F481672

General Info

Members Datasets Scaffolds Average Seq Length
807 419 1614 134

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100859380|Ga0070673_1008593802
Length 135
Sequence MLKYLLDTNLCIRVLRDRPQGLREKFNAEASSLCISSVVLYELLYRAAKSSRPVENRHAVEAFAAHMEVIDFDADAAAHAGEIRADLERQGTPIGSYNLLIAGHARSRGLIVITGNLGEFRRVDGLRCDDWELPN

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
4 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
144 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
145 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
146 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
178 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
187 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
188 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
189 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
190 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
191 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
192 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
193 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
200 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
201 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
202 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
226 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
270 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
290 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
291 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
297 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
298 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
299 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
300 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
301 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
304 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
305 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
314 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
315 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
316 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
317 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
318 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
323 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
324 2511231008 Pseudomonas sp. GM21 Isolate Nodule
325 2511231014 Pseudomonas sp. GM48 Isolate Nodule
326 2511231015 Pseudomonas sp. GM49 Isolate Nodule
327 2511231017 Pseudomonas sp. GM55 Isolate Nodule
328 2511231019 Pseudomonas sp. GM67 Isolate Nodule
329 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
330 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
331 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
332 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
333 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
334 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
335 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
336 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
337 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
338 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
339 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
340 2643221557 Ensifer sp. Root558 Isolate Unclassified
341 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
342 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
343 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
344 2643221607 Rhizobium sp. Root73 Isolate Unclassified
345 2643221618 Ensifer sp. Root231 Isolate Unclassified
346 2643221626 Ensifer sp. Root31 Isolate Unclassified
347 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
348 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
349 2643221655 Ensifer sp. Root1252 Isolate Unclassified
350 2643221659 Ensifer sp. Root127 Isolate Unclassified
351 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
352 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
353 2643221698 Ensifer sp. Root142 Isolate Unclassified
354 2643221712 Ensifer sp. Root258 Isolate Unclassified
355 2643221723 Ensifer sp. Root278 Isolate Unclassified
356 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
357 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
358 2738541280 Massilia sp. GV090 Isolate Unclassified
359 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
360 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
361 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
362 2751185800 Brucella pituitosa AA2 Isolate Unclassified
363 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
364 2765235841 Pseudomonas putida AA7 Isolate Unclassified
365 2773857670 Pseudomonas sp. 478 Isolate Unclassified
366 2784132072 Pseudomonas sp. 460 Isolate Unclassified
367 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
368 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
369 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
370 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
371 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
372 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
373 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
374 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
375 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
376 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
377 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
378 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
379 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
380 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
381 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
382 2844163670 Ensifer sp. 1H6 Isolate Unclassified
383 2849560528 Caulobacter zeae 410 Isolate Unclassified
384 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
385 2851153111 Caulobacter radicis 736 Isolate Unclassified
386 2854911287 Brucella lupini LUP21 Isolate Unclassified
387 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
388 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
389 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
390 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
391 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
392 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
393 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
394 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
395 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
396 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
397 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
398 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
399 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
400 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
401 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
402 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
403 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
404 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
405 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
406 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
407 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
408 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
409 8005258706 Rhizobium sp. R693 Isolate Nodule
410 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
411 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
412 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
413 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
414 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
415 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
416 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
417 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
418 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
419 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.48
Metatranscriptomes 0.37
Isolates 12.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.78
Nodule 2.85
Rhizoplane 2.48
Rhizosphere 71.62
Stem 0
Stem Tuber 0.12
Unclassified 5.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100859380 3300005364 Unclassified 840
2 RicEn_C7519 2010549000 Bacteria 4197
3 MRS2a_Contig_11594 2124908027 Bacteria 815
4 SwRhRL2b_contig_30749 2162886007 Bacteria 1418
5 SwRhRL2b_contig_519226 2162886007 Bacteria 1658
6 JGI25162J39368_1001056 3300002737 Bacteria 16862
7 JGI25158J39367_1002355 3300002739 Bacteria 3092
8 JGI25163J39215_1003290 3300002771 Bacteria 1344
9 JGI25164J39214_1000563 3300002772 Bacteria 16855
10 JGI25159J45721_1000083 3300002987 Bacteria 44911
11 JGI25159J45721_1000466 3300002987 Bacteria 18688
12 JGI25151J46595_10036444 3300003187 Bacteria 1856
13 JGI25165J46597_1001123 3300003214 Bacteria 16862
14 rootH1_10044342 3300003316 Bacteria 20524
15 rootH1_10130566 3300003316 Bacteria 1494
16 rootH2_10081916 3300003320 Bacteria 2517
17 rootH1_10328791 3300003323 Unclassified 1006
18 JGI25160J50197_1000005 3300003354 Bacteria 417280
19 JGI25161J50226_1000349 3300003374 Bacteria 24501
20 Ga0006562J51391_1008015 3300003578 Bacteria 4010
21 Ga0055526_1002592 3300003771 Bacteria 12087
22 Ga0055524_1033754 3300003775 Bacteria 1427
23 Ga0055536_1004642 3300003781 Bacteria 6949
24 Ga0055536_1016156 3300003781 Bacteria 2510
25 Ga0055536_1016300 3300003781 Bacteria 2491
26 Ga0055530_10008853 3300003791 Bacteria 3962
27 Ga0055530_10012947 3300003791 Bacteria 2878
28 Ga0055530_10032239 3300003791 Bacteria 1365
29 Ga0055540_1012563 3300003792 Bacteria 2648
30 Ga0055540_1068700 3300003792 Bacteria 695
31 Ga0055531_10001364 3300003794 Bacteria 18136
32 Ga0055531_10004249 3300003794 Bacteria 8812
33 Ga0055531_10073595 3300003794 Bacteria 778
34 Ga0058692_1015795 3300003856 Bacteria 1692
35 Ga0058692_1018212 3300003856 Bacteria 1523
36 Ga0055543_1000324 3300004625 Bacteria 33093
37 Ga0065165_1000002 3300005262 Bacteria 444192
38 Ga0065165_1000264 3300005262 Bacteria 90435
39 Ga0065714_10009236 3300005288 Bacteria 3678
40 Ga0065714_10020005 3300005288 Bacteria 1716
41 Ga0065714_10112802 3300005288 Bacteria 1450
42 Ga0065714_10233113 3300005288 Bacteria 812
43 Ga0065714_10308760 3300005288 Bacteria 682
44 Ga0065714_10316355 3300005288 Bacteria 674
45 Ga0065704_10085495 3300005289 Bacteria 3216
46 Ga0065704_10098219 3300005289 Bacteria 2361
47 Ga0065704_10148567 3300005289 Bacteria 1448
48 Ga0065704_10357297 3300005289 Bacteria 791
49 Ga0065712_10079004 3300005290 Bacteria 3270
50 Ga0065715_10887876 3300005293 Bacteria 579
51 Ga0070676_11025332 3300005328 Unclassified 620
52 Ga0070660_100047978 3300005339 Unclassified 3279
53 Ga0070660_100734940 3300005339 Bacteria 828
54 Ga0070669_100168990 3300005353 Bacteria 1704
55 Ga0070671_100042696 3300005355 Bacteria 3769
56 Ga0070659_100095774 3300005366 Bacteria 2384
57 Ga0070667_100726123 3300005367 Bacteria 920
58 Ga0070709_10929164 3300005434 Bacteria 689
59 Ga0070713_101026596 3300005436 Unclassified 796
60 Ga0070710_11375397 3300005437 Unclassified 527
61 Ga0070662_100203815 3300005457 Bacteria 1571
62 Ga0070665_100293480 3300005548 Bacteria 1628
63 Ga0070665_100473519 3300005548 Bacteria 1263
64 Ga0068855_100788564 3300005563 Bacteria 1011
65 Ga0070664_101156832 3300005564 Bacteria 729
66 Ga0068854_100649812 3300005578 Bacteria 905
67 Ga0068854_101751431 3300005578 Unclassified 569
68 Ga0068856_101674170 3300005614 Bacteria 649
69 Ga0068864_100000218 3300005618 Bacteria 51909
70 Ga0068864_100211383 3300005618 Bacteria 1786
71 Ga0068866_10484335 3300005718 Unclassified 815
72 Ga0068861_100166465 3300005719 Bacteria 1823
73 Ga0068851_10947323 3300005834 Unclassified 541
74 Ga0068858_100000352 3300005842 Bacteria 48455
75 Ga0068858_100001656 3300005842 Bacteria 22765
76 Ga0068862_101091742 3300005844 Unclassified 793
77 Ga0081455_10404061 3300005937 Bacteria 947
78 Ga0075365_10011682 3300006038 Bacteria 5174
79 Ga0075365_10017919 3300006038 Bacteria 4345
80 Ga0075365_10831908 3300006038 Bacteria 651
81 Ga0075364_10010433 3300006051 Bacteria 5611
82 Ga0075364_10104148 3300006051 Bacteria 1890
83 Ga0075364_10110610 3300006051 Bacteria 1833
84 Ga0075432_10055925 3300006058 Bacteria 1398
85 Ga0075432_10096218 3300006058 Bacteria 1089
86 Ga0075432_10113606 3300006058 Bacteria 1011
87 Ga0075432_10278232 3300006058 Bacteria 688
88 Ga0075432_10602777 3300006058 Bacteria 502
89 Ga0075362_10056386 3300006177 Bacteria 1768
90 Ga0075362_10444025 3300006177 Bacteria 658
91 Ga0075369_10004738 3300006186 Bacteria 5048
92 Ga0075369_10143099 3300006186 Bacteria 1091
93 Ga0097621_100903195 3300006237 Unclassified 823
94 Ga0075370_10065222 3300006353 Bacteria 2077
95 Ga0068871_100789896 3300006358 Unclassified 874
96 Ga0075430_100468458 3300006846 Unclassified 1040
97 Ga0075436_100110011 3300006914 Bacteria 1922
98 Ga0075436_100343702 3300006914 Bacteria 1074
99 Ga0079104_1000104 3300006946 Bacteria 123967
100 Ga0079104_1001328 3300006946 Bacteria 16967
101 Ga0079104_1073514 3300006946 Bacteria 713
102 Ga0099826_10004152 3300006948 Bacteria 10078
103 Ga0105251_10000466 3300009011 Bacteria 38664
104 Ga0105251_10034510 3300009011 Bacteria 2502
105 Ga0105251_10157004 3300009011 Bacteria 1026
106 Ga0105251_10372385 3300009011 Bacteria 654
107 Ga0105251_10519238 3300009011 Bacteria 558
108 Ga0105244_10027860 3300009036 Bacteria 3038
109 Ga0105244_10028008 3300009036 Bacteria 3028
110 Ga0105244_10147147 3300009036 Bacteria 1130
111 Ga0105244_10156728 3300009036 Bacteria 1089
112 Ga0105244_10170343 3300009036 Bacteria 1036
113 Ga0105244_10180080 3300009036 Bacteria 1003
114 Ga0105250_10034265 3300009092 Bacteria 2038
115 Ga0105250_10035115 3300009092 Bacteria 2011
116 Ga0105250_10060380 3300009092 Bacteria 1524
117 Ga0105250_10132132 3300009092 Bacteria 1031
118 Ga0105250_10210668 3300009092 Bacteria 822
119 Ga0105250_10227803 3300009092 Bacteria 792
120 Ga0105250_10303352 3300009092 Bacteria 691
121 Ga0105240_10549366 3300009093 Bacteria 1278
122 Ga0105245_10001436 3300009098 Bacteria 21598
123 Ga0105243_10049280 3300009148 Bacteria 3322
124 Ga0105243_10096200 3300009148 Bacteria 2449
125 Ga0105243_10736276 3300009148 Bacteria 965
126 Ga0105242_11572672 3300009176 Bacteria 690
127 Ga0105248_10007725 3300009177 Bacteria 11809
128 Ga0105238_11554376 3300009551 Bacteria 691
129 Ga0105249_10157648 3300009553 Bacteria 2191
130 Ga0157345_1000879 3300012498 Bacteria 2247
131 Ga0157373_10000160 3300013100 Bacteria 54531
132 Ga0157373_10009880 3300013100 Bacteria 7031
133 Ga0157373_10875215 3300013100 Bacteria 665
134 Ga0157373_11159517 3300013100 Bacteria 581
135 Ga0157371_10071919 3300013102 Bacteria 2449
136 Ga0157371_10175867 3300013102 Bacteria 1530
137 Ga0157371_10257754 3300013102 Bacteria 1257
138 Ga0157370_10086690 3300013104 Bacteria 2941
139 Ga0157370_10386681 3300013104 Bacteria 1288
140 Ga0157370_10630297 3300013104 Bacteria 981
141 Ga0157369_10039023 3300013105 Bacteria 5191
142 Ga0157378_10059990 3300013297 Bacteria 3395
143 Ga0163162_10015191 3300013306 Bacteria 7521
144 Ga0163162_10156336 3300013306 Bacteria 2400
145 Ga0163162_10183183 3300013306 Bacteria 2221
146 Ga0163162_10299871 3300013306 Bacteria 1739
147 Ga0163162_10386341 3300013306 Bacteria 1533
148 Ga0157375_10175495 3300013308 Bacteria 2292
149 Ga0157375_11178675 3300013308 Bacteria 898
150 Ga0157375_11300329 3300013308 Bacteria 855
151 Ga0157375_12375899 3300013308 Bacteria 632
152 Ga0182008_10007709 3300014497 Bacteria 5926
153 Ga0182008_10013620 3300014497 Bacteria 4273
154 Ga0182008_10027370 3300014497 Bacteria 2889
155 Ga0182008_10068729 3300014497 Bacteria 1743
156 Ga0182008_10117058 3300014497 Bacteria 1323
157 Ga0182008_10195381 3300014497 Bacteria 1028
158 Ga0157379_10724279 3300014968 Unclassified 935
159 Ga0157376_11382100 3300014969 Unclassified 735
160 Ga0182006_1012939 3300015261 Bacteria 3639
161 Ga0182006_1096870 3300015261 Bacteria 1053
162 Ga0182007_10003173 3300015262 Bacteria 7866
163 Ga0182007_10053020 3300015262 Bacteria 1336
164 Ga0182007_10137833 3300015262 Bacteria 824
165 Ga0182005_1046895 3300015265 Bacteria 1174
166 Ga0182005_1052573 3300015265 Bacteria 1109
167 Ga0182005_1052661 3300015265 Bacteria 1108
168 Ga0182005_1120672 3300015265 Bacteria 746
169 Ga0182005_1193945 3300015265 Bacteria 608
170 Ga0163161_10120991 3300017792 Bacteria 1967
171 Ga0163161_10161158 3300017792 Bacteria 1710
172 Ga0163161_10228308 3300017792 Bacteria 1444
173 Ga0163161_10410367 3300017792 Bacteria 1088
174 Ga0163161_11295858 3300017792 Unclassified 633
175 Ga0213872_10000747 3300021361 Bacteria 24034
176 Ga0213872_10003934 3300021361 Bacteria 8043
177 Ga0213872_10030473 3300021361 Unclassified 2472
178 Ga0213872_10032524 3300021361 Unclassified 2390
179 Ga0213872_10163047 3300021361 Unclassified 969
180 Ga0213872_10317277 3300021361 Unclassified 644
181 Ga0213875_10012055 3300021388 Bacteria 4281
182 Ga0209760_100140 3300025207 Bacteria 45356
183 Ga0209436_100162 3300025208 Bacteria 32237
184 Ga0209147_103422 3300025229 Bacteria 3098
185 Ga0207427_100016 3300025231 Bacteria 538697
186 Ga0209437_100011 3300025233 Bacteria 818520
187 Ga0209759_1001860 3300025256 Bacteria 10499
188 Ga0209233_1000019 3300025261 Bacteria 818520
189 Ga0209565_1010830 3300025263 Bacteria 2248
190 Ga0209130_1000010 3300025284 Bacteria 444920
191 Ga0209676_1000308 3300025292 Bacteria 95847
192 Ga0209676_1000320 3300025292 Bacteria 93515
193 Ga0209676_1004904 3300025292 Bacteria 7212
194 Ga0209676_1058390 3300025292 Bacteria 974
195 Ga0209025_1000687 3300025294 Bacteria 58005
196 Ga0209025_1012644 3300025294 Bacteria 5389
197 Ga0209564_1000025 3300025295 Bacteria 520535
198 Ga0209758_1046347 3300025297 Bacteria 1569
199 Ga0209050_1000466 3300025298 Bacteria 71734
200 Ga0209050_1000911 3300025298 Bacteria 39103
201 Ga0209050_1011196 3300025298 Bacteria 4292
202 Ga0209050_1016963 3300025298 Bacteria 2939
203 Ga0209256_1002250 3300025299 Bacteria 16402
204 Ga0209256_1059132 3300025299 Bacteria 899
205 Ga0207426_1000036 3300025302 Bacteria 444920
206 Ga0209051_1001718 3300025303 Bacteria 17480
207 Ga0209051_1023299 3300025303 Bacteria 2579
208 Ga0209257_1000338 3300025304 Bacteria 97721
209 Ga0209257_1005664 3300025304 Bacteria 8624
210 Ga0209257_1006123 3300025304 Bacteria 7978
211 Ga0207656_10675497 3300025321 Unclassified 528
212 Ga0207696_1000065 3300025711 Bacteria 231818
213 Ga0207696_1024123 3300025711 Bacteria 1910
214 Ga0207696_1053180 3300025711 Bacteria 1153
215 Ga0207696_1121838 3300025711 Bacteria 703
216 Ga0207655_1001270 3300025728 Bacteria 24082
217 Ga0207655_1053490 3300025728 Bacteria 1613
218 Ga0207655_1058326 3300025728 Bacteria 1510
219 Ga0207713_1000269 3300025735 Bacteria 63990
220 Ga0207713_1031081 3300025735 Bacteria 2367
221 Ga0207713_1059262 3300025735 Bacteria 1470
222 Ga0207713_1096087 3300025735 Bacteria 1032
223 Ga0207682_10139640 3300025893 Unclassified 1087
224 Ga0207699_10713177 3300025906 Bacteria 735
225 Ga0207671_10031074 3300025914 Bacteria 3981
226 Ga0207693_10152945 3300025915 Unclassified 1815
227 Ga0207657_10237338 3300025919 Bacteria 1457
228 Ga0207681_10129611 3300025923 Bacteria 1863
229 Ga0207687_10006357 3300025927 Bacteria 7807
230 Ga0207644_11244799 3300025931 Unclassified 625
231 Ga0207690_10184943 3300025932 Bacteria 1572
232 Ga0207706_10113871 3300025933 Bacteria 2379
233 Ga0207709_10138897 3300025935 Bacteria 1668
234 Ga0207709_11136771 3300025935 Bacteria 642
235 Ga0207711_10012751 3300025941 Bacteria 6981
236 Ga0207679_11101425 3300025945 Bacteria 729
237 Ga0207667_10164706 3300025949 Bacteria 2280
238 Ga0207651_10860459 3300025960 Unclassified 806
239 Ga0207712_10075390 3300025961 Bacteria 2438
240 Ga0207658_10662785 3300025986 Bacteria 941
241 Ga0207703_10001551 3300026035 Bacteria 20833
242 Ga0207703_10001574 3300026035 Bacteria 20688
243 Ga0207703_10727604 3300026035 Bacteria 945
244 Ga0207676_10000169 3300026095 Bacteria 57208
245 Ga0207676_10016717 3300026095 Bacteria 5312
246 Ga0207675_100088146 3300026118 Bacteria 2915
247 Ga0207683_10150499 3300026121 Bacteria 2100
248 Ga0209281_1000026 3300027111 Bacteria 465877
249 Ga0209281_1000717 3300027111 Bacteria 33033
250 Ga0209281_1004352 3300027111 Bacteria 4262
251 Ga0209371_1015214 3300027312 Bacteria 2077
252 Ga0209282_1008607 3300027666 Bacteria 6443
253 Ga0207428_10049800 3300027907 Bacteria 3355
254 Ga0207428_10092593 3300027907 Bacteria 2346
255 Ga0207428_10231474 3300027907 Bacteria 1383
256 Ga0207428_10506715 3300027907 Bacteria 876
257 Ga0268266_10204833 3300028379 Bacteria 1807
258 Ga0268266_10723832 3300028379 Bacteria 960
259 Ga0307517_10281107 3300028786 Bacteria 949
260 Ga0307515_10024017 3300028794 Bacteria 10646
261 Ga0316177_1190406 3300030731 Bacteria 3184
262 Ga0316179_1092971 3300030734 Bacteria 1341
263 Ga0316178_1122809 3300030735 Bacteria 6550
264 Ga0316183_1049590 3300030742 Bacteria 752
265 Ga0316181_1086264 3300030744 Bacteria 1443
266 Ga0265332_10053652 3300031238 Bacteria 1730
267 Ga0265320_10003123 3300031240 Bacteria 11245
268 Ga0307513_10906385 3300031456 Bacteria 589
269 Ga0307408_100191072 3300031548 Bacteria 1649
270 Ga0307408_100231849 3300031548 Bacteria 1512
271 Ga0307408_100233888 3300031548 Bacteria 1506
272 Ga0265313_10024553 3300031595 Bacteria 3217
273 Ga0307508_10019520 3300031616 Bacteria 6161
274 Ga0265314_10016259 3300031711 Bacteria 5886
275 Ga0307405_10018767 3300031731 Bacteria 3823
276 Ga0307405_10613597 3300031731 Bacteria 889
277 Ga0307405_10816243 3300031731 Bacteria 782
278 Ga0307405_11148512 3300031731 Bacteria 669
279 Ga0307413_10038575 3300031824 Bacteria 2770
280 Ga0307410_10427034 3300031852 Bacteria 1076
281 Ga0307406_10149843 3300031901 Bacteria 1663
282 Ga0307406_10940704 3300031901 Unclassified 738
283 Ga0307407_10559516 3300031903 Bacteria 846
284 Ga0307407_10587893 3300031903 Bacteria 827
285 Ga0307407_11380459 3300031903 Unclassified 555
286 Ga0307412_10005974 3300031911 Bacteria 6858
287 Ga0307412_10130162 3300031911 Bacteria 1826
288 Ga0307412_10756137 3300031911 Bacteria 839
289 Ga0307409_101213218 3300031995 Bacteria 778
290 Ga0307409_101524136 3300031995 Bacteria 696
291 Ga0307409_101802802 3300031995 Unclassified 641
292 Ga0307416_100138423 3300032002 Bacteria 2207
293 Ga0307416_100347869 3300032002 Bacteria 1498
294 Ga0307416_101227973 3300032002 Bacteria 855
295 Ga0307414_10011896 3300032004 Bacteria 5126
296 Ga0307414_10084898 3300032004 Bacteria 2330
297 Ga0307414_10161278 3300032004 Bacteria 1781
298 Ga0307414_10163398 3300032004 Bacteria 1771
299 Ga0307414_10402729 3300032004 Bacteria 1189
300 Ga0307414_10701448 3300032004 Bacteria 916
301 Ga0307414_11078803 3300032004 Unclassified 741
302 Ga0307411_10116667 3300032005 Bacteria 1922
303 Ga0307411_11153981 3300032005 Bacteria 701
304 Ga0307415_100927767 3300032126 Bacteria 804
305 Ga0307415_100968663 3300032126 Unclassified 789
306 Ga0316574_0171125 3300035398 Bacteria 1398
307 Ga0373933_0456734 3300035724 Bacteria 836
308 Ga0395899_0001089 3300037312 Bacteria 24380
309 Ga0395899_0335206 3300037312 Bacteria 1015
310 Ga0395899_0798720 3300037312 Bacteria 583
311 Ga0395900_0000108 3300037418 Bacteria 147706
312 Ga0395900_0007617 3300037418 Bacteria 11180
313 Ga0395900_0222737 3300037418 Bacteria 1900
314 Ga0395900_0670367 3300037418 Bacteria 972
315 Ga0395898_0009141 3300037466 Bacteria 10441
316 Ga0395898_0060019 3300037466 Unclassified 3697
317 Ga0395898_0185182 3300037466 Bacteria 1989
318 Ga0395905_0026339 3300037471 Bacteria 5483
319 Ga0395905_0077250 3300037471 Bacteria 3120
320 Ga0395905_1411360 3300037471 Unclassified 600
321 Ga0395905_1701214 3300037471 Unclassified 536
322 Ga0436364_0051522 3300037853 Bacteria 3570
323 Ga0436364_0061348 3300037853 Unclassified 1758
324 Ga0436364_0524095 3300037853 Bacteria 8185
325 Ga0395901_0000023 3300038443 Bacteria 283968
326 Ga0395901_0000050 3300038443 Bacteria 171046
327 Ga0395901_0000183 3300038443 Bacteria 81275
328 Ga0395901_0003967 3300038443 Bacteria 14881
329 Ga0395901_0237761 3300038443 Bacteria 1900
330 Ga0395901_0473364 3300038443 Bacteria 1278
331 Ga0436365_0118027 3300039437 Bacteria 1568
332 Ga0436361_0060925 3300039447 Bacteria 6643
333 Ga0436361_0422046 3300039447 Bacteria 2754
334 Ga0436361_0513574 3300039447 Bacteria 1182
335 Ga0436361_0576973 3300039447 Bacteria 5287
336 Ga0436361_0821550 3300039447 Unclassified 1368
337 Ga0436361_1057455 3300039447 Bacteria 40673
338 Ga0436361_1103751 3300039447 Unclassified 1271
339 Ga0436363_0398739 3300039450 Bacteria 2009
340 Ga0436363_0741000 3300039450 Bacteria 1470
341 Ga0436362_0250573 3300039453 Bacteria 1639
342 Ga0439438_000385 3300041405 Bacteria 19779
343 Ga0439438_001237 3300041405 Bacteria 11324
344 Ga0439438_002736 3300041405 Bacteria 7403
345 Ga0439438_009887 3300041405 Bacteria 3058
346 Ga0439438_017263 3300041405 Bacteria 2081
347 Ga0439438_046412 3300041405 Bacteria 1115
348 Ga0439438_064997 3300041405 Bacteria 909
349 Ga0439447_019572 3300041407 Bacteria 1803
350 Ga0439447_032890 3300041407 Bacteria 1294
351 Ga0439447_037780 3300041407 Bacteria 1188
352 Ga0439466_0003407 3300041411 Bacteria 6169
353 Ga0439466_0004719 3300041411 Bacteria 5236
354 Ga0439466_0014078 3300041411 Bacteria 2918
355 Ga0439466_0079893 3300041411 Bacteria 1032
356 Ga0439445_0044591 3300042004 Bacteria 1185
357 Ga0439445_0048139 3300042004 Bacteria 1146
358 Ga0439445_0210972 3300042004 Bacteria 575
359 Ga0439432_000116 3300042006 Bacteria 25928
360 Ga0439432_002197 3300042006 Bacteria 7369
361 Ga0439432_008638 3300042006 Bacteria 3574
362 Ga0439432_058708 3300042006 Bacteria 1189
363 Ga0439432_061222 3300042006 Bacteria 1160
364 Ga0439432_067791 3300042006 Bacteria 1091
365 Ga0439451_000777 3300042009 Bacteria 6068
366 Ga0439451_001521 3300042009 Bacteria 4586
367 Ga0439451_005945 3300042009 Bacteria 2493
368 Ga0439451_032790 3300042009 Bacteria 1044
369 Ga0439452_000530 3300042010 Bacteria 20404
370 Ga0439452_003840 3300042010 Bacteria 5159
371 Ga0439452_051112 3300042010 Bacteria 946
372 Ga0439456_003572 3300042013 Bacteria 3155
373 Ga0439456_008683 3300042013 Bacteria 2097
374 Ga0439456_008846 3300042013 Bacteria 2080
375 Ga0439456_013705 3300042013 Bacteria 1688
376 Ga0439463_005539 3300042016 Bacteria 3139
377 Ga0439463_014377 3300042016 Bacteria 1951
378 Ga0439463_030225 3300042016 Bacteria 1365
379 Ga0439463_098875 3300042016 Bacteria 752
380 Ga0450911_000394 3300042115 Bacteria 14425
381 Ga0450911_008569 3300042115 Bacteria 1452
382 Ga0450911_014078 3300042115 Bacteria 1066
383 Ga0450900_001734 3300042136 Bacteria 2194
384 Ga0450902_013760 3300042137 Bacteria 1304
385 Ga0450902_015032 3300042137 Bacteria 1254
386 Ga0450902_015424 3300042137 Bacteria 1239
387 Ga0450903_013304 3300042138 Bacteria 1309
388 Ga0450904_005957 3300042139 Bacteria 1223
389 Ga0450905_010235 3300042142 Bacteria 1296
390 Ga0450905_016590 3300042142 Bacteria 1063
391 Ga0450905_023307 3300042142 Bacteria 923
392 Ga0450906_000140 3300042145 Bacteria 13120
393 Ga0450907_001261 3300042146 Bacteria 5673
394 Ga0450907_033870 3300042146 Bacteria 870
395 Ga0439446_0001111 3300042156 Bacteria 5953
396 Ga0450909_001851 3300042185 Bacteria 2976
397 Ga0450909_007526 3300042185 Bacteria 1577
398 Ga0439434_0001029 3300042435 Bacteria 8072
399 Ga0439435_0019100 3300042436 Bacteria 1752
400 Ga0439460_0007980 3300042461 Bacteria 2664
401 Ga0439460_0338570 3300042461 Bacteria 529
402 Ga0450918_013240 3300042531 Bacteria 1435
403 Ga0450893_0028057 3300042532 Bacteria 994
404 Ga0450901_003932 3300042533 Bacteria 1540
405 Ga0439440_0003458 3300042993 Bacteria 3042
406 Ga0466969_0045482 3300044656 Bacteria 2179
407 Ga0466969_0154463 3300044656 Bacteria 1056
408 Ga0466965_0012519 3300044683 Bacteria 3991
409 Ga0466966_0028921 3300044684 Bacteria 3608
410 Ga0466961_0000467 3300044693 Bacteria 25598
411 Ga0466961_0093771 3300044693 Bacteria 1894
412 Ga0466961_0117619 3300044693 Unclassified 1670
413 Ga0466963_0097683 3300044694 Bacteria 2007
414 Ga0466963_0117680 3300044694 Bacteria 1827
415 Ga0466971_0291496 3300044719 Bacteria 782
416 Ga0466970_0658095 3300044765 Bacteria 609
417 Ga0466957_0148978 3300044842 Bacteria 1512
418 Ga0466959_0055078 3300045049 Bacteria 2904
419 Ga0466959_0385630 3300045049 Unclassified 953
420 Ga0466958_0180722 3300045836 Bacteria 1338
421 Ga0466967_0531768 3300045976 Bacteria 1156
422 Ga0466967_0687015 3300045976 Bacteria 1013
423 Ga0495617_003151 3300046452 Bacteria 6279
424 Ga0495617_037873 3300046452 Bacteria 1614
425 Ga0495617_129350 3300046452 Bacteria 810
426 Ga0495627_000084 3300046453 Bacteria 112950
427 Ga0495627_002251 3300046453 Bacteria 9551
428 Ga0495603_0492377 3300046455 Bacteria 702
429 Ga0495590_0055542 3300046457 Bacteria 1383
430 Ga0495590_0206280 3300046457 Bacteria 723
431 Ga0495591_026286 3300046458 Bacteria 1811
432 Ga0495591_032156 3300046458 Bacteria 1565
433 Ga0495591_037994 3300046458 Bacteria 1389
434 Ga0495638_0012479 3300046460 Bacteria 5821
435 Ga0495638_0035413 3300046460 Bacteria 3182
436 Ga0495638_0143926 3300046460 Bacteria 1388
437 Ga0495638_0221501 3300046460 Bacteria 1057
438 Ga0495638_0226256 3300046460 Bacteria 1043
439 Ga0495638_0330955 3300046460 Bacteria 810
440 Ga0495653_0000002 3300046463 Bacteria 507262
441 Ga0495650_0001827 3300046471 Bacteria 19067
442 Ga0495650_0045347 3300046471 Bacteria 1851
443 Ga0495650_0048377 3300046471 Bacteria 1772
444 Ga0495650_0194304 3300046471 Bacteria 708
445 Ga0495605_0012973 3300046474 Bacteria 4607
446 Ga0495605_0068505 3300046474 Bacteria 1681
447 Ga0495584_0001126 3300046491 Bacteria 16567
448 Ga0495584_0007670 3300046491 Bacteria 5619
449 Ga0495584_0011807 3300046491 Bacteria 4466
450 Ga0495584_0174600 3300046491 Bacteria 1092
451 Ga0495584_0198640 3300046491 Bacteria 1019
452 Ga0495584_0288602 3300046491 Bacteria 833
453 Ga0495585_0010752 3300046492 Bacteria 5437
454 Ga0495585_0049349 3300046492 Bacteria 2337
455 Ga0495585_0184055 3300046492 Bacteria 1073
456 Ga0495585_0231133 3300046492 Bacteria 929
457 Ga0495607_0006943 3300046501 Bacteria 7893
458 Ga0495607_0016609 3300046501 Bacteria 4748
459 Ga0495607_0038674 3300046501 Bacteria 2856
460 Ga0495607_0058021 3300046501 Bacteria 2215
461 Ga0495607_0070545 3300046501 Bacteria 1952
462 Ga0495607_0076441 3300046501 Bacteria 1852
463 Ga0495607_0135233 3300046501 Bacteria 1277
464 Ga0495607_0200079 3300046501 Bacteria 989
465 Ga0495607_0336958 3300046501 Bacteria 699
466 Ga0495583_0012627 3300046506 Bacteria 4764
467 Ga0495583_0079955 3300046506 Bacteria 1421
468 Ga0495606_0000030 3300046507 Bacteria 249484
469 Ga0495606_0044498 3300046507 Bacteria 2951
470 Ga0495606_0147132 3300046507 Bacteria 1386
471 Ga0495606_0263774 3300046507 Bacteria 949
472 Ga0495610_0046596 3300046512 Bacteria 2138
473 Ga0495610_0057847 3300046512 Bacteria 1857
474 Ga0495610_0140347 3300046512 Bacteria 1040
475 Ga0495610_0180453 3300046512 Bacteria 878
476 Ga0495610_0183170 3300046512 Bacteria 869
477 Ga0495616_0047259 3300046513 Bacteria 2168
478 Ga0495616_0075085 3300046513 Bacteria 1627
479 Ga0495620_0011042 3300046515 Bacteria 4730
480 Ga0495620_0037582 3300046515 Bacteria 2155
481 Ga0495630_0307968 3300046517 Bacteria 1210
482 Ga0495631_0219270 3300046518 Bacteria 812
483 Ga0495631_0349253 3300046518 Bacteria 629
484 Ga0495632_0000049 3300046519 Bacteria 134597
485 Ga0495632_0001609 3300046519 Bacteria 18580
486 Ga0495632_0003183 3300046519 Bacteria 11830
487 Ga0495632_0008656 3300046519 Bacteria 6214
488 Ga0495632_0021306 3300046519 Bacteria 3494
489 Ga0495632_0057376 3300046519 Bacteria 1900
490 Ga0495632_0096956 3300046519 Bacteria 1392
491 Ga0495632_0273459 3300046519 Bacteria 753
492 Ga0495632_0318396 3300046519 Bacteria 687
493 Ga0495637_0003277 3300046520 Bacteria 8615
494 Ga0495637_0004271 3300046520 Bacteria 7420
495 Ga0495637_0005172 3300046520 Bacteria 6683
496 Ga0495637_0022273 3300046520 Bacteria 2891
497 Ga0495637_0056987 3300046520 Bacteria 1615
498 Ga0495637_0075001 3300046520 Bacteria 1357
499 Ga0495637_0099281 3300046520 Bacteria 1139
500 Ga0495637_0110098 3300046520 Bacteria 1068
501 Ga0495643_0000047 3300046522 Bacteria 217914
502 Ga0495643_0020755 3300046522 Bacteria 3781
503 Ga0495643_0103929 3300046522 Bacteria 1452
504 Ga0495643_0114878 3300046522 Bacteria 1365
505 Ga0495643_0131869 3300046522 Bacteria 1254
506 Ga0495643_0263596 3300046522 Bacteria 799
507 Ga0495643_0329233 3300046522 Bacteria 689
508 Ga0495643_0383264 3300046522 Bacteria 623
509 Ga0495644_0001046 3300046523 Bacteria 11535
510 Ga0495648_0003342 3300046524 Bacteria 14150
511 Ga0495648_0035719 3300046524 Bacteria 3218
512 Ga0495648_0160862 3300046524 Bacteria 1161
513 Ga0495648_0229872 3300046524 Bacteria 909
514 Ga0495648_0241593 3300046524 Bacteria 877
515 Ga0495663_0000009 3300046525 Bacteria 256308
516 Ga0495642_0001171 3300046528 Bacteria 12049
517 Ga0495654_0026985 3300046530 Bacteria 2947
518 Ga0495654_0044804 3300046530 Bacteria 2185
519 Ga0495654_0088465 3300046530 Bacteria 1440
520 Ga0495654_0103363 3300046530 Bacteria 1308
521 Ga0495654_0201057 3300046530 Bacteria 852
522 Ga0495609_0000149 3300046538 Bacteria 72309
523 Ga0495609_0029481 3300046538 Bacteria 2498
524 Ga0495597_0005474 3300046542 Bacteria 6717
525 Ga0495597_0019740 3300046542 Bacteria 3148
526 Ga0495597_0044582 3300046542 Bacteria 1971
527 Ga0495597_0052307 3300046542 Bacteria 1798
528 Ga0495622_0141025 3300046557 Bacteria 1094
529 Ga0495633_0000402 3300046558 Bacteria 45246
530 Ga0495633_0000434 3300046558 Bacteria 43286
531 Ga0495633_0004035 3300046558 Bacteria 9497
532 Ga0495633_0004360 3300046558 Bacteria 9035
533 Ga0495656_0194998 3300046615 Bacteria 1002
534 Ga0495668_0042326 3300046616 Bacteria 2536
535 Ga0495611_0041298 3300046648 Bacteria 2057
536 Ga0495611_0186037 3300046648 Bacteria 970
537 Ga0495611_0423089 3300046648 Bacteria 608
538 Ga0495625_0108601 3300046660 Bacteria 1898
539 Ga0495625_0133767 3300046660 Bacteria 1678
540 Ga0495625_0159878 3300046660 Bacteria 1510
541 Ga0495625_0194017 3300046660 Bacteria 1344
542 Ga0495659_0001130 3300046664 Bacteria 9275
543 Ga0495659_0001680 3300046664 Bacteria 7418
544 Ga0495659_0056101 3300046664 Bacteria 1445
545 Ga0495661_0010223 3300046665 Bacteria 6412
546 Ga0495661_0041195 3300046665 Bacteria 2859
547 Ga0495661_0078637 3300046665 Bacteria 1907
548 Ga0495661_0248906 3300046665 Bacteria 908
549 Ga0495669_0000275 3300046684 Bacteria 29419
550 Ga0495670_0002606 3300046691 Bacteria 8907
551 Ga0495670_0024396 3300046691 Bacteria 2988
552 Ga0495670_0092817 3300046691 Bacteria 1546
553 Ga0495670_0295589 3300046691 Bacteria 867
554 Ga0495670_0785792 3300046691 Bacteria 519
555 Ga0495671_0000038 3300046692 Bacteria 173693
556 Ga0495671_0000260 3300046692 Bacteria 44754
557 Ga0495671_0026849 3300046692 Bacteria 2980
558 Ga0495671_0075028 3300046692 Bacteria 1659
559 Ga0495671_0076788 3300046692 Bacteria 1637
560 Ga0495671_0079974 3300046692 Bacteria 1601
561 Ga0495671_0195474 3300046692 Bacteria 981
562 Ga0495649_0023742 3300046694 Bacteria 3425
563 Ga0495649_0026244 3300046694 Bacteria 3241
564 Ga0495649_0138218 3300046694 Bacteria 1283
565 Ga0495649_0223118 3300046694 Bacteria 974
566 Ga0495649_0264858 3300046694 Bacteria 880
567 Ga0495589_0046821 3300046794 Bacteria 2145
568 Ga0495589_0076146 3300046794 Bacteria 1636
569 Ga0495589_0197770 3300046794 Bacteria 949
570 Ga0495660_0000049 3300046810 Bacteria 142727
571 Ga0495660_0000715 3300046810 Bacteria 25390
572 Ga0495660_0087100 3300046810 Bacteria 1629
573 Ga0495660_0098444 3300046810 Bacteria 1508
574 Ga0495660_0151269 3300046810 Bacteria 1145
575 Ga0495636_0075725 3300047318 Bacteria 1442
576 Ga0495672_0000184 3300047320 Bacteria 91103
577 Ga0495672_0014058 3300047320 Bacteria 5496
578 Ga0495672_0022104 3300047320 Bacteria 4139
579 Ga0495672_0033995 3300047320 Bacteria 3154
580 Ga0495672_0118564 3300047320 Bacteria 1410
581 Ga0495672_0119672 3300047320 Bacteria 1401
582 Ga0495680_0005487 3300047322 Bacteria 11923
583 Ga0495683_0084569 3300047323 Bacteria 1543
584 Ga0495687_037674 3300047443 Bacteria 2152
585 Ga0495687_120242 3300047443 Bacteria 949
586 Ga0495687_128256 3300047443 Bacteria 903
587 Ga0495677_0007520 3300047445 Bacteria 4067
588 Ga0495679_004730 3300047446 Bacteria 6181
589 Ga0495685_001865 3300047447 Bacteria 6511
590 Ga0495673_0015870 3300047469 Bacteria 3867
591 Ga0495673_0061895 3300047469 Bacteria 1600
592 Ga0495673_0066371 3300047469 Bacteria 1530
593 Ga0495673_0117662 3300047469 Bacteria 1055
594 Ga0495681_0002988 3300047470 Bacteria 11907
595 Ga0495681_0040661 3300047470 Bacteria 2262
596 Ga0495681_0041400 3300047470 Bacteria 2236
597 Ga0495681_0065823 3300047470 Bacteria 1655
598 Ga0495681_0110354 3300047470 Bacteria 1192
599 Ga0495686_0000624 3300047472 Bacteria 48658
600 Ga0495686_0008888 3300047472 Bacteria 7306
601 Ga0495686_0094687 3300047472 Bacteria 1809
602 Ga0495686_0098273 3300047472 Bacteria 1769
603 Ga0495686_0197160 3300047472 Bacteria 1157
604 Ga0495686_0312935 3300047472 Bacteria 863
605 Ga0495686_0379009 3300047472 Bacteria 763
606 Ga0495593_0191954 3300047673 Bacteria 1027
607 Ga0495615_0004325 3300048090 Bacteria 2472
608 Ga0495626_0002902 3300048091 Bacteria 11418
609 Ga0495626_0010145 3300048091 Bacteria 5053
610 Ga0495626_0155775 3300048091 Bacteria 960
611 Ga0495626_0421924 3300048091 Bacteria 514
612 Ga0496101_0319322 3300048904 Bacteria 1218
613 Ga0496102_0114691 3300048905 Bacteria 2514
614 Ga0496102_0174812 3300048905 Bacteria 2022
615 Ga0496107_0165459 3300048910 Bacteria 1640
616 Ga0496108_0065617 3300048911 Bacteria 3060
617 Ga0496109_0195701 3300048912 Bacteria 1900
618 Ga0496109_1147341 3300048912 Bacteria 714
619 Ga0496110_0088186 3300048913 Bacteria 2771
620 Ga0496110_0347135 3300048913 Bacteria 1352
621 Ga0496111_1020051 3300048914 Unclassified 592
622 Ga0496112_0130016 3300048915 Bacteria 2489
623 Ga0496112_0358674 3300048915 Bacteria 1400
624 Ga0496116_0044785 3300048919 Bacteria 3002
625 Ga0496117_0020723 3300048920 Bacteria 5350
626 Ga0496117_0080759 3300048920 Bacteria 2137
627 Ga0496117_0089952 3300048920 Bacteria 1980
628 Ga0496117_0142596 3300048920 Bacteria 1432
629 Ga0496118_0002611 3300048921 Bacteria 23930
630 Ga0496118_0026316 3300048921 Bacteria 4959
631 Ga0496118_0080846 3300048921 Bacteria 2285
632 Ga0496118_0196829 3300048921 Bacteria 1198
633 Ga0496118_0494061 3300048921 Bacteria 610
634 Ga0496121_0000005 3300048924 Bacteria 1034486
635 Ga0496121_0245350 3300048924 Bacteria 1245
636 Ga0496121_0276913 3300048924 Bacteria 1150
637 Ga0496121_0482982 3300048924 Bacteria 791
638 Ga0496121_0654822 3300048924 Bacteria 639
639 Ga0496122_0002889 3300048925 Bacteria 23500
640 Ga0496122_0049685 3300048925 Bacteria 3207
641 Ga0496122_0055864 3300048925 Bacteria 2949
642 Ga0496123_0085631 3300048926 Bacteria 1895
643 Ga0496123_0138664 3300048926 Bacteria 1334
644 Ga0496124_0000672 3300048927 Bacteria 56291
645 Ga0496124_0002578 3300048927 Bacteria 23487
646 Ga0496124_0053423 3300048927 Bacteria 3424
647 Ga0496124_0077797 3300048927 Bacteria 2735
648 Ga0496124_0128318 3300048927 Bacteria 2018
649 Ga0496124_0155165 3300048927 Bacteria 1791
650 Ga0496124_0310924 3300048927 Bacteria 1133
651 Ga0496124_0382424 3300048927 Bacteria 984
652 Ga0496125_0000159 3300048928 Bacteria 151205
653 Ga0496125_0001126 3300048928 Bacteria 40818
654 Ga0496125_0012345 3300048928 Bacteria 8488
655 Ga0496125_0019176 3300048928 Bacteria 6462
656 Ga0496126_0032169 3300048929 Bacteria 4945
657 Ga0496126_0037146 3300048929 Bacteria 4548
658 Ga0496126_0397206 3300048929 Bacteria 1119
659 Ga0495678_008089 3300049459 Bacteria 5357
660 Ga0495678_013524 3300049459 Bacteria 3829
661 Ga0495678_050725 3300049459 Bacteria 1607
662 Ga0495678_076574 3300049459 Bacteria 1211
663 Ga0495678_087635 3300049459 Bacteria 1103
664 Ga0495678_107749 3300049459 Bacteria 955
665 Ga0495682_0000589 3300049460 Bacteria 24714
666 Ga0495682_0048705 3300049460 Bacteria 1544
667 Ga0501300_056562 3300049523 Unclassified 614
668 Ga0501315_045870 3300049531 Bacteria 674
669 Ga0501033_0044625 3300049570 Bacteria 3300
670 Ga0501043_0049267 3300049579 Bacteria 3312
671 Ga0501043_0078395 3300049579 Bacteria 2596
672 Ga0501048_1002740 3300049582 Unclassified 601
673 Ga0501067_0039776 3300049583 Bacteria 2611
674 Ga0501067_0110703 3300049583 Bacteria 1527
675 Ga0501216_133387 3300049660 Unclassified 578
676 Ga0501227_023905 3300049665 Bacteria 1422
677 Ga0501235_034249 3300049669 Bacteria 1152
678 Ga0501240_004834 3300049673 Bacteria 1583
679 Ga0501252_008582 3300049682 Bacteria 1176
680 Ga0501221_172479 3300049704 Unclassified 586
681 Ga0501083_0088400 3300049744 Bacteria 2049
682 Ga0501241_035562 3300049758 Bacteria 953
683 Ga0501269_010422 3300049766 Bacteria 1131
684 Ga0501226_006893 3300049853 Bacteria 1279
685 nmdc:mga03683_199085_c1 3300050489 Bacteria 919
686 nmdc:mga03683_273524_c1 3300050489 Unclassified 788
687 nmdc:mga03683_35391_c1 3300050489 Bacteria 2026
688 nmdc:mga00v17_108894_c1 3300050491 Bacteria 1756
689 nmdc:mga00v17_40621_c1 3300050491 Bacteria 2791
690 nmdc:mga00v17_9237_c1 3300050491 Bacteria 5328
691 nmdc:mga0yw44_782711_c1 3300050492 Bacteria 648
692 nmdc:mga0yw44_96578_c1 3300050492 Bacteria 1876
693 nmdc:mga07m45_74270_c1 3300050496 Bacteria 1937
694 nmdc:mga0qj67_1474047_c1 3300050509 Unclassified 524
695 nmdc:mga08x19_171509_c1 3300050514 Bacteria 1478
696 nmdc:mga08x19_615911_c1 3300050514 Bacteria 769
697 nmdc:mga0sz30_34988_c1 3300050516 Bacteria 2094
698 nmdc:mga0sz30_49060_c2 3300050516 Bacteria 1195
699 Ga0500644_0284158 3300053088 Bacteria 705
700 Ga0500572_206079 3300053111 Bacteria 644
701 Ga0500594_0001502 3300053118 Bacteria 5077
702 Ga0500618_000070 3300053125 Bacteria 86080
703 Ga0500618_000344 3300053125 Bacteria 33227
704 Ga0500559_0042345 3300053136 Bacteria 1986
705 Ga0500559_0100952 3300053136 Bacteria 1330
706 Ga0500622_0402689 3300053156 Bacteria 555
707 Ga0500634_0021243 3300053161 Bacteria 3516
708 Ga0500645_184440 3300053730 Unclassified 567
709 Ga0587088_013908 3300059508 Bacteria 1244
710 2511175111 2510917026 Bacteria 7046020
711 2511181548 2510917028 Bacteria 6185411
712 2511280638 2511231008 Bacteria 6624100
713 2511312149 2511231014 Bacteria 6462302
714 2511318583 2511231015 Bacteria 6598026
715 2511332774 2511231017 Bacteria 6503007
716 2511345142 2511231019 Bacteria 6520662
717 2513868261 2513237138 Bacteria 7368160
718 2535518464 2534681796 Bacteria 7146037
719 2538427591 2537561728 Bacteria 5149301
720 2585827323 2585427591 Bacteria 5482980
721 2599482844 2599185185 Bacteria 6652270
722 2600026692 2599185316 Bacteria 6320029
723 2600029919 2599185317 Bacteria 6435722
724 2600080367 2599185325 Bacteria 6324919
725 2600197961 2599185352 Bacteria 7228948
726 2600359228 2600254930 Bacteria 6431253
727 2600365284 2600254931 Bacteria 6734225
728 2643809434 2643221557 Bacteria 7184309
729 2643840860 2643221565 Bacteria 6216018
730 2643955044 2643221589 Bacteria 6250934
731 2644024678 2643221602 Bacteria 6249926
732 2644049976 2643221607 Bacteria 6314006
733 2644107086 2643221618 Bacteria 7717186
734 2644147817 2643221626 Bacteria 8069654
735 2644189583 2643221633 Bacteria 6733554
736 2644203069 2643221636 Bacteria 6583769
737 2644311391 2643221655 Bacteria 7722067
738 2644335100 2643221659 Bacteria 7890716
739 2644482891 2643221686 Bacteria 6310811
740 2644497834 2643221689 Bacteria 6042950
741 2644543961 2643221698 Bacteria 7756764
742 2644617066 2643221712 Bacteria 7729434
743 2644674737 2643221723 Bacteria 7095460
744 2652543648 2651869719 Bacteria 6047974
745 2715749087 2713897148 Bacteria 5883533
746 2738738963 2738541280 Bacteria 6630198
747 2738945128 2738541317 Bacteria 5340176
748 2739260436 2738543015 Bacteria 6750701
749 2739792922 2739367756 Bacteria 4553612
750 2753360758 2751185800 Bacteria 5467370
751 2758638173 2758568016 Bacteria 5645291
752 2765581760 2765235841 Bacteria 6137024
753 2774119684 2773857670 Bacteria 6407454
754 2784316243 2784132072 Bacteria 6596533
755 2792310953 2791355010 Bacteria 4864581
756 2808931276 2808606377 Bacteria 6646337
757 2808953234 2808606381 Bacteria 6646461
758 2808989952 2808606387 Bacteria 5697198
759 2809217859 2808606445 Bacteria 6057339
760 2821131055 2821123053 Bacteria 7836056
761 2838719462 2838714209 Bacteria 5525906
762 2838724825 2838719591 Bacteria 5523910
763 2841851312 2841846520 Bacteria 5345850
764 2842129287 2842124991 Bacteria 5346824
765 2842175707 2842170452 Bacteria 5525737
766 2842192551 2842187318 Bacteria 5524014
767 2842229600 2842224351 Bacteria 5524473
768 2842834042 2842832357 Bacteria 5959113
769 2842859430 2842854478 Bacteria 6143501
770 2844164369 2844163670 Bacteria 7266046
771 2849564278 2849560528 Bacteria 5393480
772 2849575483 2849573788 Bacteria 5421256
773 2851155020 2851153111 Bacteria 5542585
774 2854915391 2854911287 Bacteria 5582813
775 2857544905 2857542790 Bacteria 5326616
776 2858469123 2858466076 Bacteria 4722413
777 2884960624 2884960567 Bacteria 5437054
778 2898334132 2898329390 Bacteria 5168154
779 2913309754 2913308742 Bacteria 5350706
780 2919104783 2919100787 Bacteria 7710546
781 2919119617 2919114240 Bacteria 5700270
782 2919389901 2919385768 Bacteria 5897293
783 2920828011 2920822456 Bacteria 6897201
784 2926759764 2926754445 Bacteria 5964435
785 2929142876 2929138655 Bacteria 5810547
786 2978969890 2978969890 Bacteria 5400756
787 2979095450 2979089926 Bacteria 5670289
788 2979097703 2979095461 Bacteria 5669583
789 2984287549 2984286254 Bacteria 6702062
790 2988732074 2988728565 Bacteria 6124362
791 2998140335 2998139840 Bacteria 6073514
792 3007857212 3007855910 Bacteria 5637581
793 3007864458 3007861166 Bacteria 6045338
794 3007875201 3007872151 Bacteria 5268868
795 641334028 641228493 Bacteria 3999591
796 643391163 643348555 Bacteria 3914947
797 8005258790 8005258706 Bacteria 6184835
798 8005549383 8005542996 Bacteria 7077758
799 8030000400 8029995093 Bacteria 5990776
800 8046768015 8046767195 Bacteria 7547379
801 8054930224 8054929484 Bacteria 5599761
802 8055434813 8055431914 Bacteria 4551896
803 8056116880 8056115690 Bacteria 5527654
804 8056143604 8056143049 Bacteria 6307666
805 8056158392 8056155041 Bacteria 6486948
806 8056170708 8056166840 Bacteria 5820959
807 8056572199 8056569372 Bacteria 5997322
808 Ga0070673_100859380
809 RicEn_C7519
810 MRS2a_Contig_11594
811 SwRhRL2b_contig_30749
812 SwRhRL2b_contig_519226
813 JGI25162J39368_1001056
814 JGI25158J39367_1002355
815 JGI25163J39215_1003290
816 JGI25164J39214_1000563
817 JGI25159J45721_1000083
818 JGI25159J45721_1000466
819 JGI25151J46595_10036444
820 JGI25165J46597_1001123
821 rootH1_10044342
822 rootH1_10130566
823 rootH2_10081916
824 rootH1_10328791
825 JGI25160J50197_1000005
826 JGI25161J50226_1000349
827 Ga0006562J51391_1008015
828 Ga0055526_1002592
829 Ga0055524_1033754
830 Ga0055536_1004642
831 Ga0055536_1016156
832 Ga0055536_1016300
833 Ga0055530_10008853
834 Ga0055530_10012947
835 Ga0055530_10032239
836 Ga0055540_1012563
837 Ga0055540_1068700
838 Ga0055531_10001364
839 Ga0055531_10004249
840 Ga0055531_10073595
841 Ga0058692_1015795
842 Ga0058692_1018212
843 Ga0055543_1000324
844 Ga0065165_1000002
845 Ga0065165_1000264
846 Ga0065714_10009236
847 Ga0065714_10020005
848 Ga0065714_10112802
849 Ga0065714_10233113
850 Ga0065714_10308760
851 Ga0065714_10316355
852 Ga0065704_10085495
853 Ga0065704_10098219
854 Ga0065704_10148567
855 Ga0065704_10357297
856 Ga0065712_10079004
857 Ga0065715_10887876
858 Ga0070676_11025332
859 Ga0070660_100047978
860 Ga0070660_100734940
861 Ga0070669_100168990
862 Ga0070671_100042696
863 Ga0070659_100095774
864 Ga0070667_100726123
865 Ga0070709_10929164
866 Ga0070713_101026596
867 Ga0070710_11375397
868 Ga0070662_100203815
869 Ga0070665_100293480
870 Ga0070665_100473519
871 Ga0068855_100788564
872 Ga0070664_101156832
873 Ga0068854_100649812
874 Ga0068854_101751431
875 Ga0068856_101674170
876 Ga0068864_100000218
877 Ga0068864_100211383
878 Ga0068866_10484335
879 Ga0068861_100166465
880 Ga0068851_10947323
881 Ga0068858_100000352
882 Ga0068858_100001656
883 Ga0068862_101091742
884 Ga0081455_10404061
885 Ga0075365_10011682
886 Ga0075365_10017919
887 Ga0075365_10831908
888 Ga0075364_10010433
889 Ga0075364_10104148
890 Ga0075364_10110610
891 Ga0075432_10055925
892 Ga0075432_10096218
893 Ga0075432_10113606
894 Ga0075432_10278232
895 Ga0075432_10602777
896 Ga0075362_10056386
897 Ga0075362_10444025
898 Ga0075369_10004738
899 Ga0075369_10143099
900 Ga0097621_100903195
901 Ga0075370_10065222
902 Ga0068871_100789896
903 Ga0075430_100468458
904 Ga0075436_100110011
905 Ga0075436_100343702
906 Ga0079104_1000104
907 Ga0079104_1001328
908 Ga0079104_1073514
909 Ga0099826_10004152
910 Ga0105251_10000466
911 Ga0105251_10034510
912 Ga0105251_10157004
913 Ga0105251_10372385
914 Ga0105251_10519238
915 Ga0105244_10027860
916 Ga0105244_10028008
917 Ga0105244_10147147
918 Ga0105244_10156728
919 Ga0105244_10170343
920 Ga0105244_10180080
921 Ga0105250_10034265
922 Ga0105250_10035115
923 Ga0105250_10060380
924 Ga0105250_10132132
925 Ga0105250_10210668
926 Ga0105250_10227803
927 Ga0105250_10303352
928 Ga0105240_10549366
929 Ga0105245_10001436
930 Ga0105243_10049280
931 Ga0105243_10096200
932 Ga0105243_10736276
933 Ga0105242_11572672
934 Ga0105248_10007725
935 Ga0105238_11554376
936 Ga0105249_10157648
937 Ga0157345_1000879
938 Ga0157373_10000160
939 Ga0157373_10009880
940 Ga0157373_10875215
941 Ga0157373_11159517
942 Ga0157371_10071919
943 Ga0157371_10175867
944 Ga0157371_10257754
945 Ga0157370_10086690
946 Ga0157370_10386681
947 Ga0157370_10630297
948 Ga0157369_10039023
949 Ga0157378_10059990
950 Ga0163162_10015191
951 Ga0163162_10156336
952 Ga0163162_10183183
953 Ga0163162_10299871
954 Ga0163162_10386341
955 Ga0157375_10175495
956 Ga0157375_11178675
957 Ga0157375_11300329
958 Ga0157375_12375899
959 Ga0182008_10007709
960 Ga0182008_10013620
961 Ga0182008_10027370
962 Ga0182008_10068729
963 Ga0182008_10117058
964 Ga0182008_10195381
965 Ga0157379_10724279
966 Ga0157376_11382100
967 Ga0182006_1012939
968 Ga0182006_1096870
969 Ga0182007_10003173
970 Ga0182007_10053020
971 Ga0182007_10137833
972 Ga0182005_1046895
973 Ga0182005_1052573
974 Ga0182005_1052661
975 Ga0182005_1120672
976 Ga0182005_1193945
977 Ga0163161_10120991
978 Ga0163161_10161158
979 Ga0163161_10228308
980 Ga0163161_10410367
981 Ga0163161_11295858
982 Ga0213872_10000747
983 Ga0213872_10003934
984 Ga0213872_10030473
985 Ga0213872_10032524
986 Ga0213872_10163047
987 Ga0213872_10317277
988 Ga0213875_10012055
989 Ga0209760_100140
990 Ga0209436_100162
991 Ga0209147_103422
992 Ga0207427_100016
993 Ga0209437_100011
994 Ga0209759_1001860
995 Ga0209233_1000019
996 Ga0209565_1010830
997 Ga0209130_1000010
998 Ga0209676_1000308
999 Ga0209676_1000320
1000 Ga0209676_1004904
1001 Ga0209676_1058390
1002 Ga0209025_1000687
1003 Ga0209025_1012644
1004 Ga0209564_1000025
1005 Ga0209758_1046347
1006 Ga0209050_1000466
1007 Ga0209050_1000911
1008 Ga0209050_1011196
1009 Ga0209050_1016963
1010 Ga0209256_1002250
1011 Ga0209256_1059132
1012 Ga0207426_1000036
1013 Ga0209051_1001718
1014 Ga0209051_1023299
1015 Ga0209257_1000338
1016 Ga0209257_1005664
1017 Ga0209257_1006123
1018 Ga0207656_10675497
1019 Ga0207696_1000065
1020 Ga0207696_1024123
1021 Ga0207696_1053180
1022 Ga0207696_1121838
1023 Ga0207655_1001270
1024 Ga0207655_1053490
1025 Ga0207655_1058326
1026 Ga0207713_1000269
1027 Ga0207713_1031081
1028 Ga0207713_1059262
1029 Ga0207713_1096087
1030 Ga0207682_10139640
1031 Ga0207699_10713177
1032 Ga0207671_10031074
1033 Ga0207693_10152945
1034 Ga0207657_10237338
1035 Ga0207681_10129611
1036 Ga0207687_10006357
1037 Ga0207644_11244799
1038 Ga0207690_10184943
1039 Ga0207706_10113871
1040 Ga0207709_10138897
1041 Ga0207709_11136771
1042 Ga0207711_10012751
1043 Ga0207679_11101425
1044 Ga0207667_10164706
1045 Ga0207651_10860459
1046 Ga0207712_10075390
1047 Ga0207658_10662785
1048 Ga0207703_10001551
1049 Ga0207703_10001574
1050 Ga0207703_10727604
1051 Ga0207676_10000169
1052 Ga0207676_10016717
1053 Ga0207675_100088146
1054 Ga0207683_10150499
1055 Ga0209281_1000026
1056 Ga0209281_1000717
1057 Ga0209281_1004352
1058 Ga0209371_1015214
1059 Ga0209282_1008607
1060 Ga0207428_10049800
1061 Ga0207428_10092593
1062 Ga0207428_10231474
1063 Ga0207428_10506715
1064 Ga0268266_10204833
1065 Ga0268266_10723832
1066 Ga0307517_10281107
1067 Ga0307515_10024017
1068 Ga0316177_1190406
1069 Ga0316179_1092971
1070 Ga0316178_1122809
1071 Ga0316183_1049590
1072 Ga0316181_1086264
1073 Ga0265332_10053652
1074 Ga0265320_10003123
1075 Ga0307513_10906385
1076 Ga0307408_100191072
1077 Ga0307408_100231849
1078 Ga0307408_100233888
1079 Ga0265313_10024553
1080 Ga0307508_10019520
1081 Ga0265314_10016259
1082 Ga0307405_10018767
1083 Ga0307405_10613597
1084 Ga0307405_10816243
1085 Ga0307405_11148512
1086 Ga0307413_10038575
1087 Ga0307410_10427034
1088 Ga0307406_10149843
1089 Ga0307406_10940704
1090 Ga0307407_10559516
1091 Ga0307407_10587893
1092 Ga0307407_11380459
1093 Ga0307412_10005974
1094 Ga0307412_10130162
1095 Ga0307412_10756137
1096 Ga0307409_101213218
1097 Ga0307409_101524136
1098 Ga0307409_101802802
1099 Ga0307416_100138423
1100 Ga0307416_100347869
1101 Ga0307416_101227973
1102 Ga0307414_10011896
1103 Ga0307414_10084898
1104 Ga0307414_10161278
1105 Ga0307414_10163398
1106 Ga0307414_10402729
1107 Ga0307414_10701448
1108 Ga0307414_11078803
1109 Ga0307411_10116667
1110 Ga0307411_11153981
1111 Ga0307415_100927767
1112 Ga0307415_100968663
1113 Ga0316574_0171125
1114 Ga0373933_0456734
1115 Ga0395899_0001089
1116 Ga0395899_0335206
1117 Ga0395899_0798720
1118 Ga0395900_0000108
1119 Ga0395900_0007617
1120 Ga0395900_0222737
1121 Ga0395900_0670367
1122 Ga0395898_0009141
1123 Ga0395898_0060019
1124 Ga0395898_0185182
1125 Ga0395905_0026339
1126 Ga0395905_0077250
1127 Ga0395905_1411360
1128 Ga0395905_1701214
1129 Ga0436364_0051522
1130 Ga0436364_0061348
1131 Ga0436364_0524095
1132 Ga0395901_0000023
1133 Ga0395901_0000050
1134 Ga0395901_0000183
1135 Ga0395901_0003967
1136 Ga0395901_0237761
1137 Ga0395901_0473364
1138 Ga0436365_0118027
1139 Ga0436361_0060925
1140 Ga0436361_0422046
1141 Ga0436361_0513574
1142 Ga0436361_0576973
1143 Ga0436361_0821550
1144 Ga0436361_1057455
1145 Ga0436361_1103751
1146 Ga0436363_0398739
1147 Ga0436363_0741000
1148 Ga0436362_0250573
1149 Ga0439438_000385
1150 Ga0439438_001237
1151 Ga0439438_002736
1152 Ga0439438_009887
1153 Ga0439438_017263
1154 Ga0439438_046412
1155 Ga0439438_064997
1156 Ga0439447_019572
1157 Ga0439447_032890
1158 Ga0439447_037780
1159 Ga0439466_0003407
1160 Ga0439466_0004719
1161 Ga0439466_0014078
1162 Ga0439466_0079893
1163 Ga0439445_0044591
1164 Ga0439445_0048139
1165 Ga0439445_0210972
1166 Ga0439432_000116
1167 Ga0439432_002197
1168 Ga0439432_008638
1169 Ga0439432_058708
1170 Ga0439432_061222
1171 Ga0439432_067791
1172 Ga0439451_000777
1173 Ga0439451_001521
1174 Ga0439451_005945
1175 Ga0439451_032790
1176 Ga0439452_000530
1177 Ga0439452_003840
1178 Ga0439452_051112
1179 Ga0439456_003572
1180 Ga0439456_008683
1181 Ga0439456_008846
1182 Ga0439456_013705
1183 Ga0439463_005539
1184 Ga0439463_014377
1185 Ga0439463_030225
1186 Ga0439463_098875
1187 Ga0450911_000394
1188 Ga0450911_008569
1189 Ga0450911_014078
1190 Ga0450900_001734
1191 Ga0450902_013760
1192 Ga0450902_015032
1193 Ga0450902_015424
1194 Ga0450903_013304
1195 Ga0450904_005957
1196 Ga0450905_010235
1197 Ga0450905_016590
1198 Ga0450905_023307
1199 Ga0450906_000140
1200 Ga0450907_001261
1201 Ga0450907_033870
1202 Ga0439446_0001111
1203 Ga0450909_001851
1204 Ga0450909_007526
1205 Ga0439434_0001029
1206 Ga0439435_0019100
1207 Ga0439460_0007980
1208 Ga0439460_0338570
1209 Ga0450918_013240
1210 Ga0450893_0028057
1211 Ga0450901_003932
1212 Ga0439440_0003458
1213 Ga0466969_0045482
1214 Ga0466969_0154463
1215 Ga0466965_0012519
1216 Ga0466966_0028921
1217 Ga0466961_0000467
1218 Ga0466961_0093771
1219 Ga0466961_0117619
1220 Ga0466963_0097683
1221 Ga0466963_0117680
1222 Ga0466971_0291496
1223 Ga0466970_0658095
1224 Ga0466957_0148978
1225 Ga0466959_0055078
1226 Ga0466959_0385630
1227 Ga0466958_0180722
1228 Ga0466967_0531768
1229 Ga0466967_0687015
1230 Ga0495617_003151
1231 Ga0495617_037873
1232 Ga0495617_129350
1233 Ga0495627_000084
1234 Ga0495627_002251
1235 Ga0495603_0492377
1236 Ga0495590_0055542
1237 Ga0495590_0206280
1238 Ga0495591_026286
1239 Ga0495591_032156
1240 Ga0495591_037994
1241 Ga0495638_0012479
1242 Ga0495638_0035413
1243 Ga0495638_0143926
1244 Ga0495638_0221501
1245 Ga0495638_0226256
1246 Ga0495638_0330955
1247 Ga0495653_0000002
1248 Ga0495650_0001827
1249 Ga0495650_0045347
1250 Ga0495650_0048377
1251 Ga0495650_0194304
1252 Ga0495605_0012973
1253 Ga0495605_0068505
1254 Ga0495584_0001126
1255 Ga0495584_0007670
1256 Ga0495584_0011807
1257 Ga0495584_0174600
1258 Ga0495584_0198640
1259 Ga0495584_0288602
1260 Ga0495585_0010752
1261 Ga0495585_0049349
1262 Ga0495585_0184055
1263 Ga0495585_0231133
1264 Ga0495607_0006943
1265 Ga0495607_0016609
1266 Ga0495607_0038674
1267 Ga0495607_0058021
1268 Ga0495607_0070545
1269 Ga0495607_0076441
1270 Ga0495607_0135233
1271 Ga0495607_0200079
1272 Ga0495607_0336958
1273 Ga0495583_0012627
1274 Ga0495583_0079955
1275 Ga0495606_0000030
1276 Ga0495606_0044498
1277 Ga0495606_0147132
1278 Ga0495606_0263774
1279 Ga0495610_0046596
1280 Ga0495610_0057847
1281 Ga0495610_0140347
1282 Ga0495610_0180453
1283 Ga0495610_0183170
1284 Ga0495616_0047259
1285 Ga0495616_0075085
1286 Ga0495620_0011042
1287 Ga0495620_0037582
1288 Ga0495630_0307968
1289 Ga0495631_0219270
1290 Ga0495631_0349253
1291 Ga0495632_0000049
1292 Ga0495632_0001609
1293 Ga0495632_0003183
1294 Ga0495632_0008656
1295 Ga0495632_0021306
1296 Ga0495632_0057376
1297 Ga0495632_0096956
1298 Ga0495632_0273459
1299 Ga0495632_0318396
1300 Ga0495637_0003277
1301 Ga0495637_0004271
1302 Ga0495637_0005172
1303 Ga0495637_0022273
1304 Ga0495637_0056987
1305 Ga0495637_0075001
1306 Ga0495637_0099281
1307 Ga0495637_0110098
1308 Ga0495643_0000047
1309 Ga0495643_0020755
1310 Ga0495643_0103929
1311 Ga0495643_0114878
1312 Ga0495643_0131869
1313 Ga0495643_0263596
1314 Ga0495643_0329233
1315 Ga0495643_0383264
1316 Ga0495644_0001046
1317 Ga0495648_0003342
1318 Ga0495648_0035719
1319 Ga0495648_0160862
1320 Ga0495648_0229872
1321 Ga0495648_0241593
1322 Ga0495663_0000009
1323 Ga0495642_0001171
1324 Ga0495654_0026985
1325 Ga0495654_0044804
1326 Ga0495654_0088465
1327 Ga0495654_0103363
1328 Ga0495654_0201057
1329 Ga0495609_0000149
1330 Ga0495609_0029481
1331 Ga0495597_0005474
1332 Ga0495597_0019740
1333 Ga0495597_0044582
1334 Ga0495597_0052307
1335 Ga0495622_0141025
1336 Ga0495633_0000402
1337 Ga0495633_0000434
1338 Ga0495633_0004035
1339 Ga0495633_0004360
1340 Ga0495656_0194998
1341 Ga0495668_0042326
1342 Ga0495611_0041298
1343 Ga0495611_0186037
1344 Ga0495611_0423089
1345 Ga0495625_0108601
1346 Ga0495625_0133767
1347 Ga0495625_0159878
1348 Ga0495625_0194017
1349 Ga0495659_0001130
1350 Ga0495659_0001680
1351 Ga0495659_0056101
1352 Ga0495661_0010223
1353 Ga0495661_0041195
1354 Ga0495661_0078637
1355 Ga0495661_0248906
1356 Ga0495669_0000275
1357 Ga0495670_0002606
1358 Ga0495670_0024396
1359 Ga0495670_0092817
1360 Ga0495670_0295589
1361 Ga0495670_0785792
1362 Ga0495671_0000038
1363 Ga0495671_0000260
1364 Ga0495671_0026849
1365 Ga0495671_0075028
1366 Ga0495671_0076788
1367 Ga0495671_0079974
1368 Ga0495671_0195474
1369 Ga0495649_0023742
1370 Ga0495649_0026244
1371 Ga0495649_0138218
1372 Ga0495649_0223118
1373 Ga0495649_0264858
1374 Ga0495589_0046821
1375 Ga0495589_0076146
1376 Ga0495589_0197770
1377 Ga0495660_0000049
1378 Ga0495660_0000715
1379 Ga0495660_0087100
1380 Ga0495660_0098444
1381 Ga0495660_0151269
1382 Ga0495636_0075725
1383 Ga0495672_0000184
1384 Ga0495672_0014058
1385 Ga0495672_0022104
1386 Ga0495672_0033995
1387 Ga0495672_0118564
1388 Ga0495672_0119672
1389 Ga0495680_0005487
1390 Ga0495683_0084569
1391 Ga0495687_037674
1392 Ga0495687_120242
1393 Ga0495687_128256
1394 Ga0495677_0007520
1395 Ga0495679_004730
1396 Ga0495685_001865
1397 Ga0495673_0015870
1398 Ga0495673_0061895
1399 Ga0495673_0066371
1400 Ga0495673_0117662
1401 Ga0495681_0002988
1402 Ga0495681_0040661
1403 Ga0495681_0041400
1404 Ga0495681_0065823
1405 Ga0495681_0110354
1406 Ga0495686_0000624
1407 Ga0495686_0008888
1408 Ga0495686_0094687
1409 Ga0495686_0098273
1410 Ga0495686_0197160
1411 Ga0495686_0312935
1412 Ga0495686_0379009
1413 Ga0495593_0191954
1414 Ga0495615_0004325
1415 Ga0495626_0002902
1416 Ga0495626_0010145
1417 Ga0495626_0155775
1418 Ga0495626_0421924
1419 Ga0496101_0319322
1420 Ga0496102_0114691
1421 Ga0496102_0174812
1422 Ga0496107_0165459
1423 Ga0496108_0065617
1424 Ga0496109_0195701
1425 Ga0496109_1147341
1426 Ga0496110_0088186
1427 Ga0496110_0347135
1428 Ga0496111_1020051
1429 Ga0496112_0130016
1430 Ga0496112_0358674
1431 Ga0496116_0044785
1432 Ga0496117_0020723
1433 Ga0496117_0080759
1434 Ga0496117_0089952
1435 Ga0496117_0142596
1436 Ga0496118_0002611
1437 Ga0496118_0026316
1438 Ga0496118_0080846
1439 Ga0496118_0196829
1440 Ga0496118_0494061
1441 Ga0496121_0000005
1442 Ga0496121_0245350
1443 Ga0496121_0276913
1444 Ga0496121_0482982
1445 Ga0496121_0654822
1446 Ga0496122_0002889
1447 Ga0496122_0049685
1448 Ga0496122_0055864
1449 Ga0496123_0085631
1450 Ga0496123_0138664
1451 Ga0496124_0000672
1452 Ga0496124_0002578
1453 Ga0496124_0053423
1454 Ga0496124_0077797
1455 Ga0496124_0128318
1456 Ga0496124_0155165
1457 Ga0496124_0310924
1458 Ga0496124_0382424
1459 Ga0496125_0000159
1460 Ga0496125_0001126
1461 Ga0496125_0012345
1462 Ga0496125_0019176
1463 Ga0496126_0032169
1464 Ga0496126_0037146
1465 Ga0496126_0397206
1466 Ga0495678_008089
1467 Ga0495678_013524
1468 Ga0495678_050725
1469 Ga0495678_076574
1470 Ga0495678_087635
1471 Ga0495678_107749
1472 Ga0495682_0000589
1473 Ga0495682_0048705
1474 Ga0501300_056562
1475 Ga0501315_045870
1476 Ga0501033_0044625
1477 Ga0501043_0049267
1478 Ga0501043_0078395
1479 Ga0501048_1002740
1480 Ga0501067_0039776
1481 Ga0501067_0110703
1482 Ga0501216_133387
1483 Ga0501227_023905
1484 Ga0501235_034249
1485 Ga0501240_004834
1486 Ga0501252_008582
1487 Ga0501221_172479
1488 Ga0501083_0088400
1489 Ga0501241_035562
1490 Ga0501269_010422
1491 Ga0501226_006893
1492 nmdc:mga03683_199085_c1
1493 nmdc:mga03683_273524_c1
1494 nmdc:mga03683_35391_c1
1495 nmdc:mga00v17_108894_c1
1496 nmdc:mga00v17_40621_c1
1497 nmdc:mga00v17_9237_c1
1498 nmdc:mga0yw44_782711_c1
1499 nmdc:mga0yw44_96578_c1
1500 nmdc:mga07m45_74270_c1
1501 nmdc:mga0qj67_1474047_c1
1502 nmdc:mga08x19_171509_c1
1503 nmdc:mga08x19_615911_c1
1504 nmdc:mga0sz30_34988_c1
1505 nmdc:mga0sz30_49060_c2
1506 Ga0500644_0284158
1507 Ga0500572_206079
1508 Ga0500594_0001502
1509 Ga0500618_000070
1510 Ga0500618_000344
1511 Ga0500559_0042345
1512 Ga0500559_0100952
1513 Ga0500622_0402689
1514 Ga0500634_0021243
1515 Ga0500645_184440
1516 Ga0587088_013908
1517 2511175111
1518 2511181548
1519 2511280638
1520 2511312149
1521 2511318583
1522 2511332774
1523 2511345142
1524 2513868261
1525 2535518464
1526 2538427591
1527 2585827323
1528 2599482844
1529 2600026692
1530 2600029919
1531 2600080367
1532 2600197961
1533 2600359228
1534 2600365284
1535 2643809434
1536 2643840860
1537 2643955044
1538 2644024678
1539 2644049976
1540 2644107086
1541 2644147817
1542 2644189583
1543 2644203069
1544 2644311391
1545 2644335100
1546 2644482891
1547 2644497834
1548 2644543961
1549 2644617066
1550 2644674737
1551 2652543648
1552 2715749087
1553 2738738963
1554 2738945128
1555 2739260436
1556 2739792922
1557 2753360758
1558 2758638173
1559 2765581760
1560 2774119684
1561 2784316243
1562 2792310953
1563 2808931276
1564 2808953234
1565 2808989952
1566 2809217859
1567 2821131055
1568 2838719462
1569 2838724825
1570 2841851312
1571 2842129287
1572 2842175707
1573 2842192551
1574 2842229600
1575 2842834042
1576 2842859430
1577 2844164369
1578 2849564278
1579 2849575483
1580 2851155020
1581 2854915391
1582 2857544905
1583 2858469123
1584 2884960624
1585 2898334132
1586 2913309754
1587 2919104783
1588 2919119617
1589 2919389901
1590 2920828011
1591 2926759764
1592 2929142876
1593 2978969890
1594 2979095450
1595 2979097703
1596 2984287549
1597 2988732074
1598 2998140335
1599 3007857212
1600 3007864458
1601 3007875201
1602 641334028
1603 643391163
1604 8005258790
1605 8005549383
1606 8030000400
1607 8046768015
1608 8054930224
1609 8055434813
1610 8056116880
1611 8056143604
1612 8056158392
1613 8056170708
1614 8056572199

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

4

126

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.9951 1 132
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9899 2 132
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.9867 1 132
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9751 2 132
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9709 1 132
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9709 1 132 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9635 2 132 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9632 1 132 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9494 2 132 3.40.50.1010
6nklA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9123 2 131 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A3B0Y3S4-F1-model_v4 VapC toxin protein 0.9968 1 116 GO:0004518
GO:0046872
AF-A0A1I4GVS0-F1-model_v4 tRNA(fMet)-specific endonuclease VapC 0.9927 33 129 GO:0004519
GO:0046872
AF-A0A7Z8QV22-F1-model_v4 PIN domain-containing protein 0.9919 33 132 GO:0004518
GO:0046872
AF-A0A7Y9FNL6-F1-model_v4 tRNA(fMet)-specific endonuclease VapC (EC 3.1.-.-) 0.9891 40 131 GO:0004519
GO:0046872
AF-A0A7W6DCM2-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9881 21 131 GO:0000287
GO:0004540
GO:0090729

Map