 311
399 3300050509 nmdc:mga0qj67_38194_c1 nmdc:mga0qj67_38194_c1_719_1681 311
400 3300050510 nmdc:mga06r32_77532_c1 nmdc:mga06r32_77532_c1_2164_3126 311
401 3300050511 nmdc:mga08y16_1491_c1 nmdc:mga08y16_1491_c1_16501_17466 311
402 3300050511 nmdc:mga08y16_224691_c1 nmdc:mga08y16_224691_c1_465_1424 311
403 3300005290 Ga0065712_10135169 Ga0065712_101351691 312
404 3300005329 Ga0070683_100013594 Ga0070683_1000135944 312
405 3300005331 Ga0070670_100000483 Ga0070670_10000048324 312
406 3300005338 Ga0068868_100000421 Ga0068868_1000004215 312
407 3300005340 Ga0070689_100102376 Ga0070689_1001023762 312
408 3300005344 Ga0070661_100002938 Ga0070661_1000029387 312
409 3300005347 Ga0070668_100304915 Ga0070668_1003049151 312
410 3300005354 Ga0070675_100135125 Ga0070675_1001351252 312
411 3300005354 Ga0070675_100277660 Ga0070675_1002776602 312
412 3300005364 Ga0070673_100008587 Ga0070673_1000085876 312
413 3300005367 Ga0070667_100209236 Ga0070667_1002092362 312
414 3300005444 Ga0070694_100094041 Ga0070694_1000940412 312
415 3300005456 Ga0070678_100002597 Ga0070678_1000025979 312
416 3300005456 Ga0070678_100056346 Ga0070678_1000563462 312
417 3300005458 Ga0070681_10044687 Ga0070681_100446873 312
418 3300005459 Ga0068867_100015279 Ga0068867_1000152794 312
419 3300005467 Ga0070706_100060112 Ga0070706_1000601123 312
420 3300005468 Ga0070707_100017332 Ga0070707_1000173327 312
421 3300005536 Ga0070697_100173121 Ga0070697_1001731211 312
422 3300005543 Ga0070672_100000856 Ga0070672_1000008563 312
423 3300005544 Ga0070686_100171091 Ga0070686_1001710911 312
424 3300005548 Ga0070665_100263154 Ga0070665_1002631542 312
425 3300005564 Ga0070664_100369932 Ga0070664_1003699321 312
426 3300005578 Ga0068854_100011066 Ga0068854_1000110665 312
427 3300005615 Ga0070702_100038175 Ga0070702_1000381752 312
428 3300005616 Ga0068852_100010934 Ga0068852_1000109342 312
429 3300005617 Ga0068859_100398820 Ga0068859_1003988202 312
430 3300005618 Ga0068864_100032913 Ga0068864_1000329132 312
431 3300005618 Ga0068864_100051979 Ga0068864_1000519792 312
432 3300005834 Ga0068851_10120327 Ga0068851_101203272 312
433 3300005841 Ga0068863_100143398 Ga0068863_1001433982 312
434 3300006163 Ga0070715_10095912 Ga0070715_100959122 312
435 3300006173 Ga0070716_100001401 Ga0070716_1000014014 312
436 3300006237 Ga0097621_100008507 Ga0097621_1000085075 312
437 3300006237 Ga0097621_100210972 Ga0097621_1002109722 312
438 3300006358 Ga0068871_100000437 Ga0068871_10000043723 312
439 3300006931 Ga0097620_100398850 Ga0097620_1003988502 312
440 3300009094 Ga0111539_10237065 Ga0111539_102370652 312
441 3300009094 Ga0111539_10374209 Ga0111539_103742092 312
442 3300009098 Ga0105245_10493467 Ga0105245_104934671 312
443 3300009148 Ga0105243_10093022 Ga0105243_100930222 312
444 3300009176 Ga0105242_10113883 Ga0105242_101138832 312
445 3300009553 Ga0105249_10035327 Ga0105249_100353273 312
446 3300011119 Ga0105246_10331506 Ga0105246_103315062 312
447 3300013296 Ga0157374_10140639 Ga0157374_101406393 312
448 3300013296 Ga0157374_10391766 Ga0157374_103917661 312
449 3300013297 Ga0157378_10161624 Ga0157378_101616242 312
450 3300014969 Ga0157376_10688514 Ga0157376_106885141 312
451 3300017792 Ga0163161_10326356 Ga0163161_103263562 312
452 3300025321 Ga0207656_10090936 Ga0207656_100909361 312
453 3300025901 Ga0207688_10091329 Ga0207688_100913291 312
454 3300025905 Ga0207685_10118635 Ga0207685_101186351 312
455 3300025907 Ga0207645_10030250 Ga0207645_100302503 312
456 3300025908 Ga0207643_10057136 Ga0207643_100571362 312
457 3300025912 Ga0207707_10088495 Ga0207707_100884952 312
458 3300025925 Ga0207650_10003351 Ga0207650_100033514 312
459 3300025926 Ga0207659_10000560 Ga0207659_100005602 312
460 3300025926 Ga0207659_10013837 Ga0207659_100138374 312
461 3300025939 Ga0207665_10003318 Ga0207665_100033184 312
462 3300025940 Ga0207691_10001135 Ga0207691_1000113519 312
463 3300025940 Ga0207691_10244947 Ga0207691_102449472 312
464 3300025942 Ga0207689_10016087 Ga0207689_100160874 312
465 3300025944 Ga0207661_10100171 Ga0207661_101001712 312
466 3300025945 Ga0207679_10310384 Ga0207679_103103842 312
467 3300025960 Ga0207651_10029360 Ga0207651_100293602 312
468 3300025972 Ga0207668_10318300 Ga0207668_103183002 312
469 3300025981 Ga0207640_10126403 Ga0207640_101264032 312
470 3300026035 Ga0207703_10161203 Ga0207703_101612032 312
471 3300026075 Ga0207708_10032394 Ga0207708_100323943 312
472 3300026089 Ga0207648_10051455 Ga0207648_100514553 312
473 3300026095 Ga0207676_10001530 Ga0207676_100015306 312
474 3300026095 Ga0207676_10010953 Ga0207676_100109535 312
475 3300026116 Ga0207674_10256706 Ga0207674_102567062 312
476 3300026121 Ga0207683_10000394 Ga0207683_1000039431 312
477 3300026121 Ga0207683_10319053 Ga0207683_103190532 312
478 3300028577 Ga0265318_10011303 Ga0265318_100113033 312
479 3300028577 Ga0265318_10041206 Ga0265318_100412062 312
480 3300031235 Ga0265330_10040994 Ga0265330_100409941 312
481 3300031238 Ga0265332_10001271 Ga0265332_1000127116 312
482 3300031238 Ga0265332_10001357 Ga0265332_100013572 312
483 3300031239 Ga0265328_10011152 Ga0265328_100111523 312
484 3300031239 Ga0265328_10013797 Ga0265328_100137972 312
485 3300031240 Ga0265320_10014112 Ga0265320_100141123 312
486 3300031240 Ga0265320_10031292 Ga0265320_100312922 312
487 3300031250 Ga0265331_10001190 Ga0265331_100011904 312
488 3300031250 Ga0265331_10001292 Ga0265331_100012927 312
489 3300031250 Ga0265331_10019878 Ga0265331_100198783 312
490 3300031251 Ga0265327_10031784 Ga0265327_100317843 312
491 3300031711 Ga0265314_10005591 Ga0265314_100055913 312
492 3300031711 Ga0265314_10019279 Ga0265314_100192792 312
493 3300031712 Ga0265342_10023351 Ga0265342_100233512 312
494 3300045051 Ga0451576_0162512 Ga0451576_0162512_340_1320 312
495 3300045836 Ga0466958_0199976 Ga0466958_0199976_152_1126 312
496 3300046537 Ga0495598_0014722 Ga0495598_0014722_298_1278 312
497 3300046664 Ga0495659_0039725 Ga0495659_0039725_202_1203 312
498 3300046684 Ga0495669_0012847 Ga0495669_0012847_270_1250 312
499 3300050511 nmdc:mga08y16_324312_c1 nmdc:mga08y16_324312_c1_563_1525 312
500 3300050513 nmdc:mga0rr50_173907_c1 nmdc:mga0rr50_173907_c1_51_1031 312
501 3300005329 Ga0070683_100009923 Ga0070683_10000992310 313
502 3300005330 Ga0070690_100143099 Ga0070690_1001430992 313
503 3300005331 Ga0070670_100037537 Ga0070670_1000375372 313
504 3300005331 Ga0070670_100185270 Ga0070670_1001852702 313
505 3300005333 Ga0070677_10024668 Ga0070677_100246682 313
506 3300005335 Ga0070666_10017096 Ga0070666_100170962 313
507 3300005338 Ga0068868_100006019 Ga0068868_10000601911 313
508 3300005338 Ga0068868_100011660 Ga0068868_1000116603 313
509 3300005339 Ga0070660_100085657 Ga0070660_1000856572 313
510 3300005347 Ga0070668_100193293 Ga0070668_1001932932 313
511 3300005354 Ga0070675_100029057 Ga0070675_1000290572 313
512 3300005355 Ga0070671_100010384 Ga0070671_1000103844 313
513 3300005355 Ga0070671_100026402 Ga0070671_1000264023 313
514 3300005356 Ga0070674_100020518 Ga0070674_1000205182 313
515 3300005364 Ga0070673_100129300 Ga0070673_1001293002 313
516 3300005364 Ga0070673_100181856 Ga0070673_1001818562 313
517 3300005365 Ga0070688_100100052 Ga0070688_1001000522 313
518 3300005441 Ga0070700_100026460 Ga0070700_1000264601 313
519 3300005444 Ga0070694_100179028 Ga0070694_1001790282 313
520 3300005456 Ga0070678_100003940 Ga0070678_1000039404 313
521 3300005456 Ga0070678_100172825 Ga0070678_1001728251 313
522 3300005456 Ga0070678_100243805 Ga0070678_1002438052 313
523 3300005457 Ga0070662_100333670 Ga0070662_1003336701 313
524 3300005458 Ga0070681_10133033 Ga0070681_101330332 313
525 3300005467 Ga0070706_100023816 Ga0070706_1000238165 313
526 3300005535 Ga0070684_100198522 Ga0070684_1001985222 313
527 3300005536 Ga0070697_100224505 Ga0070697_1002245052 313
528 3300005543 Ga0070672_100088638 Ga0070672_1000886382 313
529 3300005564 Ga0070664_100092960 Ga0070664_1000929603 313
530 3300005578 Ga0068854_100004773 Ga0068854_1000047732 313
531 3300005578 Ga0068854_100398249 Ga0068854_1003982491 313
532 3300005616 Ga0068852_100058250 Ga0068852_1000582504 313
533 3300005617 Ga0068859_100072696 Ga0068859_1000726963 313
534 3300005718 Ga0068866_10023077 Ga0068866_100230773 313
535 3300005719 Ga0068861_100049628 Ga0068861_1000496282 313
536 3300005840 Ga0068870_10045907 Ga0068870_100459072 313
537 3300005840 Ga0068870_10162374 Ga0068870_101623742 313
538 3300005842 Ga0068858_100059116 Ga0068858_1000591163 313
539 3300005844 Ga0068862_100109561 Ga0068862_1001095612 313
540 3300006237 Ga0097621_100071128 Ga0097621_1000711282 313
541 3300006358 Ga0068871_100010311 Ga0068871_1000103114 313
542 3300006844 Ga0075428_100002635 Ga0075428_1000026353 313
543 3300006844 Ga0075428_100006285 Ga0075428_1000062858 313
544 3300006880 Ga0075429_100005895 Ga0075429_10000589511 313
545 3300006880 Ga0075429_100041179 Ga0075429_1000411792 313
546 3300006914 Ga0075436_100029510 Ga0075436_1000295102 313
547 3300006931 Ga0097620_100072698 Ga0097620_1000726982 313
548 3300007076 Ga0075435_100317543 Ga0075435_1003175431 313
549 3300009094 Ga0111539_10001180 Ga0111539_1000118022 313
550 3300009094 Ga0111539_10002096 Ga0111539_1000209634 313
551 3300009094 Ga0111539_10017884 Ga0111539_100178846 313
552 3300009098 Ga0105245_10052676 Ga0105245_100526763 313
553 3300009147 Ga0114129_10133238 Ga0114129_101332382 313
554 3300009148 Ga0105243_10021111 Ga0105243_100211113 313
555 3300009176 Ga0105242_10003850 Ga0105242_100038506 313
556 3300009177 Ga0105248_10133730 Ga0105248_101337302 313
557 3300011119 Ga0105246_10087302 Ga0105246_100873022 313
558 3300013296 Ga0157374_10074917 Ga0157374_100749173 313
559 3300013296 Ga0157374_10199794 Ga0157374_101997941 313
560 3300013296 Ga0157374_10538577 Ga0157374_105385771 313
561 3300013297 Ga0157378_10225251 Ga0157378_102252512 313
562 3300013306 Ga0163162_10441658 Ga0163162_104416582 313
563 3300013308 Ga0157375_10056907 Ga0157375_100569074 313
564 3300014325 Ga0163163_10255438 Ga0163163_102554381 313
565 3300014326 Ga0157380_10624835 Ga0157380_106248351 313
566 3300014969 Ga0157376_10151113 Ga0157376_101511131 313
567 3300014969 Ga0157376_10206101 Ga0157376_102061012 313
568 3300025315 Ga0207697_10009842 Ga0207697_100098424 313
569 3300025893 Ga0207682_10000357 Ga0207682_1000035718 313
570 3300025901 Ga0207688_10011506 Ga0207688_100115064 313
571 3300025907 Ga0207645_10004168 Ga0207645_100041683 313
572 3300025908 Ga0207643_10048771 Ga0207643_100487713 313
573 3300025910 Ga0207684_10020818 Ga0207684_100208183 313
574 3300025912 Ga0207707_10121135 Ga0207707_101211352 313
575 3300025918 Ga0207662_10002375 Ga0207662_100023756 313
576 3300025919 Ga0207657_10127936 Ga0207657_101279362 313
577 3300025922 Ga0207646_10215205 Ga0207646_102152051 313
578 3300025923 Ga0207681_10435155 Ga0207681_104351551 313
579 3300025925 Ga0207650_10004207 Ga0207650_100042073 313
580 3300025925 Ga0207650_10117285 Ga0207650_101172852 313
581 3300025926 Ga0207659_10010536 Ga0207659_100105363 313
582 3300025931 Ga0207644_10018134 Ga0207644_100181344 313
583 3300025937 Ga0207669_10037446 Ga0207669_100374462 313
584 3300025940 Ga0207691_10148708 Ga0207691_101487083 313
585 3300025941 Ga0207711_10220645 Ga0207711_102206452 313
586 3300025942 Ga0207689_10104955 Ga0207689_101049552 313
587 3300025944 Ga0207661_10004804 Ga0207661_100048045 313
588 3300025960 Ga0207651_10099193 Ga0207651_100991932 313
589 3300025960 Ga0207651_10163784 Ga0207651_101637841 313
590 3300025961 Ga0207712_10081065 Ga0207712_100810653 313
591 3300025972 Ga0207668_10239559 Ga0207668_102395592 313
592 3300025981 Ga0207640_10006330 Ga0207640_100063302 313
593 3300026023 Ga0207677_10008476 Ga0207677_100084765 313
594 3300026023 Ga0207677_10290309 Ga0207677_102903092 313
595 3300026035 Ga0207703_10191819 Ga0207703_101918192 313
596 3300026075 Ga0207708_10015469 Ga0207708_100154693 313
597 3300026089 Ga0207648_10081090 Ga0207648_100810904 313
598 3300026095 Ga0207676_10009887 Ga0207676_100098873 313
599 3300026095 Ga0207676_10077278 Ga0207676_100772783 313
600 3300026116 Ga0207674_10029837 Ga0207674_100298374 313
601 3300026118 Ga0207675_100034340 Ga0207675_1000343402 313
602 3300026121 Ga0207683_10000838 Ga0207683_1000083817 313
603 3300026121 Ga0207683_10210851 Ga0207683_102108512 313
604 3300026142 Ga0207698_10103902 Ga0207698_101039022 313
605 3300027907 Ga0207428_10008952 Ga0207428_100089523 313
606 3300027907 Ga0207428_10028036 Ga0207428_100280362 313
607 3300035691 Ga0373931_0220396 Ga0373931_0220396_32_1006 313
608 3300046683 Ga0495658_0212791 Ga0495658_0212791_207_1169 313
609 3300047471 Ga0495684_0345303 Ga0495684_0345303_40_1014 313
610 3300048907 Ga0496104_0216286 Ga0496104_0216286_256_1281 313
611 3300048911 Ga0496108_0069581 Ga0496108_0069581_1432_2457 313
612 3300048911 Ga0496108_0279729 Ga0496108_0279729_406_1371 313
613 3300048913 Ga0496110_0022962 Ga0496110_0022962_1129_2154 313
614 3300050507 nmdc:mga05p37_96388_c1 nmdc:mga05p37_96388_c1_293_1333 313
615 3300050508 nmdc:mga09592_81116_c1 nmdc:mga09592_81116_c1_726_1766 313
616 3300050511 nmdc:mga08y16_14449_c1 nmdc:mga08y16_14449_c1_6146_7186 313
617 3300050514 nmdc:mga08x19_35077_c1 nmdc:mga08x19_35077_c1_2076_3050 313
618 iso_pu_bacteria 2881101125 2881105363 313
619 3300005343 Ga0070687_100189671 Ga0070687_1001896712 314
620 3300005354 Ga0070675_100062904 Ga0070675_1000629042 314
621 3300005458 Ga0070681_10063499 Ga0070681_100634991 314
622 3300005471 Ga0070698_100000120 Ga0070698_10000012034 314
623 3300005544 Ga0070686_100271527 Ga0070686_1002715271 314
624 3300005617 Ga0068859_100607429 Ga0068859_1006074292 314
625 3300005937 Ga0081455_10000164 Ga0081455_100001648 314
626 3300005937 Ga0081455_10001486 Ga0081455_1000148616 314
627 3300005985 Ga0081539_10007960 Ga0081539_100079607 314
628 3300006038 Ga0075365_10232852 Ga0075365_102328522 314
629 3300006048 Ga0075363_100029258 Ga0075363_1000292583 314
630 3300006177 Ga0075362_10011395 Ga0075362_100113952 314
631 3300006178 Ga0075367_10010209 Ga0075367_100102094 314
632 3300006186 Ga0075369_10065672 Ga0075369_100656722 314
633 3300006195 Ga0075366_10045257 Ga0075366_100452572 314
634 3300006353 Ga0075370_10096697 Ga0075370_100966972 314
635 3300006844 Ga0075428_100112140 Ga0075428_1001121402 314
636 3300006846 Ga0075430_100313143 Ga0075430_1003131432 314
637 3300006931 Ga0097620_100607488 Ga0097620_1006074881 314
638 3300007265 Ga0099794_10138818 Ga0099794_101388181 314
639 3300009094 Ga0111539_10011072 Ga0111539_100110726 314
640 3300009094 Ga0111539_10412471 Ga0111539_104124712 314
641 3300025910 Ga0207684_10064722 Ga0207684_100647222 314
642 3300025926 Ga0207659_10134348 Ga0207659_101343482 314
643 3300026116 Ga0207674_10498384 Ga0207674_104983842 314
644 3300027907 Ga0207428_10004110 Ga0207428_100041105 314
645 3300028380 Ga0268265_10202796 Ga0268265_102027962 314
646 3300035691 Ga0373931_0136655 Ga0373931_0136655_208_1167 314
647 3300041413 Ga0439465_0055117 Ga0439465_0055117_116_1075 314
648 3300042115 Ga0450911_008045 Ga0450911_008045_191_1180 314
649 3300044842 Ga0466957_0040678 Ga0466957_0040678_1075_2061 314
650 3300049571 Ga0501034_0000757 Ga0501034_0000757_3417_4376 314
651 3300049586 Ga0501070_0036662 Ga0501070_0036662_413_1390 314
652 3300049590 Ga0501074_0063465 Ga0501074_0063465_422_1399 314
653 3300049824 Ga0501045_0140929 Ga0501045_0140929_594_1577 314
654 3300050489 nmdc:mga03683_52895_c1 nmdc:mga03683_52895_c1_455_1414 314
655 3300050492 nmdc:mga0yw44_137659_c1 nmdc:mga0yw44_137659_c1_341_1300 314
656 3300050494 nmdc:mga06z11_52052_c1 nmdc:mga06z11_52052_c1_717_1676 314
657 3300050507 nmdc:mga05p37_365445_c1 nmdc:mga05p37_365445_c1_12_977 314
658 3300050508 nmdc:mga09592_16139_c1 nmdc:mga09592_16139_c1_4145_5110 314
659 3300050511 nmdc:mga08y16_23154_c1 nmdc:mga08y16_23154_c1_3529_4494 314
660 3300053093 Ga0500651_0201372 Ga0500651_0201372_159_1118 314
661 3300053096 Ga0500641_0002167 Ga0500641_0002167_921_1883 314
662 3300053153 Ga0500616_0001277 Ga0500616_0001277_16887_17846 314
663 3300053733 Ga0500552_000068 Ga0500552_000068_1815_2774 314
664 3300005333 Ga0070677_10015234 Ga0070677_100152343 315
665 3300005335 Ga0070666_10039114 Ga0070666_100391145 315
666 3300005338 Ga0068868_100108964 Ga0068868_1001089642 315
667 3300005340 Ga0070689_100360338 Ga0070689_1003603381 315
668 3300005347 Ga0070668_100218808 Ga0070668_1002188082 315
669 3300005355 Ga0070671_100052140 Ga0070671_1000521403 315
670 3300005367 Ga0070667_100300881 Ga0070667_1003008811 315
671 3300005441 Ga0070700_100078837 Ga0070700_1000788372 315
672 3300005456 Ga0070678_100313418 Ga0070678_1003134182 315
673 3300005457 Ga0070662_100089304 Ga0070662_1000893042 315
674 3300005543 Ga0070672_100040680 Ga0070672_1000406804 315
675 3300005547 Ga0070693_100252069 Ga0070693_1002520691 315
676 3300005548 Ga0070665_100059038 Ga0070665_1000590381 315
677 3300005564 Ga0070664_100337333 Ga0070664_1003373331 315
678 3300005578 Ga0068854_100048908 Ga0068854_1000489082 315
679 3300005618 Ga0068864_100085741 Ga0068864_1000857412 315
680 3300005718 Ga0068866_10174747 Ga0068866_101747471 315
681 3300005719 Ga0068861_100027261 Ga0068861_1000272614 315
682 3300005840 Ga0068870_10027623 Ga0068870_100276233 315
683 3300005841 Ga0068863_100101849 Ga0068863_1001018492 315
684 3300005843 Ga0068860_100229119 Ga0068860_1002291192 315
685 3300005844 Ga0068862_100077340 Ga0068862_1000773402 315
686 3300006178 Ga0075367_10027710 Ga0075367_100277104 315
687 3300006186 Ga0075369_10000327 Ga0075369_1000032715 315
688 3300006237 Ga0097621_100059196 Ga0097621_1000591963 315
689 3300006353 Ga0075370_10010206 Ga0075370_100102064 315
690 3300006358 Ga0068871_100031597 Ga0068871_1000315974 315
691 3300006881 Ga0068865_100037331 Ga0068865_1000373312 315
692 3300009094 Ga0111539_10209544 Ga0111539_102095443 315
693 3300009177 Ga0105248_10218854 Ga0105248_102188542 315
694 3300009553 Ga0105249_10129402 Ga0105249_101294022 315
695 3300013308 Ga0157375_10228828 Ga0157375_102288282 315
696 3300014326 Ga0157380_10257517 Ga0157380_102575172 315
697 3300014969 Ga0157376_10150259 Ga0157376_101502592 315
698 3300025302 Ga0207426_1025807 Ga0207426_10258072 315
699 3300025315 Ga0207697_10010166 Ga0207697_100101662 315
700 3300025321 Ga0207656_10059441 Ga0207656_100594412 315
701 3300025893 Ga0207682_10005572 Ga0207682_100055722 315
702 3300025899 Ga0207642_10017872 Ga0207642_100178722 315
703 3300025907 Ga0207645_10007892 Ga0207645_100078921 315
704 3300025918 Ga0207662_10025381 Ga0207662_100253814 315
705 3300025927 Ga0207687_10165451 Ga0207687_101654512 315
706 3300025934 Ga0207686_10018785 Ga0207686_100187854 315
707 3300025945 Ga0207679_10140576 Ga0207679_101405761 315
708 3300025981 Ga0207640_10014232 Ga0207640_100142322 315
709 3300026075 Ga0207708_10088231 Ga0207708_100882312 315
710 3300026088 Ga0207641_10077131 Ga0207641_100771313 315
711 3300026089 Ga0207648_10057495 Ga0207648_100574954 315
712 3300026095 Ga0207676_10001708 Ga0207676_1000170814 315
713 3300026118 Ga0207675_100390126 Ga0207675_1003901262 315
714 3300026121 Ga0207683_10000419 Ga0207683_100004192 315
715 3300027360 Ga0209969_1003060 Ga0209969_10030602 315
716 3300027364 Ga0209967_1015138 Ga0209967_10151382 315
717 3300027471 Ga0209995_1000757 Ga0209995_10007575 315
718 3300027526 Ga0209968_1005253 Ga0209968_10052532 315
719 3300027543 Ga0209999_1007031 Ga0209999_10070313 315
720 3300027682 Ga0209971_1016569 Ga0209971_10165693 315
721 3300027876 Ga0209974_10009049 Ga0209974_100090493 315
722 3300028379 Ga0268266_10168755 Ga0268266_101687552 315
723 3300028381 Ga0268264_10176359 Ga0268264_101763594 315
724 3300031903 Ga0307407_10186751 Ga0307407_101867511 315
725 3300046528 Ga0495642_0013141 Ga0495642_0013141_1183_2175 315
726 3300046684 Ga0495669_0018200 Ga0495669_0018200_1066_2058 315
727 3300048912 Ga0496109_0233233 Ga0496109_0233233_77_1045 315
728 3300050494 nmdc:mga06z11_4551_c1 nmdc:mga06z11_4551_c1_1798_2760 315
729 3300050496 nmdc:mga07m45_2091_c2 nmdc:mga07m45_2091_c2_2042_3004 315
730 3300050516 nmdc:mga0sz30_629_c1 nmdc:mga0sz30_629_c1_8233_9195 315
731 3300003792 Ga0055540_1000654 Ga0055540_100065415 316
732 3300005328 Ga0070676_10027201 Ga0070676_100272013 316
733 3300005330 Ga0070690_100020953 Ga0070690_1000209531 316
734 3300005333 Ga0070677_10007754 Ga0070677_100077543 316
735 3300005334 Ga0068869_100166393 Ga0068869_1001663932 316
736 3300005335 Ga0070666_10031393 Ga0070666_100313932 316
737 3300005347 Ga0070668_100027916 Ga0070668_1000279162 316
738 3300005353 Ga0070669_100095430 Ga0070669_1000954302 316
739 3300005355 Ga0070671_100030090 Ga0070671_1000300901 316
740 3300005364 Ga0070673_100024852 Ga0070673_1000248523 316
741 3300005365 Ga0070688_100012765 Ga0070688_1000127654 316
742 3300005367 Ga0070667_100304079 Ga0070667_1003040791 316
743 3300005440 Ga0070705_100115222 Ga0070705_1001152222 316
744 3300005441 Ga0070700_100011392 Ga0070700_1000113922 316
745 3300005456 Ga0070678_100010672 Ga0070678_1000106723 316
746 3300005543 Ga0070672_100057319 Ga0070672_1000573192 316
747 3300005615 Ga0070702_100013023 Ga0070702_1000130232 316
748 3300005840 Ga0068870_10026086 Ga0068870_100260862 316
749 3300005841 Ga0068863_100043608 Ga0068863_1000436083 316
750 3300005843 Ga0068860_100066252 Ga0068860_1000662523 316
751 3300006237 Ga0097621_100097369 Ga0097621_1000973692 316
752 3300006881 Ga0068865_100063041 Ga0068865_1000630413 316
753 3300009094 Ga0111539_10312331 Ga0111539_103123312 316
754 3300017792 Ga0163161_10060246 Ga0163161_100602461 316
755 3300025284 Ga0209130_1029636 Ga0209130_10296361 316
756 3300025315 Ga0207697_10016138 Ga0207697_100161383 316
757 3300025893 Ga0207682_10003947 Ga0207682_100039476 316
758 3300025908 Ga0207643_10010167 Ga0207643_100101673 316
759 3300025925 Ga0207650_10283183 Ga0207650_102831832 316
760 3300025931 Ga0207644_10322348 Ga0207644_103223482 316
761 3300025933 Ga0207706_10204627 Ga0207706_102046272 316
762 3300025935 Ga0207709_10156843 Ga0207709_101568431 316
763 3300025936 Ga0207670_10079597 Ga0207670_100795972 316
764 3300025940 Ga0207691_10256133 Ga0207691_102561332 316
765 3300025942 Ga0207689_10063485 Ga0207689_100634851 316
766 3300026075 Ga0207708_10068726 Ga0207708_100687262 316
767 3300026088 Ga0207641_10036559 Ga0207641_100365593 316
768 3300026089 Ga0207648_10029616 Ga0207648_100296164 316
769 3300026095 Ga0207676_10056986 Ga0207676_100569862 316
770 3300026118 Ga0207675_100079449 Ga0207675_1000794493 316
771 3300026121 Ga0207683_10009959 Ga0207683_100099597 316
772 3300028381 Ga0268264_10032681 Ga0268264_100326813 316
773 3300037312 Ga0395899_0160266 Ga0395899_0160266_567_1541 316
774 3300037466 Ga0395898_0043767 Ga0395898_0043767_1211_2185 316
775 3300038443 Ga0395901_0153886 Ga0395901_0153886_813_1787 316
776 3300049823 Ga0501044_0058415 Ga0501044_0058415_2177_3151 316
777 3300050511 nmdc:mga08y16_72372_c1 nmdc:mga08y16_72372_c1_633_1598 316
778 3300031903 Ga0307407_10095996 Ga0307407_100959962 317
779 3300032005 Ga0307411_10069604 Ga0307411_100696042 317
780 3300048928 Ga0496125_0023065 Ga0496125_0023065_1895_2890 317
781 3300048929 Ga0496126_0261173 Ga0496126_0261173_42_1037 317
782 iso_pu_bacteria 2929199973 2929200058 317
783 iso_pu_bacteria 8055909800 8055915326 317
784 3300009094 Ga0111539_10076202 Ga0111539_100762023 318
785 3300009148 Ga0105243_10058198 Ga0105243_100581982 318
786 3300009176 Ga0105242_10037532 Ga0105242_100375323 318
787 3300013297 Ga0157378_10083852 Ga0157378_100838522 318
788 3300013306 Ga0163162_10145969 Ga0163162_101459691 318
789 3300025907 Ga0207645_10003942 Ga0207645_100039429 318
790 3300031548 Ga0307408_100070885 Ga0307408_1000708854 318
791 3300031731 Ga0307405_10048627 Ga0307405_100486272 318
792 3300032005 Ga0307411_10343262 Ga0307411_103432622 318
793 3300048924 Ga0496121_0003189 Ga0496121_0003189_3151_4170 318
794 3300049575 Ga0501039_0047730 Ga0501039_0047730_1622_2623 318
795 3300049582 Ga0501048_0081578 Ga0501048_0081578_405_1406 318
796 3300049584 Ga0501068_0111011 Ga0501068_0111011_574_1575 318
797 3300049587 Ga0501071_0021374 Ga0501071_0021374_1417_2418 318
798 3300049743 Ga0501081_0013808 Ga0501081_0013808_688_1689 318
799 3300049824 Ga0501045_0108351 Ga0501045_0108351_252_1253 318
800 3300050511 nmdc:mga08y16_274053_c1 nmdc:mga08y16_274053_c1_18_1010 318
801 3300060353 Ga0501082_0366927 Ga0501082_0366927_61_1062 318
802 3300061734 Ga0530510_0061007 Ga0530510_0061007_721_1722 318
803 3300049571 Ga0501034_0366251 Ga0501034_0366251_298_1305 319
804 3300048904 Ga0496101_0053523 Ga0496101_0053523_642_1652 320
805 3300003203 JGI25406J46586_10000707 JGI25406J46586_100007079 323
806 3300005985 Ga0081539_10000054 Ga0081539_10000054201 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

73

347

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9519 27 323
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9488 27 323
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9474 26 323
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9443 26 323
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9328 30 320
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9501 125 248 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9429 125 248 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9425 125 248 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9357 125 248 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9286 125 248 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4R1YI10-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9755 92 323
AF-A0A7H0GIP4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9724 51 323
AF-A0A536XT46-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9705 55 323
AF-J2SVG2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9696 53 323
AF-A0A439F197-F1-model_v4 deleted 0.9681 80 323

Feature Viewer

pLDDT pTM Quality
91.4 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map