F481664

General Info

Members Datasets Scaffolds Average Seq Length
806 278 743 132

Family's Representative Sequence

Representative Sequence 3300049459|Ga0495678_215765|Ga0495678_215765_57_479
Length 140
Sequence MTDSRRPYDAVQPEPIDDNEDRMGSVHELDFDEDEPSAKIGDEIPEREREQLMPNERVREAGMTGASVADHEPTDDDMSPETLIHEDGARDAEEAGEGNQADWDLSIVDEDDIGGGNGLDEAELGSAIRWTANADKRDPL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231022 Pseudomonas sp. GM79 Isolate Nodule
10 2511231023 Pseudomonas sp. GM80 Isolate Nodule
11 2511231031 Pseudomonas sp. GM16 Isolate Nodule
12 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
13 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
14 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
15 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
16 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
17 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
18 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
19 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
20 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
21 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
22 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
23 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
24 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
25 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
26 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
27 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
28 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
29 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
30 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
31 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
32 2773857673 Pseudomonas sp. 443 Isolate Unclassified
33 2784132063 Pseudomonas sp. 424 Isolate Unclassified
34 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
35 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
36 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
37 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
38 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
39 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
40 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
41 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
42 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
43 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
44 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
45 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
46 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
47 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
48 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
49 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
50 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
51 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
52 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
53 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
54 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
55 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
56 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
57 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
58 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
133 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
143 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
144 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
145 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
146 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
149 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
150 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
151 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
152 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
153 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
154 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
155 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
156 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
163 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
268 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
269 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
270 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
271 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
272 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
273 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
274 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
275 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
276 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
277 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
278 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.06
Metatranscriptomes 0.12
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 1.36
Rhizoplane 2.61
Rhizosphere 83.5
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_25852 2124908027 Bacteria 1548
2 JGI24741J21665_1049620 3300001915 Bacteria 617
3 Ga0006562J51391_1006713 3300003578 Bacteria 530
4 Ga0055525_1007004 3300003759 Bacteria 953
5 Ga0055536_1000790 3300003781 Bacteria 21068
6 Ga0055530_10001612 3300003791 Bacteria 16180
7 Ga0055540_1000505 3300003792 Bacteria 29657
8 Ga0055531_10000123 3300003794 Bacteria 86722
9 Ga0065714_10075709 3300005288 Bacteria 2874
10 Ga0065714_10240022 3300005288 Bacteria 797
11 Ga0065714_10275559 3300005288 Bacteria 732
12 Ga0065714_10312226 3300005288 Bacteria 679
13 Ga0065704_10366959 3300005289 Bacteria 774
14 Ga0065712_10092601 3300005290 Bacteria 2326
15 Ga0070670_100480426 3300005331 Bacteria 1103
16 Ga0070669_100000452 3300005353 Bacteria 31263
17 Ga0070669_100003010 3300005353 Bacteria 12139
18 Ga0070671_100233225 3300005355 Bacteria 1562
19 Ga0070659_100447710 3300005366 Bacteria 1095
20 Ga0070662_100006733 3300005457 Bacteria 7427
21 Ga0070662_100021712 3300005457 Bacteria 4387
22 Ga0068853_100001380 3300005539 Bacteria 17535
23 Ga0070665_100176958 3300005548 Bacteria 2134
24 Ga0070665_100224375 3300005548 Bacteria 1879
25 Ga0070665_100782981 3300005548 Bacteria 967
26 Ga0070664_100818306 3300005564 Bacteria 871
27 Ga0068854_100004527 3300005578 Bacteria 8765
28 Ga0068851_10000021 3300005834 Bacteria 132824
29 Ga0075364_10085802 3300006051 Bacteria 2085
30 Ga0075364_10173764 3300006051 Bacteria 1456
31 Ga0075364_10201021 3300006051 Bacteria 1351
32 Ga0075364_10248584 3300006051 Bacteria 1209
33 Ga0075432_10014432 3300006058 Bacteria 2691
34 Ga0075432_10047202 3300006058 Bacteria 1514
35 Ga0075432_10059207 3300006058 Bacteria 1361
36 Ga0075362_10410785 3300006177 Bacteria 684
37 Ga0075370_10917419 3300006353 Bacteria 536
38 Ga0075436_100224420 3300006914 Bacteria 1333
39 Ga0105251_10003422 3300009011 Bacteria 11511
40 Ga0105251_10006741 3300009011 Bacteria 7249
41 Ga0105251_10007701 3300009011 Bacteria 6582
42 Ga0105251_10048243 3300009011 Bacteria 2042
43 Ga0105251_10061622 3300009011 Bacteria 1763
44 Ga0105251_10089203 3300009011 Bacteria 1418
45 Ga0105251_10098250 3300009011 Bacteria 1340
46 Ga0105251_10183176 3300009011 Bacteria 943
47 Ga0105251_10210081 3300009011 Bacteria 876
48 Ga0105251_10321312 3300009011 Bacteria 703
49 Ga0105244_10008583 3300009036 Bacteria 6373
50 Ga0105244_10021816 3300009036 Bacteria 3533
51 Ga0105244_10024121 3300009036 Bacteria 3324
52 Ga0105244_10058408 3300009036 Bacteria 1947
53 Ga0105244_10067215 3300009036 Bacteria 1793
54 Ga0105244_10134070 3300009036 Bacteria 1194
55 Ga0105244_10143031 3300009036 Bacteria 1149
56 Ga0105244_10164685 3300009036 Bacteria 1057
57 Ga0105244_10175750 3300009036 Bacteria 1017
58 Ga0105244_10279122 3300009036 Bacteria 775
59 Ga0105250_10000120 3300009092 Bacteria 69464
60 Ga0105250_10001686 3300009092 Bacteria 11684
61 Ga0105250_10010112 3300009092 Bacteria 3938
62 Ga0105250_10025186 3300009092 Bacteria 2398
63 Ga0105250_10424421 3300009092 Bacteria 593
64 Ga0105240_10921729 3300009093 Bacteria 939
65 Ga0105243_10001176 3300009148 Bacteria 23688
66 Ga0105242_10851667 3300009176 Bacteria 907
67 Ga0105248_10044903 3300009177 Bacteria 4956
68 Ga0105239_12521295 3300010375 Bacteria 599
69 Ga0105239_12600188 3300010375 Bacteria 590
70 Ga0105246_10003916 3300011119 Bacteria 9014
71 Ga0105246_10165354 3300011119 Bacteria 1689
72 Ga0157345_1000042 3300012498 Bacteria 30268
73 Ga0157373_10005127 3300013100 Bacteria 9848
74 Ga0157373_10037579 3300013100 Bacteria 3471
75 Ga0157373_10259317 3300013100 Bacteria 1230
76 Ga0157373_10435287 3300013100 Bacteria 942
77 Ga0157373_10652048 3300013100 Bacteria 769
78 Ga0157373_10832782 3300013100 Bacteria 682
79 Ga0157373_10888430 3300013100 Bacteria 661
80 Ga0157370_10048778 3300013104 Bacteria 4056
81 Ga0157370_11150527 3300013104 Bacteria 701
82 Ga0157370_11155409 3300013104 Bacteria 699
83 Ga0157370_11577072 3300013104 Bacteria 590
84 Ga0157369_10004354 3300013105 Bacteria 16706
85 Ga0157369_10038595 3300013105 Bacteria 5222
86 Ga0157369_10476632 3300013105 Bacteria 1291
87 Ga0163162_10001021 3300013306 Bacteria 26003
88 Ga0163162_10250382 3300013306 Bacteria 1904
89 Ga0163162_10981054 3300013306 Bacteria 955
90 Ga0163162_11648577 3300013306 Bacteria 732
91 Ga0157372_10006828 3300013307 Bacteria 12136
92 Ga0157375_10689520 3300013308 Bacteria 1176
93 Ga0157375_10731159 3300013308 Bacteria 1142
94 Ga0182008_10004169 3300014497 Bacteria 8502
95 Ga0182008_10007900 3300014497 Bacteria 5838
96 Ga0182008_10019141 3300014497 Bacteria 3538
97 Ga0182008_10039914 3300014497 Bacteria 2345
98 Ga0182008_10155738 3300014497 Bacteria 1148
99 Ga0182006_1000508 3300015261 Bacteria 29663
100 Ga0182006_1001937 3300015261 Bacteria 11759
101 Ga0182006_1028612 3300015261 Bacteria 2265
102 Ga0182006_1058617 3300015261 Bacteria 1460
103 Ga0182006_1202151 3300015261 Bacteria 658
104 Ga0182007_10001676 3300015262 Bacteria 11745
105 Ga0182007_10065383 3300015262 Bacteria 1192
106 Ga0182005_1001052 3300015265 Bacteria 11680
107 Ga0182005_1039955 3300015265 Bacteria 1276
108 Ga0182005_1041280 3300015265 Bacteria 1254
109 Ga0182005_1088592 3300015265 Bacteria 859
110 Ga0163161_10037661 3300017792 Bacteria 3468
111 Ga0163161_10058107 3300017792 Bacteria 2811
112 Ga0163161_10220175 3300017792 Bacteria 1470
113 Ga0163161_10542554 3300017792 Bacteria 952
114 Ga0163161_10702179 3300017792 Bacteria 842
115 Ga0163161_10714808 3300017792 Bacteria 835
116 Ga0163161_10772931 3300017792 Bacteria 805
117 Ga0163161_10849413 3300017792 Bacteria 770
118 Ga0163161_10869568 3300017792 Bacteria 762
119 Ga0209563_100838 3300025230 Bacteria 9157
120 Ga0209675_1015408 3300025291 Bacteria 2270
121 Ga0209676_1000010 3300025292 Bacteria 954025
122 Ga0209050_1000866 3300025298 Bacteria 40900
123 Ga0209051_1000631 3300025303 Bacteria 40463
124 Ga0209257_1000357 3300025304 Bacteria 93431
125 Ga0207656_10000020 3300025321 Bacteria 114666
126 Ga0207696_1000052 3300025711 Bacteria 272880
127 Ga0207696_1000738 3300025711 Bacteria 21855
128 Ga0207696_1001510 3300025711 Bacteria 12479
129 Ga0207696_1016498 3300025711 Bacteria 2469
130 Ga0207655_1000723 3300025728 Bacteria 37487
131 Ga0207655_1001045 3300025728 Bacteria 27769
132 Ga0207655_1003748 3300025728 Bacteria 11149
133 Ga0207655_1006098 3300025728 Bacteria 8045
134 Ga0207655_1018817 3300025728 Bacteria 3643
135 Ga0207655_1020318 3300025728 Bacteria 3419
136 Ga0207655_1050309 3300025728 Bacteria 1695
137 Ga0207655_1055613 3300025728 Bacteria 1566
138 Ga0207655_1122133 3300025728 Bacteria 861
139 Ga0207655_1180284 3300025728 Bacteria 646
140 Ga0207713_1000990 3300025735 Bacteria 24928
141 Ga0207713_1001083 3300025735 Bacteria 23417
142 Ga0207713_1002401 3300025735 Bacteria 13683
143 Ga0207713_1006100 3300025735 Bacteria 7420
144 Ga0207713_1007286 3300025735 Bacteria 6561
145 Ga0207713_1013157 3300025735 Bacteria 4378
146 Ga0207713_1043489 3300025735 Bacteria 1856
147 Ga0207713_1048386 3300025735 Bacteria 1713
148 Ga0207713_1055790 3300025735 Bacteria 1539
149 Ga0207671_10964949 3300025914 Bacteria 672
150 Ga0207681_10000119 3300025923 Bacteria 66476
151 Ga0207681_10010462 3300025923 Bacteria 5677
152 Ga0207650_10000225 3300025925 Bacteria 63430
153 Ga0207690_10232654 3300025932 Bacteria 1416
154 Ga0207706_10000855 3300025933 Bacteria 31362
155 Ga0207706_10011726 3300025933 Bacteria 7987
156 Ga0207686_10811299 3300025934 Bacteria 751
157 Ga0207709_10000189 3300025935 Bacteria 82404
158 Ga0207711_10025554 3300025941 Bacteria 4954
159 Ga0207679_10282879 3300025945 Bacteria 1423
160 Ga0207639_10001210 3300026041 Bacteria 17542
161 Ga0207428_10042657 3300027907 Bacteria 3668
162 Ga0207428_10117365 3300027907 Bacteria 2043
163 Ga0207428_10351075 3300027907 Bacteria 1085
164 Ga0268266_10043510 3300028379 Bacteria 3838
165 Ga0268266_10369118 3300028379 Bacteria 1351
166 Ga0268266_11393891 3300028379 Bacteria 676
167 Ga0307511_10028914 3300030521 Bacteria 5018
168 Ga0307511_10380965 3300030521 Bacteria 590
169 Ga0265316_10917445 3300031344 Bacteria 611
170 Ga0307408_100005853 3300031548 Bacteria 8180
171 Ga0307405_10005315 3300031731 Bacteria 6196
172 Ga0307405_12163402 3300031731 Bacteria 500
173 Ga0307412_10030472 3300031911 Bacteria 3397
174 Ga0307412_10105526 3300031911 Bacteria 2001
175 Ga0307412_11234874 3300031911 Bacteria 670
176 Ga0307414_11482321 3300032004 Bacteria 631
177 Ga0307510_10000760 3300033180 Bacteria 33313
178 Ga0439438_013914 3300041405 Bacteria 2408
179 Ga0439438_031150 3300041405 Bacteria 1418
180 Ga0439438_133771 3300041405 Bacteria 594
181 Ga0439447_000164 3300041407 Bacteria 22655
182 Ga0439447_006486 3300041407 Bacteria 3792
183 Ga0439447_014144 3300041407 Bacteria 2244
184 Ga0439447_023228 3300041407 Bacteria 1617
185 Ga0439447_042050 3300041407 Bacteria 1110
186 Ga0439466_0010082 3300041411 Bacteria 3513
187 Ga0439466_0011032 3300041411 Bacteria 3349
188 Ga0439466_0013456 3300041411 Bacteria 2994
189 Ga0439466_0021779 3300041411 Bacteria 2267
190 Ga0439466_0099843 3300041411 Bacteria 905
191 Ga0439465_0015620 3300041413 Bacteria 2368
192 Ga0451853_3596406 3300041512 Bacteria 692
193 Ga0439432_000107 3300042006 Bacteria 26714
194 Ga0439432_017184 3300042006 Bacteria 2430
195 Ga0439432_017202 3300042006 Bacteria 2428
196 Ga0439432_058894 3300042006 Bacteria 1187
197 Ga0439451_001663 3300042009 Bacteria 4416
198 Ga0439451_002456 3300042009 Bacteria 3756
199 Ga0439452_003943 3300042010 Bacteria 5085
200 Ga0439456_001367 3300042013 Bacteria 4878
201 Ga0439456_036059 3300042013 Bacteria 1066
202 Ga0439463_001373 3300042016 Bacteria 6482
203 Ga0439463_094381 3300042016 Bacteria 770
204 Ga0450911_002116 3300042115 Bacteria 4055
205 Ga0450919_002151 3300042121 Bacteria 2566
206 Ga0450922_000522 3300042124 Bacteria 4078
207 Ga0450890_001081 3300042127 Bacteria 3971
208 Ga0450897_010015 3300042128 Bacteria 905
209 Ga0450898_024289 3300042134 Bacteria 1082
210 Ga0450899_006221 3300042135 Bacteria 1288
211 Ga0450902_001401 3300042137 Bacteria 3277
212 Ga0450902_003072 3300042137 Bacteria 2411
213 Ga0450902_016067 3300042137 Bacteria 1218
214 Ga0450902_021010 3300042137 Bacteria 1078
215 Ga0450903_001769 3300042138 Bacteria 3954
216 Ga0450903_005466 3300042138 Bacteria 2129
217 Ga0450903_017010 3300042138 Bacteria 1138
218 Ga0450903_020176 3300042138 Bacteria 1031
219 Ga0450904_006536 3300042139 Bacteria 1162
220 Ga0450905_009643 3300042142 Bacteria 1330
221 Ga0450889_007563 3300042144 Bacteria 1097
222 Ga0450889_020365 3300042144 Bacteria 734
223 Ga0450906_001413 3300042145 Bacteria 5227
224 Ga0450907_005336 3300042146 Bacteria 2171
225 Ga0450907_027448 3300042146 Bacteria 965
226 Ga0450910_010755 3300042147 Bacteria 1307
227 Ga0439446_0011066 3300042156 Bacteria 2442
228 Ga0439446_0201854 3300042156 Bacteria 671
229 Ga0450908_000513 3300042184 Bacteria 7467
230 Ga0450909_001050 3300042185 Bacteria 3790
231 Ga0450909_036372 3300042185 Bacteria 753
232 Ga0439464_0005632 3300042439 Bacteria 3243
233 Ga0439460_0000049 3300042461 Bacteria 17698
234 Ga0439460_0143771 3300042461 Bacteria 792
235 Ga0450893_0033661 3300042532 Bacteria 920
236 Ga0450893_0034330 3300042532 Bacteria 913
237 Ga0439440_0000884 3300042993 Bacteria 5236
238 Ga0495617_009005 3300046452 Bacteria 3433
239 Ga0495617_037387 3300046452 Bacteria 1626
240 Ga0495617_048905 3300046452 Bacteria 1407
241 Ga0495617_074581 3300046452 Bacteria 1113
242 Ga0495617_089933 3300046452 Bacteria 1002
243 Ga0495617_130215 3300046452 Bacteria 807
244 Ga0495617_203474 3300046452 Bacteria 618
245 Ga0495617_232056 3300046452 Bacteria 571
246 Ga0495617_235007 3300046452 Bacteria 567
247 Ga0495627_000107 3300046453 Bacteria 102518
248 Ga0495627_000829 3300046453 Bacteria 22331
249 Ga0495627_007613 3300046453 Bacteria 4134
250 Ga0495627_010413 3300046453 Bacteria 3380
251 Ga0495627_018570 3300046453 Bacteria 2342
252 Ga0495627_056313 3300046453 Bacteria 1172
253 Ga0495627_181750 3300046453 Bacteria 582
254 Ga0495592_0333302 3300046454 Bacteria 977
255 Ga0495603_0051155 3300046455 Bacteria 2455
256 Ga0495590_0006886 3300046457 Bacteria 4413
257 Ga0495590_0007585 3300046457 Bacteria 4173
258 Ga0495590_0033652 3300046457 Bacteria 1791
259 Ga0495591_000610 3300046458 Bacteria 26765
260 Ga0495591_002278 3300046458 Bacteria 10885
261 Ga0495591_015801 3300046458 Bacteria 2653
262 Ga0495591_020098 3300046458 Bacteria 2216
263 Ga0495591_022985 3300046458 Bacteria 2006
264 Ga0495591_049407 3300046458 Bacteria 1156
265 Ga0495591_053432 3300046458 Bacteria 1095
266 Ga0495591_056291 3300046458 Bacteria 1057
267 Ga0495591_078170 3300046458 Bacteria 847
268 Ga0495591_114532 3300046458 Bacteria 660
269 Ga0495638_0002621 3300046460 Bacteria 14479
270 Ga0495638_0028621 3300046460 Bacteria 3595
271 Ga0495638_0068625 3300046460 Bacteria 2173
272 Ga0495638_0082730 3300046460 Bacteria 1946
273 Ga0495638_0101578 3300046460 Bacteria 1719
274 Ga0495638_0101647 3300046460 Bacteria 1718
275 Ga0495638_0167019 3300046460 Bacteria 1265
276 Ga0495638_0188496 3300046460 Bacteria 1171
277 Ga0495638_0292582 3300046460 Bacteria 880
278 Ga0495638_0303825 3300046460 Bacteria 858
279 Ga0495653_0002213 3300046463 Bacteria 15381
280 Ga0495653_0007596 3300046463 Bacteria 8864
281 Ga0495653_0041578 3300046463 Bacteria 3587
282 Ga0495653_0091678 3300046463 Bacteria 2221
283 Ga0495653_0524779 3300046463 Bacteria 735
284 Ga0495653_0622360 3300046463 Bacteria 661
285 Ga0495650_0012094 3300046471 Bacteria 4667
286 Ga0495650_0043915 3300046471 Bacteria 1892
287 Ga0495650_0124200 3300046471 Bacteria 947
288 Ga0495650_0134377 3300046471 Bacteria 900
289 Ga0495650_0164611 3300046471 Bacteria 788
290 Ga0495580_0484298 3300046472 Bacteria 827
291 Ga0495580_0569379 3300046472 Bacteria 751
292 Ga0495605_0004348 3300046474 Bacteria 8331
293 Ga0495605_0022295 3300046474 Bacteria 3346
294 Ga0495605_0046618 3300046474 Bacteria 2129
295 Ga0495605_0060483 3300046474 Bacteria 1815
296 Ga0495605_0114337 3300046474 Bacteria 1228
297 Ga0495605_0161565 3300046474 Bacteria 994
298 Ga0495605_0164025 3300046474 Bacteria 985
299 Ga0495605_0342027 3300046474 Bacteria 628
300 Ga0495605_0421905 3300046474 Bacteria 552
301 Ga0495639_0000086 3300046475 Bacteria 44597
302 Ga0495639_0406468 3300046475 Bacteria 688
303 Ga0495584_0001054 3300046491 Bacteria 17157
304 Ga0495584_0005175 3300046491 Bacteria 6923
305 Ga0495584_0029964 3300046491 Bacteria 2757
306 Ga0495584_0048510 3300046491 Bacteria 2140
307 Ga0495584_0048611 3300046491 Bacteria 2138
308 Ga0495584_0057408 3300046491 Bacteria 1958
309 Ga0495584_0129427 3300046491 Bacteria 1280
310 Ga0495584_0174215 3300046491 Bacteria 1093
311 Ga0495584_0234726 3300046491 Bacteria 932
312 Ga0495584_0239643 3300046491 Bacteria 922
313 Ga0495584_0507434 3300046491 Bacteria 614
314 Ga0495584_0603789 3300046491 Bacteria 559
315 Ga0495585_0001257 3300046492 Bacteria 20434
316 Ga0495585_0007697 3300046492 Bacteria 6565
317 Ga0495585_0008998 3300046492 Bacteria 6018
318 Ga0495585_0014307 3300046492 Bacteria 4625
319 Ga0495585_0027209 3300046492 Bacteria 3264
320 Ga0495585_0091429 3300046492 Bacteria 1638
321 Ga0495585_0162617 3300046492 Bacteria 1157
322 Ga0495585_0168756 3300046492 Bacteria 1131
323 Ga0495585_0369256 3300046492 Bacteria 694
324 Ga0495585_0512011 3300046492 Bacteria 569
325 Ga0495594_0068459 3300046499 Bacteria 1972
326 Ga0495596_0124501 3300046500 Bacteria 1000
327 Ga0495607_0002285 3300046501 Bacteria 15778
328 Ga0495607_0004396 3300046501 Bacteria 10385
329 Ga0495607_0005337 3300046501 Bacteria 9233
330 Ga0495607_0005402 3300046501 Bacteria 9152
331 Ga0495607_0005785 3300046501 Bacteria 8795
332 Ga0495607_0021044 3300046501 Bacteria 4108
333 Ga0495607_0029053 3300046501 Bacteria 3405
334 Ga0495607_0056174 3300046501 Bacteria 2261
335 Ga0495607_0141108 3300046501 Bacteria 1242
336 Ga0495607_0150145 3300046501 Bacteria 1193
337 Ga0495607_0160575 3300046501 Bacteria 1142
338 Ga0495607_0236599 3300046501 Bacteria 885
339 Ga0495607_0292865 3300046501 Bacteria 768
340 Ga0495607_0362065 3300046501 Bacteria 667
341 Ga0495607_0378183 3300046501 Bacteria 648
342 Ga0495607_0384473 3300046501 Bacteria 641
343 Ga0495607_0530072 3300046501 Bacteria 519
344 Ga0495583_0007462 3300046506 Bacteria 6859
345 Ga0495583_0079717 3300046506 Bacteria 1424
346 Ga0495606_0008144 3300046507 Bacteria 9182
347 Ga0495606_0020157 3300046507 Bacteria 4928
348 Ga0495606_0020581 3300046507 Bacteria 4857
349 Ga0495606_0026182 3300046507 Bacteria 4159
350 Ga0495606_0027986 3300046507 Bacteria 3984
351 Ga0495606_0033274 3300046507 Bacteria 3557
352 Ga0495606_0073674 3300046507 Bacteria 2141
353 Ga0495606_0091786 3300046507 Bacteria 1866
354 Ga0495606_0115936 3300046507 Bacteria 1609
355 Ga0495606_0211437 3300046507 Bacteria 1098
356 Ga0495606_0298636 3300046507 Bacteria 873
357 Ga0495606_0327220 3300046507 Bacteria 821
358 Ga0495606_0384407 3300046507 Bacteria 735
359 Ga0495610_0001135 3300046512 Bacteria 24214
360 Ga0495610_0003376 3300046512 Bacteria 12487
361 Ga0495610_0012495 3300046512 Bacteria 5105
362 Ga0495610_0016281 3300046512 Bacteria 4289
363 Ga0495610_0016514 3300046512 Bacteria 4245
364 Ga0495610_0021065 3300046512 Bacteria 3595
365 Ga0495610_0033551 3300046512 Bacteria 2652
366 Ga0495610_0039596 3300046512 Bacteria 2382
367 Ga0495610_0100252 3300046512 Bacteria 1298
368 Ga0495610_0154553 3300046512 Bacteria 975
369 Ga0495610_0290675 3300046512 Bacteria 633
370 Ga0495616_0005357 3300046513 Bacteria 7913
371 Ga0495616_0005657 3300046513 Bacteria 7653
372 Ga0495616_0014718 3300046513 Bacteria 4369
373 Ga0495616_0039866 3300046513 Bacteria 2403
374 Ga0495616_0041096 3300046513 Bacteria 2360
375 Ga0495616_0061951 3300046513 Bacteria 1833
376 Ga0495616_0121807 3300046513 Bacteria 1203
377 Ga0495616_0236193 3300046513 Bacteria 790
378 Ga0495620_0000808 3300046515 Bacteria 19266
379 Ga0495620_0027393 3300046515 Bacteria 2667
380 Ga0495620_0032507 3300046515 Bacteria 2376
381 Ga0495620_0047520 3300046515 Bacteria 1846
382 Ga0495620_0231838 3300046515 Bacteria 705
383 Ga0495628_0168861 3300046516 Bacteria 1659
384 Ga0495630_0128311 3300046517 Bacteria 1925
385 Ga0495631_0000250 3300046518 Bacteria 37252
386 Ga0495631_0000276 3300046518 Bacteria 35903
387 Ga0495631_0002243 3300046518 Bacteria 11099
388 Ga0495631_0025882 3300046518 Bacteria 2698
389 Ga0495631_0102813 3300046518 Bacteria 1229
390 Ga0495631_0111839 3300046518 Bacteria 1174
391 Ga0495631_0163304 3300046518 Bacteria 955
392 Ga0495632_0001128 3300046519 Bacteria 22842
393 Ga0495632_0007671 3300046519 Bacteria 6737
394 Ga0495632_0016512 3300046519 Bacteria 4104
395 Ga0495632_0016832 3300046519 Bacteria 4054
396 Ga0495632_0020061 3300046519 Bacteria 3629
397 Ga0495632_0026676 3300046519 Bacteria 3038
398 Ga0495632_0032985 3300046519 Bacteria 2662
399 Ga0495632_0035979 3300046519 Bacteria 2521
400 Ga0495632_0133242 3300046519 Bacteria 1155
401 Ga0495632_0133970 3300046519 Bacteria 1152
402 Ga0495632_0182340 3300046519 Bacteria 961
403 Ga0495637_0000424 3300046520 Bacteria 30857
404 Ga0495637_0001077 3300046520 Bacteria 16951
405 Ga0495637_0001331 3300046520 Bacteria 14807
406 Ga0495637_0001707 3300046520 Bacteria 12678
407 Ga0495637_0004875 3300046520 Bacteria 6902
408 Ga0495637_0014590 3300046520 Bacteria 3703
409 Ga0495637_0020988 3300046520 Bacteria 2996
410 Ga0495637_0030244 3300046520 Bacteria 2403
411 Ga0495637_0033634 3300046520 Bacteria 2249
412 Ga0495637_0035686 3300046520 Bacteria 2170
413 Ga0495637_0036357 3300046520 Bacteria 2145
414 Ga0495637_0047524 3300046520 Bacteria 1810
415 Ga0495637_0092689 3300046520 Bacteria 1190
416 Ga0495637_0268797 3300046520 Bacteria 610
417 Ga0495643_0004491 3300046522 Bacteria 9729
418 Ga0495643_0022829 3300046522 Bacteria 3563
419 Ga0495643_0053268 3300046522 Bacteria 2169
420 Ga0495643_0086047 3300046522 Bacteria 1629
421 Ga0495643_0193935 3300046522 Bacteria 979
422 Ga0495643_0205655 3300046522 Bacteria 942
423 Ga0495643_0536439 3300046522 Bacteria 500
424 Ga0495644_0000223 3300046523 Bacteria 26777
425 Ga0495644_0001517 3300046523 Bacteria 9456
426 Ga0495644_0025425 3300046523 Bacteria 2247
427 Ga0495644_0210499 3300046523 Bacteria 750
428 Ga0495648_0031384 3300046524 Bacteria 3499
429 Ga0495648_0034873 3300046524 Bacteria 3268
430 Ga0495648_0151874 3300046524 Bacteria 1207
431 Ga0495648_0183731 3300046524 Bacteria 1060
432 Ga0495648_0211381 3300046524 Bacteria 963
433 Ga0495648_0477640 3300046524 Bacteria 539
434 Ga0495648_0496131 3300046524 Bacteria 524
435 Ga0495666_0136325 3300046526 Bacteria 1145
436 Ga0495666_0165166 3300046526 Bacteria 1025
437 Ga0495666_0264668 3300046526 Bacteria 781
438 Ga0495652_0469752 3300046529 Bacteria 877
439 Ga0495654_0000137 3300046530 Bacteria 76186
440 Ga0495654_0000702 3300046530 Bacteria 26270
441 Ga0495654_0001756 3300046530 Bacteria 14521
442 Ga0495654_0001984 3300046530 Bacteria 13486
443 Ga0495654_0002874 3300046530 Bacteria 10815
444 Ga0495654_0006574 3300046530 Bacteria 6584
445 Ga0495654_0017627 3300046530 Bacteria 3749
446 Ga0495654_0066898 3300046530 Bacteria 1711
447 Ga0495654_0078117 3300046530 Bacteria 1556
448 Ga0495654_0125423 3300046530 Bacteria 1157
449 Ga0495654_0126028 3300046530 Bacteria 1154
450 Ga0495654_0152622 3300046530 Bacteria 1020
451 Ga0495654_0167663 3300046530 Bacteria 959
452 Ga0495654_0246112 3300046530 Bacteria 746
453 Ga0495654_0268292 3300046530 Bacteria 705
454 Ga0495654_0435259 3300046530 Bacteria 517
455 Ga0495587_0024842 3300046536 Bacteria 3667
456 Ga0495587_0400769 3300046536 Bacteria 762
457 Ga0495609_0005190 3300046538 Bacteria 6932
458 Ga0495609_0123817 3300046538 Bacteria 1110
459 Ga0495609_0144116 3300046538 Bacteria 1015
460 Ga0495609_0195302 3300046538 Bacteria 847
461 Ga0495597_0002668 3300046542 Bacteria 11037
462 Ga0495597_0022891 3300046542 Bacteria 2894
463 Ga0495597_0026804 3300046542 Bacteria 2646
464 Ga0495597_0043299 3300046542 Bacteria 2005
465 Ga0495597_0103375 3300046542 Bacteria 1199
466 Ga0495597_0142584 3300046542 Bacteria 987
467 Ga0495597_0153746 3300046542 Bacteria 942
468 Ga0495597_0192568 3300046542 Bacteria 819
469 Ga0495645_0471088 3300046543 Bacteria 789
470 Ga0495622_0000225 3300046557 Bacteria 44796
471 Ga0495622_0000482 3300046557 Bacteria 25100
472 Ga0495622_0530092 3300046557 Bacteria 502
473 Ga0495633_0042610 3300046558 Bacteria 2154
474 Ga0495633_0092960 3300046558 Bacteria 1402
475 Ga0495656_0053907 3300046615 Bacteria 1729
476 Ga0495656_0498348 3300046615 Bacteria 646
477 Ga0495668_0004667 3300046616 Bacteria 9615
478 Ga0495634_0001331 3300046642 Bacteria 22500
479 Ga0495634_0240611 3300046642 Bacteria 1110
480 Ga0495611_0000286 3300046648 Bacteria 34423
481 Ga0495611_0164639 3300046648 Bacteria 1036
482 Ga0495611_0172298 3300046648 Bacteria 1011
483 Ga0495611_0456080 3300046648 Bacteria 582
484 Ga0495611_0513826 3300046648 Bacteria 544
485 Ga0495625_0004277 3300046660 Bacteria 13585
486 Ga0495625_0004376 3300046660 Bacteria 13397
487 Ga0495625_0005240 3300046660 Bacteria 11932
488 Ga0495625_0043158 3300046660 Bacteria 3272
489 Ga0495625_0126733 3300046660 Bacteria 1732
490 Ga0495625_0335587 3300046660 Bacteria 959
491 Ga0495625_0476914 3300046660 Bacteria 766
492 Ga0495625_0508580 3300046660 Bacteria 735
493 Ga0495625_0544727 3300046660 Bacteria 703
494 Ga0495625_0705576 3300046660 Bacteria 595
495 Ga0495625_0769650 3300046660 Bacteria 562
496 Ga0495625_0850858 3300046660 Bacteria 526
497 Ga0495635_0012749 3300046663 Bacteria 5889
498 Ga0495659_0000110 3300046664 Bacteria 36480
499 Ga0495659_0001576 3300046664 Bacteria 7669
500 Ga0495661_0000575 3300046665 Bacteria 38183
501 Ga0495661_0005029 3300046665 Bacteria 9442
502 Ga0495661_0010957 3300046665 Bacteria 6161
503 Ga0495661_0027806 3300046665 Bacteria 3627
504 Ga0495661_0043715 3300046665 Bacteria 2752
505 Ga0495661_0071638 3300046665 Bacteria 2024
506 Ga0495661_0076772 3300046665 Bacteria 1937
507 Ga0495661_0165290 3300046665 Bacteria 1184
508 Ga0495661_0503309 3300046665 Bacteria 577
509 Ga0495661_0551326 3300046665 Bacteria 545
510 Ga0495623_0039669 3300046679 Bacteria 3008
511 Ga0495646_0048365 3300046680 Bacteria 2584
512 Ga0495646_0259173 3300046680 Bacteria 929
513 Ga0495646_0302648 3300046680 Bacteria 845
514 Ga0495669_0416525 3300046684 Bacteria 651
515 Ga0495613_0102116 3300046689 Bacteria 2070
516 Ga0495613_0115248 3300046689 Bacteria 1934
517 Ga0495613_0480537 3300046689 Bacteria 838
518 Ga0495624_0069379 3300046690 Bacteria 2196
519 Ga0495670_0000889 3300046691 Bacteria 14480
520 Ga0495670_0001208 3300046691 Bacteria 12556
521 Ga0495670_0001590 3300046691 Bacteria 11096
522 Ga0495670_0138749 3300046691 Bacteria 1270
523 Ga0495670_0236420 3300046691 Bacteria 972
524 Ga0495670_0372873 3300046691 Bacteria 769
525 Ga0495670_0491348 3300046691 Bacteria 666
526 Ga0495670_0797440 3300046691 Bacteria 515
527 Ga0495671_0001223 3300046692 Bacteria 17580
528 Ga0495671_0007222 3300046692 Bacteria 6350
529 Ga0495671_0063793 3300046692 Bacteria 1814
530 Ga0495671_0073457 3300046692 Bacteria 1678
531 Ga0495671_0129516 3300046692 Bacteria 1230
532 Ga0495671_0139930 3300046692 Bacteria 1179
533 Ga0495671_0153282 3300046692 Bacteria 1121
534 Ga0495671_0162126 3300046692 Bacteria 1087
535 Ga0495671_0241039 3300046692 Bacteria 873
536 Ga0495671_0621529 3300046692 Bacteria 513
537 Ga0495671_0646821 3300046692 Bacteria 502
538 Ga0495649_0001059 3300046694 Bacteria 21506
539 Ga0495649_0024331 3300046694 Bacteria 3377
540 Ga0495649_0027004 3300046694 Bacteria 3187
541 Ga0495649_0037588 3300046694 Bacteria 2657
542 Ga0495649_0045439 3300046694 Bacteria 2394
543 Ga0495649_0048301 3300046694 Bacteria 2312
544 Ga0495649_0049008 3300046694 Bacteria 2294
545 Ga0495649_0065793 3300046694 Bacteria 1945
546 Ga0495649_0152480 3300046694 Bacteria 1213
547 Ga0495649_0189622 3300046694 Bacteria 1070
548 Ga0495649_0191486 3300046694 Bacteria 1064
549 Ga0495649_0213841 3300046694 Bacteria 998
550 Ga0495649_0336203 3300046694 Bacteria 764
551 Ga0495649_0576014 3300046694 Bacteria 556
552 Ga0495589_0000667 3300046794 Bacteria 22510
553 Ga0495589_0008464 3300046794 Bacteria 5371
554 Ga0495589_0031454 3300046794 Bacteria 2671
555 Ga0495589_0096754 3300046794 Bacteria 1430
556 Ga0495589_0241521 3300046794 Bacteria 845
557 Ga0495589_0295406 3300046794 Bacteria 751
558 Ga0495589_0319762 3300046794 Bacteria 717
559 Ga0495600_0132456 3300046809 Bacteria 1620
560 Ga0495660_0003097 3300046810 Bacteria 10365
561 Ga0495660_0007035 3300046810 Bacteria 6633
562 Ga0495660_0023919 3300046810 Bacteria 3481
563 Ga0495660_0053801 3300046810 Bacteria 2183
564 Ga0495660_0057835 3300046810 Bacteria 2090
565 Ga0495660_0062523 3300046810 Bacteria 1995
566 Ga0495660_0063183 3300046810 Bacteria 1983
567 Ga0495660_0090130 3300046810 Bacteria 1595
568 Ga0495660_0141652 3300046810 Bacteria 1195
569 Ga0495660_0162198 3300046810 Bacteria 1095
570 Ga0495660_0206851 3300046810 Bacteria 933
571 Ga0495660_0309170 3300046810 Bacteria 713
572 Ga0495660_0413634 3300046810 Bacteria 588
573 Ga0495581_0034121 3300047315 Bacteria 2944
574 Ga0495604_0006964 3300047317 Bacteria 8960
575 Ga0495604_0055222 3300047317 Bacteria 3062
576 Ga0495672_0001938 3300047320 Bacteria 19559
577 Ga0495672_0002030 3300047320 Bacteria 19098
578 Ga0495672_0002566 3300047320 Bacteria 16526
579 Ga0495672_0003500 3300047320 Bacteria 13396
580 Ga0495672_0004290 3300047320 Bacteria 11758
581 Ga0495672_0011806 3300047320 Bacteria 6135
582 Ga0495672_0024807 3300047320 Bacteria 3854
583 Ga0495672_0306926 3300047320 Bacteria 749
584 Ga0495672_0381998 3300047320 Bacteria 647
585 Ga0495672_0395000 3300047320 Bacteria 633
586 Ga0495676_0004850 3300047321 Bacteria 12336
587 Ga0495676_0005794 3300047321 Bacteria 11330
588 Ga0495676_0322992 3300047321 Bacteria 1036
589 Ga0495680_0008909 3300047322 Bacteria 9073
590 Ga0495680_0097803 3300047322 Bacteria 2190
591 Ga0495680_0625977 3300047322 Bacteria 717
592 Ga0495683_0000675 3300047323 Bacteria 25171
593 Ga0495683_0000686 3300047323 Bacteria 24920
594 Ga0495683_0014343 3300047323 Bacteria 4129
595 Ga0495683_0020679 3300047323 Bacteria 3393
596 Ga0495683_0037979 3300047323 Bacteria 2439
597 Ga0495683_0054379 3300047323 Bacteria 1995
598 Ga0495683_0056562 3300047323 Bacteria 1951
599 Ga0495683_0059766 3300047323 Bacteria 1890
600 Ga0495683_0170053 3300047323 Bacteria 1002
601 Ga0495683_0186118 3300047323 Bacteria 945
602 Ga0495683_0199726 3300047323 Bacteria 902
603 Ga0495683_0306781 3300047323 Bacteria 680
604 Ga0495683_0469158 3300047323 Bacteria 514
605 Ga0495687_005180 3300047443 Bacteria 8432
606 Ga0495675_0215042 3300047444 Bacteria 1165
607 Ga0495677_0325716 3300047445 Bacteria 605
608 Ga0495679_002492 3300047446 Bacteria 9343
609 Ga0495679_015478 3300047446 Bacteria 2789
610 Ga0495679_018322 3300047446 Bacteria 2487
611 Ga0495679_052278 3300047446 Bacteria 1222
612 Ga0495679_083014 3300047446 Bacteria 907
613 Ga0495679_084574 3300047446 Bacteria 896
614 Ga0495673_0002498 3300047469 Bacteria 12872
615 Ga0495673_0009330 3300047469 Bacteria 5437
616 Ga0495673_0018088 3300047469 Bacteria 3562
617 Ga0495673_0026193 3300047469 Bacteria 2790
618 Ga0495673_0027354 3300047469 Bacteria 2716
619 Ga0495673_0074143 3300047469 Bacteria 1424
620 Ga0495673_0225199 3300047469 Bacteria 692
621 Ga0495681_0000966 3300047470 Bacteria 21998
622 Ga0495681_0001799 3300047470 Bacteria 15779
623 Ga0495681_0004294 3300047470 Bacteria 9758
624 Ga0495681_0007071 3300047470 Bacteria 7245
625 Ga0495681_0017801 3300047470 Bacteria 3934
626 Ga0495681_0060216 3300047470 Bacteria 1752
627 Ga0495681_0221200 3300047470 Bacteria 759
628 Ga0495681_0248276 3300047470 Bacteria 703
629 Ga0495681_0404612 3300047470 Bacteria 509
630 Ga0495684_0146357 3300047471 Bacteria 1769
631 Ga0495686_0006558 3300047472 Bacteria 8878
632 Ga0495686_0020032 3300047472 Bacteria 4463
633 Ga0495686_0072326 3300047472 Bacteria 2120
634 Ga0495686_0189832 3300047472 Bacteria 1185
635 Ga0495686_0208888 3300047472 Bacteria 1116
636 Ga0495686_0445613 3300047472 Bacteria 688
637 Ga0495593_0051598 3300047673 Bacteria 2176
638 Ga0495593_0078967 3300047673 Bacteria 1703
639 Ga0495593_0090837 3300047673 Bacteria 1573
640 Ga0495593_0218026 3300047673 Bacteria 957
641 Ga0495602_0107582 3300048088 Bacteria 2272
642 Ga0495614_0259853 3300048089 Bacteria 796
643 Ga0495626_0001018 3300048091 Bacteria 24104
644 Ga0495626_0002062 3300048091 Bacteria 14674
645 Ga0495626_0010179 3300048091 Bacteria 5042
646 Ga0495626_0018056 3300048091 Bacteria 3550
647 Ga0495626_0024546 3300048091 Bacteria 2954
648 Ga0495626_0137169 3300048091 Bacteria 1039
649 Ga0495626_0168982 3300048091 Bacteria 912
650 Ga0495626_0296648 3300048091 Bacteria 639
651 Ga0495626_0399528 3300048091 Bacteria 531
652 Ga0496101_0460807 3300048904 Bacteria 1003
653 Ga0496102_0000963 3300048905 Bacteria 27075
654 Ga0496103_0002945 3300048906 Bacteria 10551
655 Ga0496104_0511590 3300048907 Bacteria 1112
656 Ga0496105_0641153 3300048908 Bacteria 821
657 Ga0496106_0352417 3300048909 Bacteria 1182
658 Ga0496107_0491462 3300048910 Bacteria 910
659 Ga0496110_0071726 3300048913 Bacteria 3072
660 Ga0496113_1319088 3300048916 Bacteria 561
661 Ga0496114_0429770 3300048917 Bacteria 1170
662 Ga0496115_0333671 3300048918 Bacteria 1239
663 Ga0496116_0000824 3300048919 Bacteria 39126
664 Ga0496116_0001464 3300048919 Bacteria 26439
665 Ga0496116_0005891 3300048919 Bacteria 11254
666 Ga0496116_0011922 3300048919 Bacteria 7144
667 Ga0496116_0067220 3300048919 Bacteria 2290
668 Ga0496117_0006785 3300048920 Bacteria 11421
669 Ga0496117_0008064 3300048920 Bacteria 10089
670 Ga0496117_0087105 3300048920 Bacteria 2025
671 Ga0496117_0091484 3300048920 Bacteria 1956
672 Ga0496117_0183792 3300048920 Bacteria 1198
673 Ga0496117_0190496 3300048920 Bacteria 1168
674 Ga0496117_0194471 3300048920 Bacteria 1151
675 Ga0496117_0339962 3300048920 Bacteria 779
676 Ga0496117_0368451 3300048920 Bacteria 735
677 Ga0496118_0009042 3300048921 Bacteria 10154
678 Ga0496118_0022925 3300048921 Bacteria 5439
679 Ga0496118_0030037 3300048921 Bacteria 4545
680 Ga0496118_0031218 3300048921 Bacteria 4422
681 Ga0496118_0085582 3300048921 Bacteria 2194
682 Ga0496118_0196630 3300048921 Bacteria 1199
683 Ga0496118_0227027 3300048921 Bacteria 1081
684 Ga0496119_0164257 3300048922 Bacteria 1177
685 Ga0496119_0410488 3300048922 Bacteria 644
686 Ga0496120_0157672 3300048923 Bacteria 1134
687 Ga0496120_0205568 3300048923 Bacteria 950
688 Ga0496120_0243911 3300048923 Bacteria 846
689 Ga0496120_0275099 3300048923 Bacteria 780
690 Ga0496120_0353450 3300048923 Bacteria 659
691 Ga0496121_0009775 3300048924 Bacteria 10963
692 Ga0496121_0029238 3300048924 Bacteria 5103
693 Ga0496121_0037117 3300048924 Bacteria 4331
694 Ga0496121_0066951 3300048924 Bacteria 2913
695 Ga0496121_0089185 3300048924 Bacteria 2415
696 Ga0496121_0410827 3300048924 Bacteria 883
697 Ga0496121_0635784 3300048924 Bacteria 652
698 Ga0496122_0001608 3300048925 Bacteria 35325
699 Ga0496122_0048394 3300048925 Bacteria 3269
700 Ga0496122_0173587 3300048925 Bacteria 1295
701 Ga0496122_0265822 3300048925 Bacteria 948
702 Ga0496122_0333317 3300048925 Bacteria 800
703 Ga0496123_0008778 3300048926 Bacteria 9218
704 Ga0496123_0138023 3300048926 Bacteria 1338
705 Ga0496123_0245112 3300048926 Bacteria 887
706 Ga0496123_0342018 3300048926 Bacteria 699
707 Ga0496124_0003600 3300048927 Bacteria 18825
708 Ga0496124_0015291 3300048927 Bacteria 7365
709 Ga0496124_0130380 3300048927 Bacteria 1998
710 Ga0496124_0141186 3300048927 Bacteria 1900
711 Ga0496124_0395766 3300048927 Bacteria 960
712 Ga0496125_0004482 3300048928 Bacteria 16087
713 Ga0496125_0126332 3300048928 Bacteria 1811
714 Ga0496125_0139962 3300048928 Bacteria 1684
715 Ga0496125_0240892 3300048928 Bacteria 1148
716 Ga0496125_0280507 3300048928 Bacteria 1032
717 Ga0496125_0464184 3300048928 Bacteria 721
718 Ga0496125_0561338 3300048928 Bacteria 630
719 Ga0496126_0044008 3300048929 Bacteria 4114
720 Ga0496126_0438960 3300048929 Bacteria 1052
721 Ga0495678_000992 3300049459 Bacteria 24319
722 Ga0495678_004782 3300049459 Bacteria 7712
723 Ga0495678_007695 3300049459 Bacteria 5554
724 Ga0495678_008128 3300049459 Bacteria 5341
725 Ga0495678_011559 3300049459 Bacteria 4221
726 Ga0495678_029518 3300049459 Bacteria 2301
727 Ga0495678_035982 3300049459 Bacteria 2024
728 Ga0495678_090819 3300049459 Bacteria 1076
729 Ga0495678_095274 3300049459 Bacteria 1040
730 Ga0495678_215765 3300049459 Bacteria 584
731 Ga0495678_225492 3300049459 Bacteria 566
732 Ga0495682_0001863 3300049460 Bacteria 10533
733 Ga0495682_0070463 3300049460 Bacteria 1258
734 Ga0495682_0118400 3300049460 Bacteria 948
735 Ga0495682_0120217 3300049460 Bacteria 940
736 Ga0495682_0271138 3300049460 Bacteria 599
737 Ga0501241_000096 3300049758 Bacteria 19209
738 nmdc:mga00v17_380421_c1 3300050491 Bacteria 918
739 Ga0500572_007230 3300053111 Bacteria 2567
740 Ga0500618_005147 3300053125 Bacteria 4023
741 Ga0500586_116210 3300053145 Bacteria 933
742 Ga0500589_289260 3300053147 Bacteria 584
743 Ga0500634_0004624 3300053161 Bacteria 6399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0464184 Ga0496125_0464184_12_368 103
2 3300049460 Ga0495682_0271138 Ga0495682_0271138_32_367 111
3 3300046452 Ga0495617_232056 Ga0495617_232056_204_542 112
4 3300046460 Ga0495638_0082730 Ga0495638_0082730_1590_1928 112
5 3300046522 Ga0495643_0053268 Ga0495643_0053268_1768_2106 112
6 3300046524 Ga0495648_0477640 Ga0495648_0477640_172_510 112
7 3300046660 Ga0495625_0508580 Ga0495625_0508580_13_351 112
8 3300046660 Ga0495625_0544727 Ga0495625_0544727_33_371 112
9 3300046660 Ga0495625_0850858 Ga0495625_0850858_28_366 112
10 3300047472 Ga0495686_0006558 Ga0495686_0006558_2920_3258 112
11 3300048091 Ga0495626_0399528 Ga0495626_0399528_166_504 112
12 3300048919 Ga0496116_0001464 Ga0496116_0001464_4709_5047 112
13 3300048922 Ga0496119_0410488 Ga0496119_0410488_285_623 112
14 3300048925 Ga0496122_0333317 Ga0496122_0333317_54_392 112
15 3300048928 Ga0496125_0561338 Ga0496125_0561338_281_619 112
16 3300046491 Ga0495584_0129427 Ga0495584_0129427_219_611 115
17 3300048920 Ga0496117_0368451 Ga0496117_0368451_56_460 117
18 3300048924 Ga0496121_0635784 Ga0496121_0635784_197_601 117
19 iso_pu_bacteria 2599185167 2599397462 117
20 iso_pu_bacteria 2599185179 2599449460 117
21 iso_pu_bacteria 2599185190 2599510802 117
22 iso_pu_bacteria 2599185191 2599519708 117
23 iso_pu_bacteria 2599185290 2599890177 117
24 iso_pu_bacteria 2931390751 2931391638 117
25 3300013100 Ga0157373_10005127 Ga0157373_100051274 118
26 3300046542 Ga0495597_0142584 Ga0495597_0142584_266_655 120
27 3300001915 JGI24741J21665_1049620 JGI24741J21665_10496201 121
28 3300005288 Ga0065714_10075709 Ga0065714_100757094 121
29 3300005353 Ga0070669_100000452 Ga0070669_10000045228 121
30 3300005457 Ga0070662_100021712 Ga0070662_1000217125 121
31 3300005539 Ga0068853_100001380 Ga0068853_10000138014 121
32 3300005564 Ga0070664_100818306 Ga0070664_1008183062 121
33 3300005578 Ga0068854_100004527 Ga0068854_1000045272 121
34 3300005834 Ga0068851_10000021 Ga0068851_100000217 121
35 3300009011 Ga0105251_10007701 Ga0105251_100077019 121
36 3300009036 Ga0105244_10143031 Ga0105244_101430311 121
37 3300009177 Ga0105248_10044903 Ga0105248_100449034 121
38 3300010375 Ga0105239_12521295 Ga0105239_125212951 121
39 3300013100 Ga0157373_10652048 Ga0157373_106520481 121
40 3300013104 Ga0157370_11150527 Ga0157370_111505271 121
41 3300013104 Ga0157370_11155409 Ga0157370_111554091 121
42 3300013105 Ga0157369_10476632 Ga0157369_104766322 121
43 3300014497 Ga0182008_10019141 Ga0182008_100191412 121
44 3300017792 Ga0163161_10702179 Ga0163161_107021792 121
45 3300025321 Ga0207656_10000020 Ga0207656_10000020112 121
46 3300025735 Ga0207713_1007286 Ga0207713_10072869 121
47 3300025914 Ga0207671_10964949 Ga0207671_109649491 121
48 3300025923 Ga0207681_10000119 Ga0207681_1000011914 121
49 3300025933 Ga0207706_10000855 Ga0207706_100008552 121
50 3300025941 Ga0207711_10025554 Ga0207711_100255546 121
51 3300025945 Ga0207679_10282879 Ga0207679_102828793 121
52 3300026041 Ga0207639_10001210 Ga0207639_100012102 121
53 3300042016 Ga0439463_094381 Ga0439463_094381_40_405 121
54 3300048920 Ga0496117_0194471 Ga0496117_0194471_286_651 121
55 3300048922 Ga0496119_0164257 Ga0496119_0164257_286_651 121
56 3300048923 Ga0496120_0157672 Ga0496120_0157672_484_849 121
57 3300048924 Ga0496121_0066951 Ga0496121_0066951_443_808 121
58 3300048925 Ga0496122_0173587 Ga0496122_0173587_502_867 121
59 3300048926 Ga0496123_0138023 Ga0496123_0138023_476_841 121
60 3300048928 Ga0496125_0240892 Ga0496125_0240892_498_863 121
61 3300046558 Ga0495633_0092960 Ga0495633_0092960_210_578 122
62 3300046463 Ga0495653_0524779 Ga0495653_0524779_341_715 124
63 3300046472 Ga0495580_0569379 Ga0495580_0569379_26_400 124
64 3300046526 Ga0495666_0165166 Ga0495666_0165166_597_971 124
65 3300046557 Ga0495622_0530092 Ga0495622_0530092_13_387 124
66 3300046648 Ga0495611_0513826 Ga0495611_0513826_18_392 124
67 3300046689 Ga0495613_0480537 Ga0495613_0480537_266_673 124
68 3300048927 Ga0496124_0395766 Ga0496124_0395766_357_779 125
69 3300046452 Ga0495617_037387 Ga0495617_037387_849_1232 127
70 3300046453 Ga0495627_000107 Ga0495627_000107_100305_100688 127
71 3300046471 Ga0495650_0124200 Ga0495650_0124200_407_790 127
72 3300046518 Ga0495631_0002243 Ga0495631_0002243_1762_2145 127
73 3300046519 Ga0495632_0007671 Ga0495632_0007671_5462_5845 127
74 3300046519 Ga0495632_0016512 Ga0495632_0016512_1944_2327 127
75 3300046530 Ga0495654_0001984 Ga0495654_0001984_10043_10426 127
76 3300046692 Ga0495671_0063793 Ga0495671_0063793_727_1110 127
77 3300047320 Ga0495672_0003500 Ga0495672_0003500_9027_9410 127
78 3300031344 Ga0265316_10917445 Ga0265316_109174452 128
79 3300049459 Ga0495678_215765 Ga0495678_215765_57_479 130
80 iso_pu_bacteria 2511231004 2511253680 130
81 iso_pu_bacteria 2511231007 2511272844 130
82 iso_pu_bacteria 2511231008 2511275218 130
83 iso_pu_bacteria 2511231010 2511288453 130
84 iso_pu_bacteria 2511231011 2511293720 130
85 iso_pu_bacteria 2511231016 2511327656 130
86 iso_pu_bacteria 2511231017 2511330641 130
87 iso_pu_bacteria 2511231022 2511364773 130
88 iso_pu_bacteria 2511231023 2511367910 130
89 iso_pu_bacteria 2511231031 2511413002 130
90 iso_pu_bacteria 2597489888 2597861920 130
91 iso_pu_bacteria 2597489889 2597867653 130
92 iso_pu_bacteria 2599185288 2599883956 130
93 iso_pu_bacteria 2599185303 2599950334 130
94 iso_pu_bacteria 2600255318 2601801168 130
95 iso_pu_bacteria 2603880185 2606073253 130
96 iso_pu_bacteria 2603880199 2606126137 130
97 iso_pu_bacteria 2623620443 2624482743 130
98 iso_pu_bacteria 2623620446 2624490183 130
99 iso_pu_bacteria 2643221571 2643869282 130
100 iso_pu_bacteria 2675903420 2677898487 130
101 iso_pu_bacteria 2713897149 2715755440 130
102 iso_pu_bacteria 2738541294 2738808708 130
103 iso_pu_bacteria 2738541309 2738896068 130
104 iso_pu_bacteria 2738543025 2739314376 130
105 iso_pu_bacteria 2773857673 2774138489 130
106 iso_pu_bacteria 2784132063 2784262480 130
107 iso_pu_bacteria 2808606385 2808974781 130
108 iso_pu_bacteria 2808606388 2808991580 130
109 iso_pu_bacteria 2818991456 2819654151 130
110 iso_pu_bacteria 2834028612 2834028621 130
111 iso_pu_bacteria 2852612431 2852616010 130
112 iso_pu_bacteria 2852657418 2852662996 130
113 iso_pu_bacteria 2852667396 2852670978 130
114 iso_pu_bacteria 2860339153 2860344615 130
115 iso_pu_bacteria 2878029506 2878034675 130
116 iso_pu_bacteria 2880230671 2880235323 130
117 iso_pu_bacteria 2904518522 2904521697 130
118 iso_pu_bacteria 2908446538 2908447289 130
119 iso_pu_bacteria 2919063839 2919069409 130
120 iso_pu_bacteria 2919697872 2919702247 130
121 iso_pu_bacteria 2931396565 2931397384 130
122 iso_pu_bacteria 2945928738 2945929909 130
123 iso_pu_bacteria 2945961074 2945961090 130
124 iso_pu_bacteria 2946027586 2946028896 130
125 iso_pu_bacteria 2969304461 2969309490 130
126 iso_pu_bacteria 3007614139 3007617996 130
127 iso_pu_bacteria 3007619802 3007624050 130
128 iso_pu_bacteria 3007718800 3007723448 130
129 iso_pu_bacteria 8019775933 8019780088 130
130 iso_pu_bacteria 8054285046 8054289260 130
131 iso_pu_bacteria 8054503363 8054504228 130
132 iso_pu_bacteria 8056148874 8056150822 130
133 iso_pu_bacteria 8056155041 8056158068 130
134 iso_pu_bacteria 8056161164 8056161575 130
135 iso_pu_bacteria 8056177738 8056179877 130
136 iso_pu_bacteria 8056569372 8056574724 130
137 3300003578 Ga0006562J51391_1006713 Ga0006562J51391_10067131 133
138 3300006058 Ga0075432_10014432 Ga0075432_100144323 133
139 3300011119 Ga0105246_10165354 Ga0105246_101653541 133
140 3300027907 Ga0207428_10042657 Ga0207428_100426574 133
141 3300031731 Ga0307405_12163402 Ga0307405_121634021 133
142 3300046460 Ga0495638_0292582 Ga0495638_0292582_447_848 133
143 3300046474 Ga0495605_0022295 Ga0495605_0022295_2584_2985 133
144 3300046501 Ga0495607_0362065 Ga0495607_0362065_170_571 133
145 3300046530 Ga0495654_0002874 Ga0495654_0002874_2658_3059 133
146 3300046691 Ga0495670_0491348 Ga0495670_0491348_35_436 133
147 3300047320 Ga0495672_0001938 Ga0495672_0001938_2753_3154 133
148 3300047323 Ga0495683_0170053 Ga0495683_0170053_166_567 133
149 2124908027 MRS2a_Contig_25852 MRS2a_00702000 134
150 3300003759 Ga0055525_1007004 Ga0055525_10070042 134
151 3300003781 Ga0055536_1000790 Ga0055536_100079018 134
152 3300003791 Ga0055530_10001612 Ga0055530_100016129 134
153 3300003792 Ga0055540_1000505 Ga0055540_100050519 134
154 3300003794 Ga0055531_10000123 Ga0055531_1000012377 134
155 3300005288 Ga0065714_10240022 Ga0065714_102400222 134
156 3300005288 Ga0065714_10275559 Ga0065714_102755591 134
157 3300005288 Ga0065714_10312226 Ga0065714_103122261 134
158 3300005289 Ga0065704_10366959 Ga0065704_103669592 134
159 3300005290 Ga0065712_10092601 Ga0065712_100926012 134
160 3300005331 Ga0070670_100480426 Ga0070670_1004804262 134
161 3300005353 Ga0070669_100003010 Ga0070669_1000030104 134
162 3300005355 Ga0070671_100233225 Ga0070671_1002332253 134
163 3300005366 Ga0070659_100447710 Ga0070659_1004477102 134
164 3300005457 Ga0070662_100006733 Ga0070662_1000067337 134
165 3300005548 Ga0070665_100176958 Ga0070665_1001769584 134
166 3300005548 Ga0070665_100224375 Ga0070665_1002243752 134
167 3300005548 Ga0070665_100782981 Ga0070665_1007829812 134
168 3300006051 Ga0075364_10085802 Ga0075364_100858024 134
169 3300006051 Ga0075364_10173764 Ga0075364_101737641 134
170 3300006051 Ga0075364_10201021 Ga0075364_102010213 134
171 3300006051 Ga0075364_10248584 Ga0075364_102485841 134
172 3300006058 Ga0075432_10047202 Ga0075432_100472023 134
173 3300006058 Ga0075432_10059207 Ga0075432_100592072 134
174 3300006177 Ga0075362_10410785 Ga0075362_104107851 134
175 3300006353 Ga0075370_10917419 Ga0075370_109174191 134
176 3300006914 Ga0075436_100224420 Ga0075436_1002244202 134
177 3300009011 Ga0105251_10003422 Ga0105251_100034226 134
178 3300009011 Ga0105251_10006741 Ga0105251_100067414 134
179 3300009011 Ga0105251_10048243 Ga0105251_100482432 134
180 3300009011 Ga0105251_10061622 Ga0105251_100616222 134
181 3300009011 Ga0105251_10089203 Ga0105251_100892031 134
182 3300009011 Ga0105251_10098250 Ga0105251_100982502 134
183 3300009011 Ga0105251_10183176 Ga0105251_101831762 134
184 3300009011 Ga0105251_10210081 Ga0105251_102100812 134
185 3300009011 Ga0105251_10321312 Ga0105251_103213122 134
186 3300009036 Ga0105244_10008583 Ga0105244_100085835 134
187 3300009036 Ga0105244_10021816 Ga0105244_100218162 134
188 3300009036 Ga0105244_10024121 Ga0105244_100241213 134
189 3300009036 Ga0105244_10058408 Ga0105244_100584083 134
190 3300009036 Ga0105244_10067215 Ga0105244_100672152 134
191 3300009036 Ga0105244_10134070 Ga0105244_101340702 134
192 3300009036 Ga0105244_10164685 Ga0105244_101646852 134
193 3300009036 Ga0105244_10175750 Ga0105244_101757502 134
194 3300009036 Ga0105244_10279122 Ga0105244_102791222 134
195 3300009092 Ga0105250_10000120 Ga0105250_100001208 134
196 3300009092 Ga0105250_10001686 Ga0105250_100016868 134
197 3300009092 Ga0105250_10010112 Ga0105250_100101124 134
198 3300009092 Ga0105250_10025186 Ga0105250_100251863 134
199 3300009092 Ga0105250_10424421 Ga0105250_104244212 134
200 3300009093 Ga0105240_10921729 Ga0105240_109217292 134
201 3300009148 Ga0105243_10001176 Ga0105243_1000117610 134
202 3300009176 Ga0105242_10851667 Ga0105242_108516671 134
203 3300010375 Ga0105239_12600188 Ga0105239_126001881 134
204 3300011119 Ga0105246_10003916 Ga0105246_100039167 134
205 3300012498 Ga0157345_1000042 Ga0157345_100004226 134
206 3300013100 Ga0157373_10037579 Ga0157373_100375794 134
207 3300013100 Ga0157373_10259317 Ga0157373_102593172 134
208 3300013100 Ga0157373_10435287 Ga0157373_104352872 134
209 3300013100 Ga0157373_10832782 Ga0157373_108327821 134
210 3300013100 Ga0157373_10888430 Ga0157373_108884302 134
211 3300013104 Ga0157370_10048778 Ga0157370_100487783 134
212 3300013104 Ga0157370_11577072 Ga0157370_115770721 134
213 3300013105 Ga0157369_10004354 Ga0157369_1000435416 134
214 3300013105 Ga0157369_10038595 Ga0157369_100385955 134
215 3300013306 Ga0163162_10001021 Ga0163162_1000102117 134
216 3300013306 Ga0163162_10250382 Ga0163162_102503822 134
217 3300013306 Ga0163162_10981054 Ga0163162_109810542 134
218 3300013306 Ga0163162_11648577 Ga0163162_116485771 134
219 3300013307 Ga0157372_10006828 Ga0157372_100068283 134
220 3300013308 Ga0157375_10689520 Ga0157375_106895201 134
221 3300013308 Ga0157375_10731159 Ga0157375_107311592 134
222 3300014497 Ga0182008_10004169 Ga0182008_100041693 134
223 3300014497 Ga0182008_10007900 Ga0182008_100079003 134
224 3300014497 Ga0182008_10039914 Ga0182008_100399144 134
225 3300014497 Ga0182008_10155738 Ga0182008_101557382 134
226 3300015261 Ga0182006_1000508 Ga0182006_10005082 134
227 3300015261 Ga0182006_1001937 Ga0182006_100193710 134
228 3300015261 Ga0182006_1028612 Ga0182006_10286124 134
229 3300015261 Ga0182006_1058617 Ga0182006_10586172 134
230 3300015261 Ga0182006_1202151 Ga0182006_12021511 134
231 3300015262 Ga0182007_10001676 Ga0182007_100016762 134
232 3300015262 Ga0182007_10065383 Ga0182007_100653832 134
233 3300015265 Ga0182005_1001052 Ga0182005_10010522 134
234 3300015265 Ga0182005_1039955 Ga0182005_10399552 134
235 3300015265 Ga0182005_1041280 Ga0182005_10412802 134
236 3300015265 Ga0182005_1088592 Ga0182005_10885922 134
237 3300017792 Ga0163161_10037661 Ga0163161_100376614 134
238 3300017792 Ga0163161_10058107 Ga0163161_100581072 134
239 3300017792 Ga0163161_10220175 Ga0163161_102201752 134
240 3300017792 Ga0163161_10542554 Ga0163161_105425541 134
241 3300017792 Ga0163161_10714808 Ga0163161_107148081 134
242 3300017792 Ga0163161_10772931 Ga0163161_107729312 134
243 3300017792 Ga0163161_10849413 Ga0163161_108494132 134
244 3300017792 Ga0163161_10869568 Ga0163161_108695682 134
245 3300025230 Ga0209563_100838 Ga0209563_1008386 134
246 3300025291 Ga0209675_1015408 Ga0209675_10154083 134
247 3300025292 Ga0209676_1000010 Ga0209676_1000010890 134
248 3300025298 Ga0209050_1000866 Ga0209050_100086628 134
249 3300025303 Ga0209051_1000631 Ga0209051_100063110 134
250 3300025304 Ga0209257_1000357 Ga0209257_100035783 134
251 3300025711 Ga0207696_1000052 Ga0207696_100005210 134
252 3300025711 Ga0207696_1000738 Ga0207696_100073816 134
253 3300025711 Ga0207696_1001510 Ga0207696_10015103 134
254 3300025711 Ga0207696_1016498 Ga0207696_10164983 134
255 3300025728 Ga0207655_1000723 Ga0207655_100072332 134
256 3300025728 Ga0207655_1001045 Ga0207655_100104510 134
257 3300025728 Ga0207655_1003748 Ga0207655_10037482 134
258 3300025728 Ga0207655_1006098 Ga0207655_10060984 134
259 3300025728 Ga0207655_1018817 Ga0207655_10188172 134
260 3300025728 Ga0207655_1020318 Ga0207655_10203183 134
261 3300025728 Ga0207655_1050309 Ga0207655_10503093 134
262 3300025728 Ga0207655_1055613 Ga0207655_10556131 134
263 3300025728 Ga0207655_1122133 Ga0207655_11221331 134
264 3300025728 Ga0207655_1180284 Ga0207655_11802841 134
265 3300025735 Ga0207713_1000990 Ga0207713_100099011 134
266 3300025735 Ga0207713_1001083 Ga0207713_10010839 134
267 3300025735 Ga0207713_1002401 Ga0207713_10024015 134
268 3300025735 Ga0207713_1006100 Ga0207713_10061006 134
269 3300025735 Ga0207713_1013157 Ga0207713_10131573 134
270 3300025735 Ga0207713_1043489 Ga0207713_10434893 134
271 3300025735 Ga0207713_1048386 Ga0207713_10483861 134
272 3300025735 Ga0207713_1055790 Ga0207713_10557902 134
273 3300025923 Ga0207681_10010462 Ga0207681_100104626 134
274 3300025925 Ga0207650_10000225 Ga0207650_1000022550 134
275 3300025932 Ga0207690_10232654 Ga0207690_102326542 134
276 3300025933 Ga0207706_10011726 Ga0207706_100117262 134
277 3300025934 Ga0207686_10811299 Ga0207686_108112991 134
278 3300025935 Ga0207709_10000189 Ga0207709_1000018910 134
279 3300027907 Ga0207428_10117365 Ga0207428_101173653 134
280 3300027907 Ga0207428_10351075 Ga0207428_103510751 134
281 3300028379 Ga0268266_10043510 Ga0268266_100435105 134
282 3300028379 Ga0268266_10369118 Ga0268266_103691182 134
283 3300028379 Ga0268266_11393891 Ga0268266_113938911 134
284 3300030521 Ga0307511_10028914 Ga0307511_100289142 134
285 3300030521 Ga0307511_10380965 Ga0307511_103809651 134
286 3300031548 Ga0307408_100005853 Ga0307408_1000058534 134
287 3300031731 Ga0307405_10005315 Ga0307405_100053152 134
288 3300031911 Ga0307412_10030472 Ga0307412_100304722 134
289 3300031911 Ga0307412_10105526 Ga0307412_101055263 134
290 3300031911 Ga0307412_11234874 Ga0307412_112348741 134
291 3300032004 Ga0307414_11482321 Ga0307414_114823211 134
292 3300033180 Ga0307510_10000760 Ga0307510_1000076026 134
293 3300041405 Ga0439438_013914 Ga0439438_013914_1537_1941 134
294 3300041405 Ga0439438_031150 Ga0439438_031150_585_989 134
295 3300041405 Ga0439438_133771 Ga0439438_133771_95_499 134
296 3300041407 Ga0439447_000164 Ga0439447_000164_20675_21079 134
297 3300041407 Ga0439447_006486 Ga0439447_006486_1537_1941 134
298 3300041407 Ga0439447_014144 Ga0439447_014144_111_515 134
299 3300041407 Ga0439447_023228 Ga0439447_023228_989_1393 134
300 3300041407 Ga0439447_042050 Ga0439447_042050_281_685 134
301 3300041411 Ga0439466_0010082 Ga0439466_0010082_257_661 134
302 3300041411 Ga0439466_0011032 Ga0439466_0011032_1494_1898 134
303 3300041411 Ga0439466_0013456 Ga0439466_0013456_1100_1504 134
304 3300041411 Ga0439466_0021779 Ga0439466_0021779_1584_1988 134
305 3300041411 Ga0439466_0099843 Ga0439466_0099843_394_798 134
306 3300041413 Ga0439465_0015620 Ga0439465_0015620_454_858 134
307 3300041512 Ga0451853_3596406 Ga0451853_3596406_179_583 134
308 3300042006 Ga0439432_000107 Ga0439432_000107_10167_10571 134
309 3300042006 Ga0439432_017184 Ga0439432_017184_1494_1898 134
310 3300042006 Ga0439432_017202 Ga0439432_017202_534_938 134
311 3300042006 Ga0439432_058894 Ga0439432_058894_425_829 134
312 3300042009 Ga0439451_001663 Ga0439451_001663_399_803 134
313 3300042009 Ga0439451_002456 Ga0439451_002456_1537_1941 134
314 3300042010 Ga0439452_003943 Ga0439452_003943_3145_3549 134
315 3300042013 Ga0439456_001367 Ga0439456_001367_1532_1936 134
316 3300042013 Ga0439456_036059 Ga0439456_036059_371_775 134
317 3300042016 Ga0439463_001373 Ga0439463_001373_1575_1979 134
318 3300042115 Ga0450911_002116 Ga0450911_002116_2088_2492 134
319 3300042121 Ga0450919_002151 Ga0450919_002151_1511_1915 134
320 3300042124 Ga0450922_000522 Ga0450922_000522_1523_1927 134
321 3300042127 Ga0450890_001081 Ga0450890_001081_1507_1911 134
322 3300042128 Ga0450897_010015 Ga0450897_010015_385_789 134
323 3300042134 Ga0450898_024289 Ga0450898_024289_403_807 134
324 3300042135 Ga0450899_006221 Ga0450899_006221_634_1038 134
325 3300042137 Ga0450902_001401 Ga0450902_001401_2458_2862 134
326 3300042137 Ga0450902_003072 Ga0450902_003072_13_417 134
327 3300042137 Ga0450902_016067 Ga0450902_016067_323_727 134
328 3300042137 Ga0450902_021010 Ga0450902_021010_387_791 134
329 3300042138 Ga0450903_001769 Ga0450903_001769_1653_2057 134
330 3300042138 Ga0450903_005466 Ga0450903_005466_1214_1618 134
331 3300042138 Ga0450903_017010 Ga0450903_017010_224_628 134
332 3300042138 Ga0450903_020176 Ga0450903_020176_458_862 134
333 3300042139 Ga0450904_006536 Ga0450904_006536_473_877 134
334 3300042142 Ga0450905_009643 Ga0450905_009643_682_1086 134
335 3300042144 Ga0450889_007563 Ga0450889_007563_254_658 134
336 3300042144 Ga0450889_020365 Ga0450889_020365_27_431 134
337 3300042145 Ga0450906_001413 Ga0450906_001413_1220_1624 134
338 3300042146 Ga0450907_005336 Ga0450907_005336_533_937 134
339 3300042146 Ga0450907_027448 Ga0450907_027448_302_706 134
340 3300042147 Ga0450910_010755 Ga0450910_010755_627_1031 134
341 3300042156 Ga0439446_0011066 Ga0439446_0011066_1537_1941 134
342 3300042156 Ga0439446_0201854 Ga0439446_0201854_29_433 134
343 3300042184 Ga0450908_000513 Ga0450908_000513_5518_5922 134
344 3300042185 Ga0450909_001050 Ga0450909_001050_1571_1975 134
345 3300042185 Ga0450909_036372 Ga0450909_036372_286_690 134
346 3300042439 Ga0439464_0005632 Ga0439464_0005632_338_742 134
347 3300042461 Ga0439460_0000049 Ga0439460_0000049_15716_16120 134
348 3300042461 Ga0439460_0143771 Ga0439460_0143771_102_506 134
349 3300042532 Ga0450893_0033661 Ga0450893_0033661_267_671 134
350 3300042532 Ga0450893_0034330 Ga0450893_0034330_67_471 134
351 3300042993 Ga0439440_0000884 Ga0439440_0000884_3365_3769 134
352 3300046452 Ga0495617_009005 Ga0495617_009005_226_630 134
353 3300046452 Ga0495617_048905 Ga0495617_048905_454_858 134
354 3300046452 Ga0495617_074581 Ga0495617_074581_476_880 134
355 3300046452 Ga0495617_089933 Ga0495617_089933_524_928 134
356 3300046452 Ga0495617_130215 Ga0495617_130215_258_662 134
357 3300046452 Ga0495617_203474 Ga0495617_203474_187_591 134
358 3300046452 Ga0495617_235007 Ga0495617_235007_122_526 134
359 3300046453 Ga0495627_000829 Ga0495627_000829_8881_9285 134
360 3300046453 Ga0495627_007613 Ga0495627_007613_3287_3691 134
361 3300046453 Ga0495627_010413 Ga0495627_010413_2177_2581 134
362 3300046453 Ga0495627_018570 Ga0495627_018570_181_585 134
363 3300046453 Ga0495627_056313 Ga0495627_056313_218_622 134
364 3300046453 Ga0495627_181750 Ga0495627_181750_93_497 134
365 3300046454 Ga0495592_0333302 Ga0495592_0333302_16_420 134
366 3300046455 Ga0495603_0051155 Ga0495603_0051155_1862_2266 134
367 3300046457 Ga0495590_0006886 Ga0495590_0006886_2501_2905 134
368 3300046457 Ga0495590_0007585 Ga0495590_0007585_456_860 134
369 3300046457 Ga0495590_0033652 Ga0495590_0033652_457_861 134
370 3300046458 Ga0495591_000610 Ga0495591_000610_15822_16226 134
371 3300046458 Ga0495591_002278 Ga0495591_002278_10275_10679 134
372 3300046458 Ga0495591_015801 Ga0495591_015801_2065_2469 134
373 3300046458 Ga0495591_020098 Ga0495591_020098_207_611 134
374 3300046458 Ga0495591_022985 Ga0495591_022985_99_503 134
375 3300046458 Ga0495591_049407 Ga0495591_049407_593_997 134
376 3300046458 Ga0495591_053432 Ga0495591_053432_317_721 134
377 3300046458 Ga0495591_056291 Ga0495591_056291_444_848 134
378 3300046458 Ga0495591_078170 Ga0495591_078170_253_657 134
379 3300046458 Ga0495591_114532 Ga0495591_114532_171_575 134
380 3300046460 Ga0495638_0002621 Ga0495638_0002621_12542_12946 134
381 3300046460 Ga0495638_0028621 Ga0495638_0028621_2989_3393 134
382 3300046460 Ga0495638_0068625 Ga0495638_0068625_234_638 134
383 3300046460 Ga0495638_0101578 Ga0495638_0101578_468_872 134
384 3300046460 Ga0495638_0101647 Ga0495638_0101647_1013_1417 134
385 3300046460 Ga0495638_0167019 Ga0495638_0167019_219_623 134
386 3300046460 Ga0495638_0188496 Ga0495638_0188496_226_630 134
387 3300046460 Ga0495638_0303825 Ga0495638_0303825_131_535 134
388 3300046463 Ga0495653_0002213 Ga0495653_0002213_1573_1977 134
389 3300046463 Ga0495653_0007596 Ga0495653_0007596_4069_4473 134
390 3300046463 Ga0495653_0041578 Ga0495653_0041578_202_606 134
391 3300046463 Ga0495653_0091678 Ga0495653_0091678_1492_1896 134
392 3300046463 Ga0495653_0622360 Ga0495653_0622360_109_513 134
393 3300046471 Ga0495650_0012094 Ga0495650_0012094_586_990 134
394 3300046471 Ga0495650_0043915 Ga0495650_0043915_139_543 134
395 3300046471 Ga0495650_0134377 Ga0495650_0134377_201_605 134
396 3300046471 Ga0495650_0164611 Ga0495650_0164611_41_445 134
397 3300046472 Ga0495580_0484298 Ga0495580_0484298_62_466 134
398 3300046474 Ga0495605_0004348 Ga0495605_0004348_74_478 134
399 3300046474 Ga0495605_0046618 Ga0495605_0046618_183_587 134
400 3300046474 Ga0495605_0060483 Ga0495605_0060483_1066_1470 134
401 3300046474 Ga0495605_0114337 Ga0495605_0114337_363_767 134
402 3300046474 Ga0495605_0161565 Ga0495605_0161565_106_510 134
403 3300046474 Ga0495605_0164025 Ga0495605_0164025_371_775 134
404 3300046474 Ga0495605_0342027 Ga0495605_0342027_21_425 134
405 3300046474 Ga0495605_0421905 Ga0495605_0421905_125_529 134
406 3300046475 Ga0495639_0000086 Ga0495639_0000086_34431_34835 134
407 3300046475 Ga0495639_0406468 Ga0495639_0406468_238_642 134
408 3300046491 Ga0495584_0001054 Ga0495584_0001054_15226_15630 134
409 3300046491 Ga0495584_0005175 Ga0495584_0005175_1579_1983 134
410 3300046491 Ga0495584_0029964 Ga0495584_0029964_1176_1580 134
411 3300046491 Ga0495584_0048510 Ga0495584_0048510_184_588 134
412 3300046491 Ga0495584_0048611 Ga0495584_0048611_1432_1836 134
413 3300046491 Ga0495584_0057408 Ga0495584_0057408_126_530 134
414 3300046491 Ga0495584_0174215 Ga0495584_0174215_471_875 134
415 3300046491 Ga0495584_0234726 Ga0495584_0234726_223_627 134
416 3300046491 Ga0495584_0239643 Ga0495584_0239643_126_530 134
417 3300046491 Ga0495584_0507434 Ga0495584_0507434_80_484 134
418 3300046491 Ga0495584_0603789 Ga0495584_0603789_128_532 134
419 3300046492 Ga0495585_0001257 Ga0495585_0001257_18485_18889 134
420 3300046492 Ga0495585_0007697 Ga0495585_0007697_632_1036 134
421 3300046492 Ga0495585_0008998 Ga0495585_0008998_208_612 134
422 3300046492 Ga0495585_0014307 Ga0495585_0014307_2564_2968 134
423 3300046492 Ga0495585_0027209 Ga0495585_0027209_2727_3131 134
424 3300046492 Ga0495585_0091429 Ga0495585_0091429_770_1174 134
425 3300046492 Ga0495585_0162617 Ga0495585_0162617_584_988 134
426 3300046492 Ga0495585_0168756 Ga0495585_0168756_106_510 134
427 3300046492 Ga0495585_0369256 Ga0495585_0369256_208_612 134
428 3300046492 Ga0495585_0512011 Ga0495585_0512011_60_464 134
429 3300046499 Ga0495594_0068459 Ga0495594_0068459_1393_1797 134
430 3300046500 Ga0495596_0124501 Ga0495596_0124501_439_843 134
431 3300046501 Ga0495607_0002285 Ga0495607_0002285_1581_1985 134
432 3300046501 Ga0495607_0004396 Ga0495607_0004396_5981_6397 134
433 3300046501 Ga0495607_0005337 Ga0495607_0005337_8476_8880 134
434 3300046501 Ga0495607_0005402 Ga0495607_0005402_8653_9057 134
435 3300046501 Ga0495607_0005785 Ga0495607_0005785_6468_6872 134
436 3300046501 Ga0495607_0021044 Ga0495607_0021044_3251_3655 134
437 3300046501 Ga0495607_0029053 Ga0495607_0029053_2781_3185 134
438 3300046501 Ga0495607_0056174 Ga0495607_0056174_935_1339 134
439 3300046501 Ga0495607_0141108 Ga0495607_0141108_618_1022 134
440 3300046501 Ga0495607_0150145 Ga0495607_0150145_321_725 134
441 3300046501 Ga0495607_0160575 Ga0495607_0160575_80_484 134
442 3300046501 Ga0495607_0236599 Ga0495607_0236599_163_567 134
443 3300046501 Ga0495607_0292865 Ga0495607_0292865_113_517 134
444 3300046501 Ga0495607_0378183 Ga0495607_0378183_70_474 134
445 3300046501 Ga0495607_0384473 Ga0495607_0384473_186_590 134
446 3300046501 Ga0495607_0530072 Ga0495607_0530072_27_431 134
447 3300046506 Ga0495583_0007462 Ga0495583_0007462_416_820 134
448 3300046506 Ga0495583_0079717 Ga0495583_0079717_507_911 134
449 3300046507 Ga0495606_0008144 Ga0495606_0008144_5519_5923 134
450 3300046507 Ga0495606_0020157 Ga0495606_0020157_1523_1927 134
451 3300046507 Ga0495606_0020581 Ga0495606_0020581_536_940 134
452 3300046507 Ga0495606_0026182 Ga0495606_0026182_63_467 134
453 3300046507 Ga0495606_0027986 Ga0495606_0027986_3372_3776 134
454 3300046507 Ga0495606_0033274 Ga0495606_0033274_2627_3031 134
455 3300046507 Ga0495606_0073674 Ga0495606_0073674_158_562 134
456 3300046507 Ga0495606_0091786 Ga0495606_0091786_215_619 134
457 3300046507 Ga0495606_0115936 Ga0495606_0115936_1143_1547 134
458 3300046507 Ga0495606_0211437 Ga0495606_0211437_216_620 134
459 3300046507 Ga0495606_0298636 Ga0495606_0298636_325_729 134
460 3300046507 Ga0495606_0327220 Ga0495606_0327220_11_415 134
461 3300046507 Ga0495606_0384407 Ga0495606_0384407_205_609 134
462 3300046512 Ga0495610_0001135 Ga0495610_0001135_20320_20724 134
463 3300046512 Ga0495610_0003376 Ga0495610_0003376_1571_1975 134
464 3300046512 Ga0495610_0012495 Ga0495610_0012495_4283_4687 134
465 3300046512 Ga0495610_0016281 Ga0495610_0016281_3446_3850 134
466 3300046512 Ga0495610_0016514 Ga0495610_0016514_1567_1971 134
467 3300046512 Ga0495610_0021065 Ga0495610_0021065_2972_3376 134
468 3300046512 Ga0495610_0033551 Ga0495610_0033551_552_956 134
469 3300046512 Ga0495610_0039596 Ga0495610_0039596_281_685 134
470 3300046512 Ga0495610_0100252 Ga0495610_0100252_602_1006 134
471 3300046512 Ga0495610_0154553 Ga0495610_0154553_45_449 134
472 3300046512 Ga0495610_0290675 Ga0495610_0290675_41_445 134
473 3300046513 Ga0495616_0005357 Ga0495616_0005357_6895_7299 134
474 3300046513 Ga0495616_0005657 Ga0495616_0005657_6587_6991 134
475 3300046513 Ga0495616_0014718 Ga0495616_0014718_537_941 134
476 3300046513 Ga0495616_0039866 Ga0495616_0039866_202_606 134
477 3300046513 Ga0495616_0041096 Ga0495616_0041096_220_624 134
478 3300046513 Ga0495616_0061951 Ga0495616_0061951_1170_1574 134
479 3300046513 Ga0495616_0121807 Ga0495616_0121807_402_806 134
480 3300046513 Ga0495616_0236193 Ga0495616_0236193_269_673 134
481 3300046515 Ga0495620_0000808 Ga0495620_0000808_16570_16974 134
482 3300046515 Ga0495620_0027393 Ga0495620_0027393_1897_2301 134
483 3300046515 Ga0495620_0032507 Ga0495620_0032507_1780_2184 134
484 3300046515 Ga0495620_0047520 Ga0495620_0047520_1310_1714 134
485 3300046515 Ga0495620_0231838 Ga0495620_0231838_10_414 134
486 3300046516 Ga0495628_0168861 Ga0495628_0168861_1216_1620 134
487 3300046517 Ga0495630_0128311 Ga0495630_0128311_361_765 134
488 3300046518 Ga0495631_0000250 Ga0495631_0000250_10301_10705 134
489 3300046518 Ga0495631_0000276 Ga0495631_0000276_32145_32549 134
490 3300046518 Ga0495631_0025882 Ga0495631_0025882_1570_1974 134
491 3300046518 Ga0495631_0102813 Ga0495631_0102813_404_808 134
492 3300046518 Ga0495631_0111839 Ga0495631_0111839_547_951 134
493 3300046518 Ga0495631_0163304 Ga0495631_0163304_400_804 134
494 3300046519 Ga0495632_0001128 Ga0495632_0001128_20534_20938 134
495 3300046519 Ga0495632_0016832 Ga0495632_0016832_3420_3824 134
496 3300046519 Ga0495632_0020061 Ga0495632_0020061_1286_1690 134
497 3300046519 Ga0495632_0026676 Ga0495632_0026676_21_425 134
498 3300046519 Ga0495632_0032985 Ga0495632_0032985_1353_1757 134
499 3300046519 Ga0495632_0035979 Ga0495632_0035979_1367_1771 134
500 3300046519 Ga0495632_0133242 Ga0495632_0133242_573_977 134
501 3300046519 Ga0495632_0133970 Ga0495632_0133970_644_1048 134
502 3300046519 Ga0495632_0182340 Ga0495632_0182340_79_483 134
503 3300046520 Ga0495637_0000424 Ga0495637_0000424_28614_29018 134
504 3300046520 Ga0495637_0001077 Ga0495637_0001077_15895_16299 134
505 3300046520 Ga0495637_0001331 Ga0495637_0001331_5769_6173 134
506 3300046520 Ga0495637_0001707 Ga0495637_0001707_11937_12341 134
507 3300046520 Ga0495637_0004875 Ga0495637_0004875_4752_5156 134
508 3300046520 Ga0495637_0014590 Ga0495637_0014590_3034_3438 134
509 3300046520 Ga0495637_0020988 Ga0495637_0020988_1065_1469 134
510 3300046520 Ga0495637_0030244 Ga0495637_0030244_217_621 134
511 3300046520 Ga0495637_0033634 Ga0495637_0033634_112_516 134
512 3300046520 Ga0495637_0035686 Ga0495637_0035686_213_617 134
513 3300046520 Ga0495637_0036357 Ga0495637_0036357_175_579 134
514 3300046520 Ga0495637_0047524 Ga0495637_0047524_613_1017 134
515 3300046520 Ga0495637_0092689 Ga0495637_0092689_278_682 134
516 3300046520 Ga0495637_0268797 Ga0495637_0268797_196_600 134
517 3300046522 Ga0495643_0004491 Ga0495643_0004491_560_964 134
518 3300046522 Ga0495643_0022829 Ga0495643_0022829_2640_3044 134
519 3300046522 Ga0495643_0086047 Ga0495643_0086047_683_1087 134
520 3300046522 Ga0495643_0193935 Ga0495643_0193935_276_680 134
521 3300046522 Ga0495643_0205655 Ga0495643_0205655_129_533 134
522 3300046522 Ga0495643_0536439 Ga0495643_0536439_82_486 134
523 3300046523 Ga0495644_0000223 Ga0495644_0000223_1312_1716 134
524 3300046523 Ga0495644_0001517 Ga0495644_0001517_5713_6117 134
525 3300046523 Ga0495644_0025425 Ga0495644_0025425_208_612 134
526 3300046523 Ga0495644_0210499 Ga0495644_0210499_305_709 134
527 3300046524 Ga0495648_0031384 Ga0495648_0031384_1573_1977 134
528 3300046524 Ga0495648_0034873 Ga0495648_0034873_880_1284 134
529 3300046524 Ga0495648_0151874 Ga0495648_0151874_609_1013 134
530 3300046524 Ga0495648_0183731 Ga0495648_0183731_594_998 134
531 3300046524 Ga0495648_0211381 Ga0495648_0211381_63_467 134
532 3300046524 Ga0495648_0496131 Ga0495648_0496131_47_451 134
533 3300046526 Ga0495666_0136325 Ga0495666_0136325_725_1129 134
534 3300046526 Ga0495666_0264668 Ga0495666_0264668_17_421 134
535 3300046529 Ga0495652_0469752 Ga0495652_0469752_176_580 134
536 3300046530 Ga0495654_0000137 Ga0495654_0000137_449_853 134
537 3300046530 Ga0495654_0000702 Ga0495654_0000702_2894_3298 134
538 3300046530 Ga0495654_0001756 Ga0495654_0001756_12525_12929 134
539 3300046530 Ga0495654_0006574 Ga0495654_0006574_627_1031 134
540 3300046530 Ga0495654_0017627 Ga0495654_0017627_2038_2442 134
541 3300046530 Ga0495654_0066898 Ga0495654_0066898_239_643 134
542 3300046530 Ga0495654_0078117 Ga0495654_0078117_570_974 134
543 3300046530 Ga0495654_0125423 Ga0495654_0125423_583_987 134
544 3300046530 Ga0495654_0126028 Ga0495654_0126028_665_1069 134
545 3300046530 Ga0495654_0152622 Ga0495654_0152622_198_602 134
546 3300046530 Ga0495654_0167663 Ga0495654_0167663_353_757 134
547 3300046530 Ga0495654_0246112 Ga0495654_0246112_220_624 134
548 3300046530 Ga0495654_0268292 Ga0495654_0268292_221_625 134
549 3300046530 Ga0495654_0435259 Ga0495654_0435259_26_430 134
550 3300046536 Ga0495587_0024842 Ga0495587_0024842_339_743 134
551 3300046536 Ga0495587_0400769 Ga0495587_0400769_263_667 134
552 3300046538 Ga0495609_0005190 Ga0495609_0005190_5777_6181 134
553 3300046538 Ga0495609_0123817 Ga0495609_0123817_93_497 134
554 3300046538 Ga0495609_0144116 Ga0495609_0144116_468_872 134
555 3300046538 Ga0495609_0195302 Ga0495609_0195302_260_664 134
556 3300046542 Ga0495597_0002668 Ga0495597_0002668_1896_2300 134
557 3300046542 Ga0495597_0022891 Ga0495597_0022891_398_802 134
558 3300046542 Ga0495597_0026804 Ga0495597_0026804_1968_2372 134
559 3300046542 Ga0495597_0043299 Ga0495597_0043299_1585_1989 134
560 3300046542 Ga0495597_0103375 Ga0495597_0103375_562_966 134
561 3300046542 Ga0495597_0153746 Ga0495597_0153746_53_457 134
562 3300046542 Ga0495597_0192568 Ga0495597_0192568_226_630 134
563 3300046543 Ga0495645_0471088 Ga0495645_0471088_172_576 134
564 3300046557 Ga0495622_0000225 Ga0495622_0000225_34427_34831 134
565 3300046557 Ga0495622_0000482 Ga0495622_0000482_22375_22779 134
566 3300046558 Ga0495633_0042610 Ga0495633_0042610_165_569 134
567 3300046615 Ga0495656_0053907 Ga0495656_0053907_1308_1712 134
568 3300046615 Ga0495656_0498348 Ga0495656_0498348_232_636 134
569 3300046616 Ga0495668_0004667 Ga0495668_0004667_3321_3725 134
570 3300046642 Ga0495634_0001331 Ga0495634_0001331_20541_20945 134
571 3300046642 Ga0495634_0240611 Ga0495634_0240611_153_557 134
572 3300046648 Ga0495611_0000286 Ga0495611_0000286_31375_31779 134
573 3300046648 Ga0495611_0164639 Ga0495611_0164639_216_620 134
574 3300046648 Ga0495611_0172298 Ga0495611_0172298_283_687 134
575 3300046648 Ga0495611_0456080 Ga0495611_0456080_166_570 134
576 3300046660 Ga0495625_0004277 Ga0495625_0004277_9787_10191 134
577 3300046660 Ga0495625_0004376 Ga0495625_0004376_10297_10701 134
578 3300046660 Ga0495625_0005240 Ga0495625_0005240_8906_9310 134
579 3300046660 Ga0495625_0043158 Ga0495625_0043158_2657_3061 134
580 3300046660 Ga0495625_0126733 Ga0495625_0126733_360_764 134
581 3300046660 Ga0495625_0335587 Ga0495625_0335587_242_646 134
582 3300046660 Ga0495625_0476914 Ga0495625_0476914_263_667 134
583 3300046660 Ga0495625_0705576 Ga0495625_0705576_167_571 134
584 3300046660 Ga0495625_0769650 Ga0495625_0769650_83_487 134
585 3300046663 Ga0495635_0012749 Ga0495635_0012749_1526_1930 134
586 3300046664 Ga0495659_0000110 Ga0495659_0000110_1719_2123 134
587 3300046664 Ga0495659_0001576 Ga0495659_0001576_458_862 134
588 3300046665 Ga0495661_0000575 Ga0495661_0000575_7107_7511 134
589 3300046665 Ga0495661_0005029 Ga0495661_0005029_8531_8935 134
590 3300046665 Ga0495661_0010957 Ga0495661_0010957_5707_6111 134
591 3300046665 Ga0495661_0027806 Ga0495661_0027806_1456_1860 134
592 3300046665 Ga0495661_0043715 Ga0495661_0043715_2141_2545 134
593 3300046665 Ga0495661_0071638 Ga0495661_0071638_43_447 134
594 3300046665 Ga0495661_0076772 Ga0495661_0076772_1383_1787 134
595 3300046665 Ga0495661_0165290 Ga0495661_0165290_555_959 134
596 3300046665 Ga0495661_0503309 Ga0495661_0503309_111_515 134
597 3300046665 Ga0495661_0551326 Ga0495661_0551326_44_448 134
598 3300046679 Ga0495623_0039669 Ga0495623_0039669_1346_1750 134
599 3300046680 Ga0495646_0048365 Ga0495646_0048365_2005_2409 134
600 3300046680 Ga0495646_0259173 Ga0495646_0259173_80_484 134
601 3300046680 Ga0495646_0302648 Ga0495646_0302648_80_484 134
602 3300046684 Ga0495669_0416525 Ga0495669_0416525_154_558 134
603 3300046689 Ga0495613_0102116 Ga0495613_0102116_1557_1961 134
604 3300046689 Ga0495613_0115248 Ga0495613_0115248_1280_1684 134
605 3300046690 Ga0495624_0069379 Ga0495624_0069379_217_621 134
606 3300046691 Ga0495670_0000889 Ga0495670_0000889_650_1054 134
607 3300046691 Ga0495670_0001208 Ga0495670_0001208_8784_9188 134
608 3300046691 Ga0495670_0001590 Ga0495670_0001590_8833_9237 134
609 3300046691 Ga0495670_0138749 Ga0495670_0138749_249_653 134
610 3300046691 Ga0495670_0236420 Ga0495670_0236420_324_728 134
611 3300046691 Ga0495670_0372873 Ga0495670_0372873_273_677 134
612 3300046691 Ga0495670_0797440 Ga0495670_0797440_73_477 134
613 3300046692 Ga0495671_0001223 Ga0495671_0001223_15653_16057 134
614 3300046692 Ga0495671_0007222 Ga0495671_0007222_4704_5108 134
615 3300046692 Ga0495671_0073457 Ga0495671_0073457_260_664 134
616 3300046692 Ga0495671_0129516 Ga0495671_0129516_204_608 134
617 3300046692 Ga0495671_0139930 Ga0495671_0139930_335_739 134
618 3300046692 Ga0495671_0153282 Ga0495671_0153282_514_918 134
619 3300046692 Ga0495671_0162126 Ga0495671_0162126_120_524 134
620 3300046692 Ga0495671_0241039 Ga0495671_0241039_325_729 134
621 3300046692 Ga0495671_0621529 Ga0495671_0621529_19_423 134
622 3300046692 Ga0495671_0646821 Ga0495671_0646821_81_485 134
623 3300046694 Ga0495649_0001059 Ga0495649_0001059_17958_18362 134
624 3300046694 Ga0495649_0024331 Ga0495649_0024331_1690_2094 134
625 3300046694 Ga0495649_0027004 Ga0495649_0027004_1387_1791 134
626 3300046694 Ga0495649_0037588 Ga0495649_0037588_1947_2351 134
627 3300046694 Ga0495649_0045439 Ga0495649_0045439_411_815 134
628 3300046694 Ga0495649_0048301 Ga0495649_0048301_1696_2100 134
629 3300046694 Ga0495649_0049008 Ga0495649_0049008_190_594 134
630 3300046694 Ga0495649_0065793 Ga0495649_0065793_635_1039 134
631 3300046694 Ga0495649_0152480 Ga0495649_0152480_711_1115 134
632 3300046694 Ga0495649_0189622 Ga0495649_0189622_130_534 134
633 3300046694 Ga0495649_0191486 Ga0495649_0191486_562_966 134
634 3300046694 Ga0495649_0213841 Ga0495649_0213841_154_558 134
635 3300046694 Ga0495649_0336203 Ga0495649_0336203_196_600 134
636 3300046694 Ga0495649_0576014 Ga0495649_0576014_127_531 134
637 3300046794 Ga0495589_0000667 Ga0495589_0000667_3031_3435 134
638 3300046794 Ga0495589_0008464 Ga0495589_0008464_268_672 134
639 3300046794 Ga0495589_0031454 Ga0495589_0031454_2055_2459 134
640 3300046794 Ga0495589_0096754 Ga0495589_0096754_103_507 134
641 3300046794 Ga0495589_0241521 Ga0495589_0241521_288_692 134
642 3300046794 Ga0495589_0295406 Ga0495589_0295406_215_619 134
643 3300046794 Ga0495589_0319762 Ga0495589_0319762_202_612 134
644 3300046809 Ga0495600_0132456 Ga0495600_0132456_137_541 134
645 3300046810 Ga0495660_0003097 Ga0495660_0003097_2649_3053 134
646 3300046810 Ga0495660_0007035 Ga0495660_0007035_3586_3990 134
647 3300046810 Ga0495660_0023919 Ga0495660_0023919_2533_2937 134
648 3300046810 Ga0495660_0053801 Ga0495660_0053801_185_589 134
649 3300046810 Ga0495660_0057835 Ga0495660_0057835_1267_1671 134
650 3300046810 Ga0495660_0062523 Ga0495660_0062523_98_502 134
651 3300046810 Ga0495660_0063183 Ga0495660_0063183_817_1221 134
652 3300046810 Ga0495660_0090130 Ga0495660_0090130_42_449 134
653 3300046810 Ga0495660_0141652 Ga0495660_0141652_613_1017 134
654 3300046810 Ga0495660_0162198 Ga0495660_0162198_517_921 134
655 3300046810 Ga0495660_0206851 Ga0495660_0206851_288_692 134
656 3300046810 Ga0495660_0309170 Ga0495660_0309170_96_500 134
657 3300046810 Ga0495660_0413634 Ga0495660_0413634_44_448 134
658 3300047315 Ga0495581_0034121 Ga0495581_0034121_411_815 134
659 3300047317 Ga0495604_0006964 Ga0495604_0006964_1537_1941 134
660 3300047317 Ga0495604_0055222 Ga0495604_0055222_1590_1994 134
661 3300047320 Ga0495672_0002030 Ga0495672_0002030_1576_1980 134
662 3300047320 Ga0495672_0002566 Ga0495672_0002566_15729_16133 134
663 3300047320 Ga0495672_0004290 Ga0495672_0004290_11019_11423 134
664 3300047320 Ga0495672_0011806 Ga0495672_0011806_2584_2988 134
665 3300047320 Ga0495672_0024807 Ga0495672_0024807_2044_2448 134
666 3300047320 Ga0495672_0306926 Ga0495672_0306926_301_705 134
667 3300047320 Ga0495672_0381998 Ga0495672_0381998_91_495 134
668 3300047320 Ga0495672_0395000 Ga0495672_0395000_133_537 134
669 3300047321 Ga0495676_0004850 Ga0495676_0004850_8947_9351 134
670 3300047321 Ga0495676_0005794 Ga0495676_0005794_3090_3494 134
671 3300047321 Ga0495676_0322992 Ga0495676_0322992_206_610 134
672 3300047322 Ga0495680_0008909 Ga0495680_0008909_7136_7540 134
673 3300047322 Ga0495680_0097803 Ga0495680_0097803_1572_1976 134
674 3300047322 Ga0495680_0625977 Ga0495680_0625977_110_514 134
675 3300047323 Ga0495683_0000675 Ga0495683_0000675_21022_21426 134
676 3300047323 Ga0495683_0000686 Ga0495683_0000686_17529_17933 134
677 3300047323 Ga0495683_0014343 Ga0495683_0014343_3178_3582 134
678 3300047323 Ga0495683_0020679 Ga0495683_0020679_1364_1768 134
679 3300047323 Ga0495683_0037979 Ga0495683_0037979_92_496 134
680 3300047323 Ga0495683_0054379 Ga0495683_0054379_71_475 134
681 3300047323 Ga0495683_0056562 Ga0495683_0056562_52_456 134
682 3300047323 Ga0495683_0059766 Ga0495683_0059766_665_1069 134
683 3300047323 Ga0495683_0186118 Ga0495683_0186118_291_695 134
684 3300047323 Ga0495683_0199726 Ga0495683_0199726_301_705 134
685 3300047323 Ga0495683_0306781 Ga0495683_0306781_258_662 134
686 3300047323 Ga0495683_0469158 Ga0495683_0469158_44_448 134
687 3300047443 Ga0495687_005180 Ga0495687_005180_7236_7640 134
688 3300047444 Ga0495675_0215042 Ga0495675_0215042_488_892 134
689 3300047445 Ga0495677_0325716 Ga0495677_0325716_141_545 134
690 3300047446 Ga0495679_002492 Ga0495679_002492_410_814 134
691 3300047446 Ga0495679_015478 Ga0495679_015478_1901_2305 134
692 3300047446 Ga0495679_018322 Ga0495679_018322_1886_2290 134
693 3300047446 Ga0495679_052278 Ga0495679_052278_167_571 134
694 3300047446 Ga0495679_083014 Ga0495679_083014_220_624 134
695 3300047446 Ga0495679_084574 Ga0495679_084574_449_853 134
696 3300047469 Ga0495673_0002498 Ga0495673_0002498_11160_11564 134
697 3300047469 Ga0495673_0009330 Ga0495673_0009330_3092_3496 134
698 3300047469 Ga0495673_0018088 Ga0495673_0018088_1659_2063 134
699 3300047469 Ga0495673_0026193 Ga0495673_0026193_2187_2591 134
700 3300047469 Ga0495673_0027354 Ga0495673_0027354_443_847 134
701 3300047469 Ga0495673_0074143 Ga0495673_0074143_237_641 134
702 3300047469 Ga0495673_0225199 Ga0495673_0225199_221_625 134
703 3300047470 Ga0495681_0000966 Ga0495681_0000966_2688_3092 134
704 3300047470 Ga0495681_0001799 Ga0495681_0001799_13799_14203 134
705 3300047470 Ga0495681_0004294 Ga0495681_0004294_9089_9493 134
706 3300047470 Ga0495681_0007071 Ga0495681_0007071_234_638 134
707 3300047470 Ga0495681_0017801 Ga0495681_0017801_1986_2390 134
708 3300047470 Ga0495681_0060216 Ga0495681_0060216_1326_1730 134
709 3300047470 Ga0495681_0221200 Ga0495681_0221200_100_504 134
710 3300047470 Ga0495681_0248276 Ga0495681_0248276_120_524 134
711 3300047470 Ga0495681_0404612 Ga0495681_0404612_62_466 134
712 3300047471 Ga0495684_0146357 Ga0495684_0146357_173_577 134
713 3300047472 Ga0495686_0020032 Ga0495686_0020032_656_1060 134
714 3300047472 Ga0495686_0072326 Ga0495686_0072326_1052_1456 134
715 3300047472 Ga0495686_0189832 Ga0495686_0189832_391_795 134
716 3300047472 Ga0495686_0208888 Ga0495686_0208888_320_724 134
717 3300047472 Ga0495686_0445613 Ga0495686_0445613_211_615 134
718 3300047673 Ga0495593_0051598 Ga0495593_0051598_333_737 134
719 3300047673 Ga0495593_0078967 Ga0495593_0078967_1284_1688 134
720 3300047673 Ga0495593_0090837 Ga0495593_0090837_211_615 134
721 3300047673 Ga0495593_0218026 Ga0495593_0218026_46_450 134
722 3300048088 Ga0495602_0107582 Ga0495602_0107582_335_739 134
723 3300048089 Ga0495614_0259853 Ga0495614_0259853_330_734 134
724 3300048091 Ga0495626_0001018 Ga0495626_0001018_13378_13782 134
725 3300048091 Ga0495626_0002062 Ga0495626_0002062_10779_11183 134
726 3300048091 Ga0495626_0010179 Ga0495626_0010179_4443_4847 134
727 3300048091 Ga0495626_0018056 Ga0495626_0018056_2549_2953 134
728 3300048091 Ga0495626_0024546 Ga0495626_0024546_1935_2339 134
729 3300048091 Ga0495626_0137169 Ga0495626_0137169_594_998 134
730 3300048091 Ga0495626_0168982 Ga0495626_0168982_74_478 134
731 3300048091 Ga0495626_0296648 Ga0495626_0296648_190_594 134
732 3300048904 Ga0496101_0460807 Ga0496101_0460807_579_983 134
733 3300048905 Ga0496102_0000963 Ga0496102_0000963_1495_1899 134
734 3300048906 Ga0496103_0002945 Ga0496103_0002945_1434_1838 134
735 3300048907 Ga0496104_0511590 Ga0496104_0511590_178_582 134
736 3300048908 Ga0496105_0641153 Ga0496105_0641153_87_491 134
737 3300048909 Ga0496106_0352417 Ga0496106_0352417_245_649 134
738 3300048910 Ga0496107_0491462 Ga0496107_0491462_236_640 134
739 3300048913 Ga0496110_0071726 Ga0496110_0071726_331_735 134
740 3300048916 Ga0496113_1319088 Ga0496113_1319088_20_424 134
741 3300048917 Ga0496114_0429770 Ga0496114_0429770_454_858 134
742 3300048918 Ga0496115_0333671 Ga0496115_0333671_462_866 134
743 3300048919 Ga0496116_0000824 Ga0496116_0000824_35219_35623 134
744 3300048919 Ga0496116_0005891 Ga0496116_0005891_1556_1960 134
745 3300048919 Ga0496116_0011922 Ga0496116_0011922_5200_5604 134
746 3300048919 Ga0496116_0067220 Ga0496116_0067220_420_824 134
747 3300048920 Ga0496117_0006785 Ga0496117_0006785_1504_1908 134
748 3300048920 Ga0496117_0008064 Ga0496117_0008064_1534_1938 134
749 3300048920 Ga0496117_0087105 Ga0496117_0087105_413_817 134
750 3300048920 Ga0496117_0091484 Ga0496117_0091484_20_424 134
751 3300048920 Ga0496117_0183792 Ga0496117_0183792_266_670 134
752 3300048920 Ga0496117_0190496 Ga0496117_0190496_232_636 134
753 3300048920 Ga0496117_0339962 Ga0496117_0339962_110_514 134
754 3300048921 Ga0496118_0009042 Ga0496118_0009042_8195_8599 134
755 3300048921 Ga0496118_0022925 Ga0496118_0022925_3503_3907 134
756 3300048921 Ga0496118_0030037 Ga0496118_0030037_407_811 134
757 3300048921 Ga0496118_0031218 Ga0496118_0031218_400_804 134
758 3300048921 Ga0496118_0085582 Ga0496118_0085582_1450_1854 134
759 3300048921 Ga0496118_0196630 Ga0496118_0196630_247_651 134
760 3300048921 Ga0496118_0227027 Ga0496118_0227027_517_921 134
761 3300048923 Ga0496120_0205568 Ga0496120_0205568_266_670 134
762 3300048923 Ga0496120_0243911 Ga0496120_0243911_196_600 134
763 3300048923 Ga0496120_0275099 Ga0496120_0275099_212_616 134
764 3300048923 Ga0496120_0353450 Ga0496120_0353450_90_494 134
765 3300048924 Ga0496121_0009775 Ga0496121_0009775_1570_1974 134
766 3300048924 Ga0496121_0029238 Ga0496121_0029238_3713_4117 134
767 3300048924 Ga0496121_0037117 Ga0496121_0037117_382_786 134
768 3300048924 Ga0496121_0089185 Ga0496121_0089185_629_1033 134
769 3300048924 Ga0496121_0410827 Ga0496121_0410827_282_686 134
770 3300048925 Ga0496122_0001608 Ga0496122_0001608_299_703 134
771 3300048925 Ga0496122_0048394 Ga0496122_0048394_596_1000 134
772 3300048925 Ga0496122_0265822 Ga0496122_0265822_162_566 134
773 3300048926 Ga0496123_0008778 Ga0496123_0008778_8253_8657 134
774 3300048926 Ga0496123_0245112 Ga0496123_0245112_17_421 134
775 3300048926 Ga0496123_0342018 Ga0496123_0342018_100_504 134
776 3300048927 Ga0496124_0003600 Ga0496124_0003600_1523_1927 134
777 3300048927 Ga0496124_0015291 Ga0496124_0015291_1586_1990 134
778 3300048927 Ga0496124_0130380 Ga0496124_0130380_392_796 134
779 3300048927 Ga0496124_0141186 Ga0496124_0141186_214_618 134
780 3300048928 Ga0496125_0004482 Ga0496125_0004482_1588_1992 134
781 3300048928 Ga0496125_0126332 Ga0496125_0126332_280_684 134
782 3300048928 Ga0496125_0139962 Ga0496125_0139962_516_920 134
783 3300048928 Ga0496125_0280507 Ga0496125_0280507_425_829 134
784 3300048929 Ga0496126_0044008 Ga0496126_0044008_1453_1857 134
785 3300048929 Ga0496126_0438960 Ga0496126_0438960_417_821 134
786 3300049459 Ga0495678_000992 Ga0495678_000992_1420_1824 134
787 3300049459 Ga0495678_004782 Ga0495678_004782_6705_7109 134
788 3300049459 Ga0495678_007695 Ga0495678_007695_4498_4902 134
789 3300049459 Ga0495678_008128 Ga0495678_008128_2539_2943 134
790 3300049459 Ga0495678_011559 Ga0495678_011559_3300_3704 134
791 3300049459 Ga0495678_029518 Ga0495678_029518_1680_2084 134
792 3300049459 Ga0495678_035982 Ga0495678_035982_63_467 134
793 3300049459 Ga0495678_090819 Ga0495678_090819_638_1042 134
794 3300049459 Ga0495678_095274 Ga0495678_095274_555_959 134
795 3300049459 Ga0495678_225492 Ga0495678_225492_91_495 134
796 3300049460 Ga0495682_0001863 Ga0495682_0001863_1370_1774 134
797 3300049460 Ga0495682_0070463 Ga0495682_0070463_349_753 134
798 3300049460 Ga0495682_0118400 Ga0495682_0118400_436_840 134
799 3300049460 Ga0495682_0120217 Ga0495682_0120217_453_857 134
800 3300049758 Ga0501241_000096 Ga0501241_000096_1527_1931 134
801 3300050491 nmdc:mga00v17_380421_c1 nmdc:mga00v17_380421_c1_440_844 134
802 3300053111 Ga0500572_007230 Ga0500572_007230_125_529 134
803 3300053125 Ga0500618_005147 Ga0500618_005147_2111_2515 134
804 3300053145 Ga0500586_116210 Ga0500586_116210_115_519 134
805 3300053147 Ga0500589_289260 Ga0500589_289260_137_541 134
806 3300053161 Ga0500634_0004624 Ga0500634_0004624_496_900 134

Feature Viewer

pLDDT pTM Quality
62.63 0.16 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map