F481689
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 807 | 354 | 1614 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300046463|Ga0495653_0075841|Ga0495653_0075841_418_936 |
| Length | 172 |
| Sequence | MLFSTKAEYGVRLMVELGRQPSSGPVSLSAVAEAERLPLSYLEHLVARLRKAGLVTSTRGAHGGYCLAKPAEEITMDAVVEALEGQISPMECFHETPEGKVLCSHESDGDHACSTKLLWTRVQGGVTKALAGTTLAELVEFSSPEGRREAAAVGRLPDLELNRKQNGRSEIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 203 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 204 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 205 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 206 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 207 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 350 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 351 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.21 |
| Nodule | 0 |
| Rhizoplane | 8.92 |
| Rhizosphere | 82.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495653_0075841 | 3300046463 | Bacteria | 2501 |
| 2 | JGI24746J21847_1000063 | 3300001977 | Bacteria | 11032 |
| 3 | JGI24740J21852_10003503 | 3300001979 | Bacteria | 6878 |
| 4 | JGI24034J26672_10001204 | 3300002239 | Bacteria | 3388 |
| 5 | JGI24751J29686_10040041 | 3300002459 | Bacteria | 970 |
| 6 | JGI25406J46586_10079445 | 3300003203 | Bacteria | 1009 |
| 7 | JGI25404J52841_10015867 | 3300003659 | Bacteria | 1634 |
| 8 | Ga0070658_10561537 | 3300005327 | Bacteria | 988 |
| 9 | Ga0070683_100011615 | 3300005329 | Bacteria | 7621 |
| 10 | Ga0070683_100031765 | 3300005329 | Bacteria | 4805 |
| 11 | Ga0070683_100192357 | 3300005329 | Bacteria | 1937 |
| 12 | Ga0070683_100365743 | 3300005329 | Bacteria | 1374 |
| 13 | Ga0070683_100440370 | 3300005329 | Bacteria | 1243 |
| 14 | Ga0070670_100100171 | 3300005331 | Bacteria | 2494 |
| 15 | Ga0070677_10001179 | 3300005333 | Bacteria | 8379 |
| 16 | Ga0070666_10005134 | 3300005335 | Bacteria | 8017 |
| 17 | Ga0070666_10018876 | 3300005335 | Bacteria | 4442 |
| 18 | Ga0070680_100270119 | 3300005336 | Bacteria | 1440 |
| 19 | Ga0070680_100894434 | 3300005336 | Bacteria | 766 |
| 20 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 21 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 22 | Ga0070682_100145503 | 3300005337 | Bacteria | 1620 |
| 23 | Ga0070682_100561615 | 3300005337 | Bacteria | 895 |
| 24 | Ga0068868_100000104 | 3300005338 | Bacteria | 52249 |
| 25 | Ga0068868_100008318 | 3300005338 | Bacteria | 7426 |
| 26 | Ga0070689_100167007 | 3300005340 | Bacteria | 1782 |
| 27 | Ga0070689_100367531 | 3300005340 | Bacteria | 1210 |
| 28 | Ga0070689_101190632 | 3300005340 | Bacteria | 684 |
| 29 | Ga0070691_10018604 | 3300005341 | Bacteria | 3203 |
| 30 | Ga0070691_10079856 | 3300005341 | Bacteria | 1599 |
| 31 | Ga0070687_100304074 | 3300005343 | Bacteria | 1013 |
| 32 | Ga0070661_100000110 | 3300005344 | Bacteria | 68106 |
| 33 | Ga0070692_10133729 | 3300005345 | Bacteria | 1397 |
| 34 | Ga0070668_100018993 | 3300005347 | Bacteria | 5165 |
| 35 | Ga0070668_100541165 | 3300005347 | Bacteria | 1012 |
| 36 | Ga0070675_100000091 | 3300005354 | Bacteria | 52149 |
| 37 | Ga0070674_100000019 | 3300005356 | Bacteria | 89350 |
| 38 | Ga0070674_100000030 | 3300005356 | Bacteria | 69481 |
| 39 | Ga0070674_100068087 | 3300005356 | Bacteria | 2507 |
| 40 | Ga0070673_100016927 | 3300005364 | Bacteria | 5170 |
| 41 | Ga0070673_101602761 | 3300005364 | Bacteria | 615 |
| 42 | Ga0070688_100000077 | 3300005365 | Bacteria | 48743 |
| 43 | Ga0070688_100000937 | 3300005365 | Bacteria | 14631 |
| 44 | Ga0070659_100219493 | 3300005366 | Bacteria | 1569 |
| 45 | Ga0070667_100000597 | 3300005367 | Bacteria | 35219 |
| 46 | Ga0070667_100061279 | 3300005367 | Bacteria | 3185 |
| 47 | Ga0070667_100183456 | 3300005367 | Bacteria | 1851 |
| 48 | Ga0070714_100016382 | 3300005435 | Bacteria | 5983 |
| 49 | Ga0070714_101538777 | 3300005435 | Bacteria | 650 |
| 50 | Ga0070713_100000135 | 3300005436 | Bacteria | 48487 |
| 51 | Ga0070713_101132661 | 3300005436 | Bacteria | 757 |
| 52 | Ga0070701_10706001 | 3300005438 | Bacteria | 679 |
| 53 | Ga0070711_100402416 | 3300005439 | Bacteria | 1111 |
| 54 | Ga0070700_100642768 | 3300005441 | Bacteria | 837 |
| 55 | Ga0070663_100002413 | 3300005455 | Bacteria | 10511 |
| 56 | Ga0070663_100160259 | 3300005455 | Bacteria | 1731 |
| 57 | Ga0070663_100493462 | 3300005455 | Bacteria | 1016 |
| 58 | Ga0070663_101630720 | 3300005455 | Bacteria | 576 |
| 59 | Ga0070678_100016978 | 3300005456 | Bacteria | 4673 |
| 60 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 61 | Ga0070681_10130354 | 3300005458 | Bacteria | 2447 |
| 62 | Ga0070681_10853037 | 3300005458 | Bacteria | 829 |
| 63 | Ga0068867_100001975 | 3300005459 | Bacteria | 14301 |
| 64 | Ga0070685_10000061 | 3300005466 | Bacteria | 63408 |
| 65 | Ga0070685_10000965 | 3300005466 | Bacteria | 15453 |
| 66 | Ga0070685_10249296 | 3300005466 | Bacteria | 1175 |
| 67 | Ga0070685_10663912 | 3300005466 | Bacteria | 757 |
| 68 | Ga0070706_100704758 | 3300005467 | Unclassified | 936 |
| 69 | Ga0070679_100000088 | 3300005530 | Bacteria | 69314 |
| 70 | Ga0070679_100014779 | 3300005530 | Bacteria | 7502 |
| 71 | Ga0070684_100043101 | 3300005535 | Bacteria | 3896 |
| 72 | Ga0070684_100166554 | 3300005535 | Bacteria | 2001 |
| 73 | Ga0070684_100951324 | 3300005535 | Unclassified | 805 |
| 74 | Ga0068853_100045796 | 3300005539 | Bacteria | 3748 |
| 75 | Ga0068853_100370084 | 3300005539 | Bacteria | 1337 |
| 76 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 77 | Ga0070686_100177806 | 3300005544 | Bacteria | 1510 |
| 78 | Ga0070695_100552488 | 3300005545 | Bacteria | 898 |
| 79 | Ga0070693_100005314 | 3300005547 | Bacteria | 6173 |
| 80 | Ga0070693_100882773 | 3300005547 | Bacteria | 669 |
| 81 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 82 | Ga0070665_100170243 | 3300005548 | Bacteria | 2179 |
| 83 | Ga0070665_100282978 | 3300005548 | Bacteria | 1660 |
| 84 | Ga0070665_100369737 | 3300005548 | Bacteria | 1441 |
| 85 | Ga0070665_101456766 | 3300005548 | Bacteria | 693 |
| 86 | Ga0070704_100288739 | 3300005549 | Bacteria | 1362 |
| 87 | Ga0068855_100485303 | 3300005563 | Bacteria | 1345 |
| 88 | Ga0070664_100118646 | 3300005564 | Bacteria | 2314 |
| 89 | Ga0068854_100001193 | 3300005578 | Bacteria | 15575 |
| 90 | Ga0068854_100121310 | 3300005578 | Bacteria | 1985 |
| 91 | Ga0068856_100005135 | 3300005614 | Bacteria | 12924 |
| 92 | Ga0068856_100017905 | 3300005614 | Bacteria | 6870 |
| 93 | Ga0068856_100130001 | 3300005614 | Bacteria | 2523 |
| 94 | Ga0068856_100231969 | 3300005614 | Bacteria | 1861 |
| 95 | Ga0070702_100572749 | 3300005615 | Bacteria | 842 |
| 96 | Ga0068852_100000037 | 3300005616 | Bacteria | 97602 |
| 97 | Ga0068852_100899962 | 3300005616 | Bacteria | 902 |
| 98 | Ga0068859_100554284 | 3300005617 | Bacteria | 1244 |
| 99 | Ga0068859_101021985 | 3300005617 | Bacteria | 908 |
| 100 | Ga0068864_100000043 | 3300005618 | Bacteria | 162928 |
| 101 | Ga0068866_10000005 | 3300005718 | Bacteria | 196339 |
| 102 | Ga0068866_10000645 | 3300005718 | Bacteria | 15809 |
| 103 | Ga0068866_10040199 | 3300005718 | Bacteria | 2314 |
| 104 | Ga0068861_100216257 | 3300005719 | Bacteria | 1617 |
| 105 | Ga0068851_10000741 | 3300005834 | Bacteria | 13966 |
| 106 | Ga0068851_10045443 | 3300005834 | Bacteria | 2220 |
| 107 | Ga0068863_100000761 | 3300005841 | Bacteria | 32288 |
| 108 | Ga0068863_100786095 | 3300005841 | Bacteria | 949 |
| 109 | Ga0068863_101000478 | 3300005841 | Bacteria | 839 |
| 110 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 111 | Ga0068858_100001657 | 3300005842 | Bacteria | 22764 |
| 112 | Ga0068858_100344114 | 3300005842 | Bacteria | 1428 |
| 113 | Ga0068858_100576201 | 3300005842 | Bacteria | 1091 |
| 114 | Ga0068860_100020604 | 3300005843 | Bacteria | 6388 |
| 115 | Ga0068860_100048144 | 3300005843 | Bacteria | 4063 |
| 116 | Ga0068862_100000366 | 3300005844 | Bacteria | 49032 |
| 117 | Ga0081455_10019072 | 3300005937 | Bacteria | 6503 |
| 118 | Ga0081455_10021413 | 3300005937 | Bacteria | 6064 |
| 119 | Ga0081455_10022734 | 3300005937 | Bacteria | 5851 |
| 120 | Ga0081455_10052328 | 3300005937 | Bacteria | 3497 |
| 121 | Ga0081455_10085453 | 3300005937 | Bacteria | 2573 |
| 122 | Ga0081538_10000279 | 3300005981 | Bacteria | 58452 |
| 123 | Ga0081538_10008303 | 3300005981 | Bacteria | 8841 |
| 124 | Ga0081538_10068073 | 3300005981 | Bacteria | 1982 |
| 125 | Ga0081538_10133347 | 3300005981 | Bacteria | 1162 |
| 126 | Ga0081540_1000994 | 3300005983 | Bacteria | 25500 |
| 127 | Ga0081540_1002630 | 3300005983 | Bacteria | 14596 |
| 128 | Ga0081540_1049696 | 3300005983 | Bacteria | 2090 |
| 129 | Ga0081540_1077734 | 3300005983 | Bacteria | 1507 |
| 130 | Ga0081539_10002753 | 3300005985 | Bacteria | 23665 |
| 131 | Ga0081539_10223030 | 3300005985 | Bacteria | 856 |
| 132 | Ga0075365_10150839 | 3300006038 | Bacteria | 1617 |
| 133 | Ga0075365_10311150 | 3300006038 | Bacteria | 1109 |
| 134 | Ga0075365_10465353 | 3300006038 | Bacteria | 893 |
| 135 | Ga0075363_100077964 | 3300006048 | Unclassified | 1808 |
| 136 | Ga0075363_100229633 | 3300006048 | Bacteria | 1065 |
| 137 | Ga0075363_100254041 | 3300006048 | Unclassified | 1013 |
| 138 | Ga0075363_100285119 | 3300006048 | Bacteria | 956 |
| 139 | Ga0075363_100506818 | 3300006048 | Bacteria | 717 |
| 140 | Ga0075364_10052053 | 3300006051 | Bacteria | 2675 |
| 141 | Ga0075364_10098504 | 3300006051 | Bacteria | 1945 |
| 142 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 143 | Ga0075367_10014716 | 3300006178 | Bacteria | 4237 |
| 144 | Ga0075367_10495668 | 3300006178 | Bacteria | 775 |
| 145 | Ga0097621_100348354 | 3300006237 | Bacteria | 1317 |
| 146 | Ga0075370_10461226 | 3300006353 | Bacteria | 765 |
| 147 | Ga0068871_100280695 | 3300006358 | Bacteria | 1457 |
| 148 | Ga0068871_100748934 | 3300006358 | Bacteria | 898 |
| 149 | Ga0075430_100019225 | 3300006846 | Bacteria | 5808 |
| 150 | Ga0075430_100028465 | 3300006846 | Bacteria | 4748 |
| 151 | Ga0075431_100019004 | 3300006847 | Bacteria | 7002 |
| 152 | Ga0075433_10002844 | 3300006852 | Bacteria | 13254 |
| 153 | Ga0075433_10003268 | 3300006852 | Bacteria | 12514 |
| 154 | Ga0075434_101855833 | 3300006871 | Bacteria | 609 |
| 155 | Ga0075429_101070141 | 3300006880 | Bacteria | 705 |
| 156 | Ga0068865_100000089 | 3300006881 | Bacteria | 47955 |
| 157 | Ga0068865_100248902 | 3300006881 | Bacteria | 1402 |
| 158 | Ga0097620_100554329 | 3300006931 | Bacteria | 1244 |
| 159 | Ga0097620_101022036 | 3300006931 | Bacteria | 908 |
| 160 | Ga0105240_10370785 | 3300009093 | Bacteria | 1619 |
| 161 | Ga0105240_10391637 | 3300009093 | Bacteria | 1567 |
| 162 | Ga0111539_10380430 | 3300009094 | Bacteria | 1644 |
| 163 | Ga0111539_12414790 | 3300009094 | Unclassified | 610 |
| 164 | Ga0111539_12560859 | 3300009094 | Bacteria | 592 |
| 165 | Ga0105245_10001641 | 3300009098 | Bacteria | 20352 |
| 166 | Ga0105245_10001806 | 3300009098 | Bacteria | 19490 |
| 167 | Ga0105245_10002937 | 3300009098 | Bacteria | 15306 |
| 168 | Ga0105245_10444841 | 3300009098 | Bacteria | 1303 |
| 169 | Ga0105245_10493084 | 3300009098 | Bacteria | 1240 |
| 170 | Ga0105245_10660449 | 3300009098 | Bacteria | 1076 |
| 171 | Ga0105245_10717322 | 3300009098 | Bacteria | 1034 |
| 172 | Ga0105245_11187958 | 3300009098 | Bacteria | 811 |
| 173 | Ga0105247_10000148 | 3300009101 | Bacteria | 68936 |
| 174 | Ga0105247_10102660 | 3300009101 | Bacteria | 1830 |
| 175 | Ga0105247_10244616 | 3300009101 | Bacteria | 1224 |
| 176 | Ga0105247_10255241 | 3300009101 | Bacteria | 1200 |
| 177 | Ga0105243_10014402 | 3300009148 | Bacteria | 5987 |
| 178 | Ga0105243_10415157 | 3300009148 | Bacteria | 1253 |
| 179 | Ga0105243_10461872 | 3300009148 | Bacteria | 1194 |
| 180 | Ga0105243_11392845 | 3300009148 | Unclassified | 721 |
| 181 | Ga0105241_10064199 | 3300009174 | Bacteria | 2834 |
| 182 | Ga0105242_10000052 | 3300009176 | Bacteria | 79244 |
| 183 | Ga0105242_10127169 | 3300009176 | Bacteria | 2195 |
| 184 | Ga0105242_12753087 | 3300009176 | Unclassified | 542 |
| 185 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 186 | Ga0105248_10625591 | 3300009177 | Bacteria | 1214 |
| 187 | Ga0105248_10788899 | 3300009177 | Bacteria | 1072 |
| 188 | Ga0105237_10291929 | 3300009545 | Bacteria | 1633 |
| 189 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 190 | Ga0105238_10719819 | 3300009551 | Bacteria | 1011 |
| 191 | Ga0105249_10000331 | 3300009553 | Bacteria | 47860 |
| 192 | Ga0105249_10001411 | 3300009553 | Bacteria | 21021 |
| 193 | Ga0105249_10131733 | 3300009553 | Bacteria | 2388 |
| 194 | Ga0105249_10355377 | 3300009553 | Bacteria | 1485 |
| 195 | Ga0105249_10494563 | 3300009553 | Bacteria | 1267 |
| 196 | Ga0105239_10119724 | 3300010375 | Bacteria | 2922 |
| 197 | Ga0105239_10230456 | 3300010375 | Bacteria | 2078 |
| 198 | Ga0105239_10416869 | 3300010375 | Bacteria | 1521 |
| 199 | Ga0105239_10485955 | 3300010375 | Bacteria | 1403 |
| 200 | Ga0105246_10132936 | 3300011119 | Bacteria | 1861 |
| 201 | Ga0157371_10039820 | 3300013102 | Bacteria | 3360 |
| 202 | Ga0157370_10038083 | 3300013104 | Bacteria | 4655 |
| 203 | Ga0157370_11130078 | 3300013104 | Bacteria | 708 |
| 204 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 205 | Ga0157374_10003750 | 3300013296 | Bacteria | 12770 |
| 206 | Ga0157374_10380572 | 3300013296 | Bacteria | 1406 |
| 207 | Ga0157378_10014664 | 3300013297 | Bacteria | 6863 |
| 208 | Ga0157378_10134805 | 3300013297 | Bacteria | 2289 |
| 209 | Ga0163162_10122193 | 3300013306 | Bacteria | 2709 |
| 210 | Ga0163162_10788476 | 3300013306 | Bacteria | 1068 |
| 211 | Ga0163162_10842929 | 3300013306 | Bacteria | 1032 |
| 212 | Ga0163162_11500526 | 3300013306 | Bacteria | 768 |
| 213 | Ga0157372_10011019 | 3300013307 | Bacteria | 9623 |
| 214 | Ga0157372_12066595 | 3300013307 | Unclassified | 655 |
| 215 | Ga0157375_10000717 | 3300013308 | Bacteria | 29235 |
| 216 | Ga0157375_10005849 | 3300013308 | Bacteria | 10704 |
| 217 | Ga0157375_10312228 | 3300013308 | Bacteria | 1736 |
| 218 | Ga0157375_10348654 | 3300013308 | Bacteria | 1646 |
| 219 | Ga0157375_10532221 | 3300013308 | Bacteria | 1338 |
| 220 | Ga0163163_10133149 | 3300014325 | Bacteria | 2526 |
| 221 | Ga0163163_10381539 | 3300014325 | Bacteria | 1467 |
| 222 | Ga0163163_10574443 | 3300014325 | Bacteria | 1190 |
| 223 | Ga0163163_10976597 | 3300014325 | Bacteria | 910 |
| 224 | Ga0163163_11072545 | 3300014325 | Bacteria | 869 |
| 225 | Ga0163163_11807583 | 3300014325 | Bacteria | 671 |
| 226 | Ga0157380_10001737 | 3300014326 | Bacteria | 14372 |
| 227 | Ga0157380_10002174 | 3300014326 | Bacteria | 13164 |
| 228 | Ga0157380_10722493 | 3300014326 | Bacteria | 1004 |
| 229 | Ga0157379_10006275 | 3300014968 | Bacteria | 10238 |
| 230 | Ga0157379_10042444 | 3300014968 | Bacteria | 4060 |
| 231 | Ga0157379_10077380 | 3300014968 | Bacteria | 2979 |
| 232 | Ga0157379_10138803 | 3300014968 | Bacteria | 2191 |
| 233 | Ga0157376_10010190 | 3300014969 | Bacteria | 6865 |
| 234 | Ga0157376_11654243 | 3300014969 | Bacteria | 675 |
| 235 | Ga0163161_10000064 | 3300017792 | Bacteria | 108508 |
| 236 | Ga0163161_10293350 | 3300017792 | Bacteria | 1279 |
| 237 | Ga0163161_10418428 | 3300017792 | Bacteria | 1078 |
| 238 | Ga0206356_10694035 | 3300020070 | Bacteria | 615 |
| 239 | Ga0154015_1686715 | 3300020610 | Bacteria | 1197 |
| 240 | Ga0207672_1005954 | 3300025223 | Unclassified | 699 |
| 241 | Ga0207656_10003732 | 3300025321 | Bacteria | 5271 |
| 242 | Ga0207656_10013531 | 3300025321 | Bacteria | 3122 |
| 243 | Ga0207682_10000799 | 3300025893 | Bacteria | 14533 |
| 244 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 245 | Ga0207642_10000854 | 3300025899 | Bacteria | 9485 |
| 246 | Ga0207642_10023091 | 3300025899 | Bacteria | 2479 |
| 247 | Ga0207710_10000336 | 3300025900 | Bacteria | 35206 |
| 248 | Ga0207710_10137289 | 3300025900 | Bacteria | 1178 |
| 249 | Ga0207710_10255809 | 3300025900 | Bacteria | 876 |
| 250 | Ga0207680_10020951 | 3300025903 | Bacteria | 3530 |
| 251 | Ga0207680_10035678 | 3300025903 | Bacteria | 2857 |
| 252 | Ga0207647_10278193 | 3300025904 | Bacteria | 956 |
| 253 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 254 | Ga0207684_10446306 | 3300025910 | Bacteria | 1111 |
| 255 | Ga0207654_10074141 | 3300025911 | Bacteria | 2030 |
| 256 | Ga0207707_10010959 | 3300025912 | Bacteria | 7885 |
| 257 | Ga0207707_10176229 | 3300025912 | Bacteria | 1868 |
| 258 | Ga0207695_10306591 | 3300025913 | Bacteria | 1478 |
| 259 | Ga0207695_10379008 | 3300025913 | Bacteria | 1300 |
| 260 | Ga0207693_10001233 | 3300025915 | Bacteria | 22785 |
| 261 | Ga0207660_10416083 | 3300025917 | Bacteria | 1084 |
| 262 | Ga0207662_10198248 | 3300025918 | Bacteria | 1298 |
| 263 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 264 | Ga0207652_10000286 | 3300025921 | Bacteria | 52725 |
| 265 | Ga0207652_10010480 | 3300025921 | Bacteria | 7460 |
| 266 | Ga0207681_10188746 | 3300025923 | Bacteria | 1575 |
| 267 | Ga0207681_10810447 | 3300025923 | Bacteria | 782 |
| 268 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 269 | Ga0207650_10070934 | 3300025925 | Bacteria | 2620 |
| 270 | Ga0207659_10000147 | 3300025926 | Bacteria | 41347 |
| 271 | Ga0207687_10000040 | 3300025927 | Bacteria | 113598 |
| 272 | Ga0207687_10000105 | 3300025927 | Bacteria | 61343 |
| 273 | Ga0207687_10001806 | 3300025927 | Bacteria | 14723 |
| 274 | Ga0207687_10504596 | 3300025927 | Bacteria | 1010 |
| 275 | Ga0207687_10551492 | 3300025927 | Bacteria | 967 |
| 276 | Ga0207687_10875157 | 3300025927 | Bacteria | 768 |
| 277 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 278 | Ga0207664_10159989 | 3300025929 | Bacteria | 1920 |
| 279 | Ga0207664_11063832 | 3300025929 | Bacteria | 724 |
| 280 | Ga0207644_10038025 | 3300025931 | Bacteria | 3388 |
| 281 | Ga0207644_10389915 | 3300025931 | Bacteria | 1137 |
| 282 | Ga0207690_10160986 | 3300025932 | Bacteria | 1673 |
| 283 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 284 | Ga0207686_10000119 | 3300025934 | Bacteria | 64297 |
| 285 | Ga0207709_10001985 | 3300025935 | Bacteria | 13342 |
| 286 | Ga0207709_10269087 | 3300025935 | Bacteria | 1253 |
| 287 | Ga0207709_10519813 | 3300025935 | Bacteria | 931 |
| 288 | Ga0207670_10049250 | 3300025936 | Bacteria | 2817 |
| 289 | Ga0207670_10135646 | 3300025936 | Bacteria | 1809 |
| 290 | Ga0207669_10000029 | 3300025937 | Bacteria | 88351 |
| 291 | Ga0207669_10000140 | 3300025937 | Bacteria | 34667 |
| 292 | Ga0207669_10226863 | 3300025937 | Bacteria | 1375 |
| 293 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 294 | Ga0207704_11825032 | 3300025938 | Unclassified | 523 |
| 295 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 296 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 297 | Ga0207711_10596050 | 3300025941 | Bacteria | 1031 |
| 298 | Ga0207661_10007629 | 3300025944 | Bacteria | 7694 |
| 299 | Ga0207661_10015648 | 3300025944 | Bacteria | 5588 |
| 300 | Ga0207661_10019816 | 3300025944 | Bacteria | 5019 |
| 301 | Ga0207661_10053877 | 3300025944 | Bacteria | 3221 |
| 302 | Ga0207661_10093192 | 3300025944 | Bacteria | 2513 |
| 303 | Ga0207679_10019679 | 3300025945 | Bacteria | 4541 |
| 304 | Ga0207667_10085816 | 3300025949 | Bacteria | 3258 |
| 305 | Ga0207651_10002542 | 3300025960 | Bacteria | 8713 |
| 306 | Ga0207651_11199120 | 3300025960 | Bacteria | 681 |
| 307 | Ga0207712_10000032 | 3300025961 | Bacteria | 210628 |
| 308 | Ga0207712_10022892 | 3300025961 | Bacteria | 4118 |
| 309 | Ga0207712_10130419 | 3300025961 | Bacteria | 1915 |
| 310 | Ga0207712_10837356 | 3300025961 | Bacteria | 810 |
| 311 | Ga0207668_10019909 | 3300025972 | Bacteria | 4253 |
| 312 | Ga0207668_10329212 | 3300025972 | Bacteria | 1270 |
| 313 | Ga0207640_10023521 | 3300025981 | Bacteria | 3703 |
| 314 | Ga0207640_10050126 | 3300025981 | Bacteria | 2707 |
| 315 | Ga0207658_10000465 | 3300025986 | Bacteria | 37863 |
| 316 | Ga0207658_10128175 | 3300025986 | Bacteria | 2034 |
| 317 | Ga0207658_10478357 | 3300025986 | Bacteria | 1106 |
| 318 | Ga0207677_10004907 | 3300026023 | Bacteria | 7221 |
| 319 | Ga0207677_10019802 | 3300026023 | Bacteria | 4072 |
| 320 | Ga0207677_10718857 | 3300026023 | Bacteria | 888 |
| 321 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 322 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 323 | Ga0207703_10314861 | 3300026035 | Bacteria | 1431 |
| 324 | Ga0207639_10065976 | 3300026041 | Bacteria | 2811 |
| 325 | Ga0207678_10208008 | 3300026067 | Bacteria | 1674 |
| 326 | Ga0207678_10475134 | 3300026067 | Bacteria | 1088 |
| 327 | Ga0207678_10823248 | 3300026067 | Bacteria | 820 |
| 328 | Ga0207708_10146443 | 3300026075 | Bacteria | 1856 |
| 329 | Ga0207708_10914166 | 3300026075 | Bacteria | 760 |
| 330 | Ga0207708_11595524 | 3300026075 | Bacteria | 573 |
| 331 | Ga0207702_10000690 | 3300026078 | Bacteria | 36486 |
| 332 | Ga0207702_10009194 | 3300026078 | Bacteria | 8308 |
| 333 | Ga0207702_10013026 | 3300026078 | Bacteria | 6916 |
| 334 | Ga0207702_11803884 | 3300026078 | Unclassified | 604 |
| 335 | Ga0207641_10001193 | 3300026088 | Bacteria | 26064 |
| 336 | Ga0207641_10001906 | 3300026088 | Bacteria | 20029 |
| 337 | Ga0207641_10372784 | 3300026088 | Bacteria | 1365 |
| 338 | Ga0207648_10008953 | 3300026089 | Bacteria | 9628 |
| 339 | Ga0207676_10000042 | 3300026095 | Bacteria | 163475 |
| 340 | Ga0207674_10084363 | 3300026116 | Bacteria | 3175 |
| 341 | Ga0207675_100176938 | 3300026118 | Bacteria | 2041 |
| 342 | Ga0207675_100615370 | 3300026118 | Bacteria | 1090 |
| 343 | Ga0207675_101291602 | 3300026118 | Bacteria | 750 |
| 344 | Ga0207683_10018394 | 3300026121 | Bacteria | 5962 |
| 345 | Ga0207683_10562157 | 3300026121 | Bacteria | 1055 |
| 346 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 347 | Ga0207698_10123198 | 3300026142 | Bacteria | 2199 |
| 348 | Ga0209813_10051989 | 3300027866 | Bacteria | 1283 |
| 349 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 350 | Ga0268266_10000485 | 3300028379 | Bacteria | 57051 |
| 351 | Ga0268266_10023699 | 3300028379 | Bacteria | 5224 |
| 352 | Ga0268266_10263640 | 3300028379 | Bacteria | 1597 |
| 353 | Ga0268266_10266381 | 3300028379 | Bacteria | 1589 |
| 354 | Ga0268266_10705621 | 3300028379 | Bacteria | 972 |
| 355 | Ga0268265_10001048 | 3300028380 | Bacteria | 24851 |
| 356 | Ga0268264_10000725 | 3300028381 | Bacteria | 37821 |
| 357 | Ga0268264_10467006 | 3300028381 | Bacteria | 1225 |
| 358 | Ga0268264_10924361 | 3300028381 | Bacteria | 876 |
| 359 | Ga0265337_1000061 | 3300028556 | Bacteria | 49480 |
| 360 | Ga0265326_10000067 | 3300028558 | Bacteria | 59507 |
| 361 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 362 | Ga0265319_1072955 | 3300028563 | Bacteria | 1098 |
| 363 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 364 | Ga0265322_10147680 | 3300028654 | Bacteria | 672 |
| 365 | Ga0265336_10013428 | 3300028666 | Bacteria | 2731 |
| 366 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 367 | Ga0265338_10135291 | 3300028800 | Bacteria | 1939 |
| 368 | Ga0265324_10000510 | 3300029957 | Bacteria | 26678 |
| 369 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 370 | Ga0265329_10004168 | 3300031242 | Bacteria | 6095 |
| 371 | Ga0265340_10176445 | 3300031247 | Bacteria | 967 |
| 372 | Ga0265339_10100330 | 3300031249 | Bacteria | 1507 |
| 373 | Ga0265331_10012002 | 3300031250 | Bacteria | 4718 |
| 374 | Ga0265331_10223414 | 3300031250 | Bacteria | 846 |
| 375 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 376 | Ga0265314_10000208 | 3300031711 | Bacteria | 86855 |
| 377 | Ga0265342_10068433 | 3300031712 | Bacteria | 2075 |
| 378 | Ga0316576_10578517 | 3300031727 | Unclassified | 821 |
| 379 | Ga0307416_102370189 | 3300032002 | Bacteria | 631 |
| 380 | Ga0307414_10056032 | 3300032004 | Bacteria | 2763 |
| 381 | Ga0307415_100007274 | 3300032126 | Bacteria | 6046 |
| 382 | Ga0373952_0219959 | 3300035092 | Unclassified | 564 |
| 383 | Ga0373953_0112095 | 3300035117 | Bacteria | 1154 |
| 384 | Ga0373957_0067938 | 3300035120 | Bacteria | 1390 |
| 385 | Ga0373955_0140108 | 3300035172 | Bacteria | 1418 |
| 386 | Ga0316574_0016220 | 3300035398 | Bacteria | 4337 |
| 387 | Ga0373937_0001667 | 3300036401 | Bacteria | 18672 |
| 388 | Ga0373937_0128760 | 3300036401 | Bacteria | 2363 |
| 389 | Ga0373937_1294158 | 3300036401 | Bacteria | 677 |
| 390 | Ga0316584_0028222 | 3300036712 | Bacteria | 4136 |
| 391 | Ga0395899_0468773 | 3300037312 | Bacteria | 822 |
| 392 | Ga0395900_0111379 | 3300037418 | Bacteria | 2812 |
| 393 | Ga0395900_0427642 | 3300037418 | Bacteria | 1284 |
| 394 | Ga0395900_0938445 | 3300037418 | Bacteria | 787 |
| 395 | Ga0395898_0093219 | 3300037466 | Bacteria | 2895 |
| 396 | Ga0395898_0668303 | 3300037466 | Bacteria | 981 |
| 397 | Ga0395898_0903357 | 3300037466 | Bacteria | 821 |
| 398 | Ga0395898_1107309 | 3300037466 | Bacteria | 725 |
| 399 | Ga0395905_0133939 | 3300037471 | Bacteria | 2331 |
| 400 | Ga0395905_0623207 | 3300037471 | Bacteria | 981 |
| 401 | Ga0395905_1315366 | 3300037471 | Bacteria | 627 |
| 402 | Ga0395901_0247715 | 3300038443 | Bacteria | 1857 |
| 403 | Ga0395901_1242601 | 3300038443 | Unclassified | 709 |
| 404 | Ga0395901_1748225 | 3300038443 | Bacteria | 572 |
| 405 | Ga0436365_0260549 | 3300039437 | Bacteria | 1404 |
| 406 | Ga0451833_1155571 | 3300041491 | Bacteria | 1251 |
| 407 | Ga0451835_1131163 | 3300041492 | Bacteria | 829 |
| 408 | Ga0451837_0395850 | 3300041494 | Unclassified | 631 |
| 409 | Ga0451837_1762875 | 3300041494 | Bacteria | 603 |
| 410 | Ga0451839_0099500 | 3300041496 | Bacteria | 667 |
| 411 | Ga0451843_1072820 | 3300041509 | Unclassified | 573 |
| 412 | Ga0451853_1692226 | 3300041512 | Bacteria | 545 |
| 413 | Ga0451853_2939721 | 3300041512 | Bacteria | 5855 |
| 414 | Ga0466963_0000012 | 3300044694 | Bacteria | 62839 |
| 415 | Ga0466963_0027043 | 3300044694 | Bacteria | 3671 |
| 416 | Ga0466957_0278065 | 3300044842 | Bacteria | 1120 |
| 417 | Ga0466957_0874469 | 3300044842 | Bacteria | 641 |
| 418 | Ga0466960_0664726 | 3300044901 | Bacteria | 623 |
| 419 | Ga0466958_0040450 | 3300045836 | Bacteria | 2802 |
| 420 | Ga0466967_0000012 | 3300045976 | Bacteria | 104270 |
| 421 | Ga0466967_0171823 | 3300045976 | Bacteria | 2040 |
| 422 | Ga0495592_0000176 | 3300046454 | Bacteria | 56403 |
| 423 | Ga0495592_0316566 | 3300046454 | Bacteria | 1009 |
| 424 | Ga0495603_0000194 | 3300046455 | Bacteria | 31819 |
| 425 | Ga0495603_0001410 | 3300046455 | Bacteria | 13984 |
| 426 | Ga0495603_0013396 | 3300046455 | Bacteria | 4962 |
| 427 | Ga0495629_0003392 | 3300046459 | Bacteria | 12051 |
| 428 | Ga0495629_0011904 | 3300046459 | Bacteria | 6308 |
| 429 | Ga0495629_0044313 | 3300046459 | Bacteria | 3122 |
| 430 | Ga0495629_0062302 | 3300046459 | Bacteria | 2606 |
| 431 | Ga0495629_0296397 | 3300046459 | Bacteria | 1108 |
| 432 | Ga0495638_0016134 | 3300046460 | Bacteria | 5006 |
| 433 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 434 | Ga0495641_0006093 | 3300046461 | Bacteria | 7915 |
| 435 | Ga0495641_0016127 | 3300046461 | Bacteria | 3946 |
| 436 | Ga0495641_0024432 | 3300046461 | Bacteria | 2983 |
| 437 | Ga0495641_0046814 | 3300046461 | Bacteria | 1988 |
| 438 | Ga0495651_0022610 | 3300046462 | Bacteria | 4888 |
| 439 | Ga0495651_0154592 | 3300046462 | Bacteria | 1650 |
| 440 | Ga0495651_0496846 | 3300046462 | Bacteria | 781 |
| 441 | Ga0495653_0129657 | 3300046463 | Bacteria | 1787 |
| 442 | Ga0495582_0000002 | 3300046473 | Bacteria | 219909 |
| 443 | Ga0495639_0115584 | 3300046475 | Bacteria | 1276 |
| 444 | Ga0495662_0000051 | 3300046476 | Bacteria | 40340 |
| 445 | Ga0495662_0012354 | 3300046476 | Bacteria | 4167 |
| 446 | Ga0495662_0108159 | 3300046476 | Bacteria | 1362 |
| 447 | Ga0495662_0211315 | 3300046476 | Bacteria | 956 |
| 448 | Ga0495662_0559525 | 3300046476 | Bacteria | 560 |
| 449 | Ga0495664_0104877 | 3300046477 | Bacteria | 1704 |
| 450 | Ga0495584_0377913 | 3300046491 | Bacteria | 720 |
| 451 | Ga0495584_0670679 | 3300046491 | Bacteria | 529 |
| 452 | Ga0495594_0000012 | 3300046499 | Bacteria | 105133 |
| 453 | Ga0495594_0117509 | 3300046499 | Bacteria | 1502 |
| 454 | Ga0495606_0000895 | 3300046507 | Bacteria | 44393 |
| 455 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 456 | Ga0495608_0000092 | 3300046511 | Bacteria | 64795 |
| 457 | Ga0495608_0030777 | 3300046511 | Bacteria | 3631 |
| 458 | Ga0495608_0090400 | 3300046511 | Bacteria | 1981 |
| 459 | Ga0495618_0000094 | 3300046514 | Bacteria | 64293 |
| 460 | Ga0495618_0561944 | 3300046514 | Bacteria | 682 |
| 461 | Ga0495620_0001177 | 3300046515 | Bacteria | 16018 |
| 462 | Ga0495620_0110416 | 3300046515 | Bacteria | 1090 |
| 463 | Ga0495628_0011464 | 3300046516 | Bacteria | 7494 |
| 464 | Ga0495628_0173427 | 3300046516 | Bacteria | 1634 |
| 465 | Ga0495628_0279023 | 3300046516 | Bacteria | 1241 |
| 466 | Ga0495628_0283957 | 3300046516 | Bacteria | 1228 |
| 467 | Ga0495628_0363418 | 3300046516 | Bacteria | 1062 |
| 468 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 469 | Ga0495630_0001088 | 3300046517 | Bacteria | 18687 |
| 470 | Ga0495630_0005122 | 3300046517 | Bacteria | 9222 |
| 471 | Ga0495630_0128742 | 3300046517 | Bacteria | 1922 |
| 472 | Ga0495637_0059066 | 3300046520 | Bacteria | 1579 |
| 473 | Ga0495637_0267690 | 3300046520 | Unclassified | 612 |
| 474 | Ga0495644_0006649 | 3300046523 | Bacteria | 4479 |
| 475 | Ga0495642_0215545 | 3300046528 | Bacteria | 838 |
| 476 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 477 | Ga0495652_0090220 | 3300046529 | Bacteria | 2508 |
| 478 | Ga0495640_0032590 | 3300046533 | Bacteria | 3711 |
| 479 | Ga0495640_0522300 | 3300046533 | Bacteria | 721 |
| 480 | Ga0495586_0003566 | 3300046535 | Bacteria | 8341 |
| 481 | Ga0495586_0165578 | 3300046535 | Bacteria | 1248 |
| 482 | Ga0495587_0033413 | 3300046536 | Bacteria | 3106 |
| 483 | Ga0495587_0075611 | 3300046536 | Bacteria | 1956 |
| 484 | Ga0495598_0001187 | 3300046537 | Bacteria | 5038 |
| 485 | Ga0495621_0006180 | 3300046539 | Bacteria | 3482 |
| 486 | Ga0495597_0307911 | 3300046542 | Bacteria | 614 |
| 487 | Ga0495645_0043713 | 3300046543 | Bacteria | 3268 |
| 488 | Ga0495645_0062351 | 3300046543 | Bacteria | 2700 |
| 489 | Ga0495645_0189460 | 3300046543 | Bacteria | 1403 |
| 490 | Ga0495622_0000578 | 3300046557 | Bacteria | 21905 |
| 491 | Ga0495667_0000265 | 3300046559 | Bacteria | 34047 |
| 492 | Ga0495667_0030451 | 3300046559 | Bacteria | 3626 |
| 493 | Ga0495656_0000429 | 3300046615 | Bacteria | 13711 |
| 494 | Ga0495668_0094173 | 3300046616 | Bacteria | 1640 |
| 495 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 496 | Ga0495634_0000191 | 3300046642 | Bacteria | 56356 |
| 497 | Ga0495634_0019259 | 3300046642 | Bacteria | 4849 |
| 498 | Ga0495634_0137071 | 3300046642 | Bacteria | 1556 |
| 499 | Ga0495625_0000243 | 3300046660 | Bacteria | 85589 |
| 500 | Ga0495625_0243376 | 3300046660 | Bacteria | 1170 |
| 501 | Ga0495635_0000182 | 3300046663 | Bacteria | 39469 |
| 502 | Ga0495635_0004480 | 3300046663 | Bacteria | 9675 |
| 503 | Ga0495588_0000266 | 3300046674 | Bacteria | 40474 |
| 504 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 505 | Ga0495657_0004649 | 3300046675 | Bacteria | 10949 |
| 506 | Ga0495657_0192481 | 3300046675 | Bacteria | 1246 |
| 507 | Ga0495599_0004118 | 3300046678 | Bacteria | 8583 |
| 508 | Ga0495599_0270602 | 3300046678 | Bacteria | 1031 |
| 509 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 510 | Ga0495647_0034599 | 3300046681 | Bacteria | 1893 |
| 511 | Ga0495647_0055281 | 3300046681 | Bacteria | 1553 |
| 512 | Ga0495647_0230342 | 3300046681 | Bacteria | 820 |
| 513 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 514 | Ga0495658_0031777 | 3300046683 | Bacteria | 2877 |
| 515 | Ga0495658_0743171 | 3300046683 | Bacteria | 628 |
| 516 | Ga0495669_0000188 | 3300046684 | Bacteria | 38417 |
| 517 | Ga0495669_0010344 | 3300046684 | Bacteria | 3942 |
| 518 | Ga0495669_0273938 | 3300046684 | Bacteria | 811 |
| 519 | Ga0495613_0000132 | 3300046689 | Bacteria | 74233 |
| 520 | Ga0495613_0000173 | 3300046689 | Bacteria | 62463 |
| 521 | Ga0495613_0101242 | 3300046689 | Bacteria | 2081 |
| 522 | Ga0495613_0304261 | 3300046689 | Bacteria | 1103 |
| 523 | Ga0495624_0000343 | 3300046690 | Bacteria | 36927 |
| 524 | Ga0495624_0000563 | 3300046690 | Bacteria | 29131 |
| 525 | Ga0495624_0018984 | 3300046690 | Bacteria | 4593 |
| 526 | Ga0495624_0420887 | 3300046690 | Bacteria | 801 |
| 527 | Ga0495670_0028796 | 3300046691 | Bacteria | 2754 |
| 528 | Ga0495649_0007603 | 3300046694 | Bacteria | 6588 |
| 529 | Ga0495600_0002279 | 3300046809 | Bacteria | 10937 |
| 530 | Ga0495600_0043677 | 3300046809 | Bacteria | 2923 |
| 531 | Ga0495600_0045484 | 3300046809 | Bacteria | 2864 |
| 532 | Ga0495600_0214080 | 3300046809 | Bacteria | 1234 |
| 533 | Ga0495604_0000437 | 3300047317 | Bacteria | 37081 |
| 534 | Ga0495604_0006534 | 3300047317 | Bacteria | 9241 |
| 535 | Ga0495604_0088714 | 3300047317 | Bacteria | 2300 |
| 536 | Ga0495604_0550856 | 3300047317 | Bacteria | 744 |
| 537 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 538 | Ga0495672_0139049 | 3300047320 | Bacteria | 1270 |
| 539 | Ga0495676_0000320 | 3300047321 | Bacteria | 38969 |
| 540 | Ga0495676_0008923 | 3300047321 | Bacteria | 9159 |
| 541 | Ga0495676_0179551 | 3300047321 | Bacteria | 1484 |
| 542 | Ga0495676_0330236 | 3300047321 | Bacteria | 1023 |
| 543 | Ga0495676_0427247 | 3300047321 | Bacteria | 876 |
| 544 | Ga0495680_0000113 | 3300047322 | Bacteria | 76525 |
| 545 | Ga0495680_0005366 | 3300047322 | Bacteria | 12092 |
| 546 | Ga0495680_0017421 | 3300047322 | Bacteria | 6136 |
| 547 | Ga0495680_0181853 | 3300047322 | Bacteria | 1517 |
| 548 | Ga0495680_0879296 | 3300047322 | Bacteria | 580 |
| 549 | Ga0495675_0000094 | 3300047444 | Bacteria | 63338 |
| 550 | Ga0495675_0166063 | 3300047444 | Bacteria | 1357 |
| 551 | Ga0495679_029636 | 3300047446 | Bacteria | 1784 |
| 552 | Ga0495673_0052087 | 3300047469 | Bacteria | 1790 |
| 553 | Ga0495684_0080956 | 3300047471 | Bacteria | 2465 |
| 554 | Ga0495686_0046915 | 3300047472 | Bacteria | 2729 |
| 555 | Ga0495686_0066554 | 3300047472 | Bacteria | 2226 |
| 556 | Ga0495593_0128513 | 3300047673 | Bacteria | 1287 |
| 557 | Ga0495593_0128680 | 3300047673 | Bacteria | 1286 |
| 558 | Ga0495593_0148503 | 3300047673 | Bacteria | 1186 |
| 559 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 560 | Ga0495602_0000315 | 3300048088 | Bacteria | 44563 |
| 561 | Ga0495602_0061367 | 3300048088 | Bacteria | 3270 |
| 562 | Ga0495602_0125208 | 3300048088 | Bacteria | 2060 |
| 563 | Ga0495602_0217397 | 3300048088 | Bacteria | 1445 |
| 564 | Ga0495602_0220088 | 3300048088 | Bacteria | 1434 |
| 565 | Ga0495614_0065090 | 3300048089 | Bacteria | 1568 |
| 566 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 567 | Ga0496100_0000006 | 3300048903 | Bacteria | 297429 |
| 568 | Ga0496100_0333654 | 3300048903 | Bacteria | 1142 |
| 569 | Ga0496101_0000009 | 3300048904 | Bacteria | 297429 |
| 570 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 571 | Ga0496101_0055455 | 3300048904 | Bacteria | 2863 |
| 572 | Ga0496101_0223187 | 3300048904 | Bacteria | 1463 |
| 573 | Ga0496102_0000129 | 3300048905 | Bacteria | 104478 |
| 574 | Ga0496102_0020642 | 3300048905 | Bacteria | 5822 |
| 575 | Ga0496102_0175324 | 3300048905 | Bacteria | 2019 |
| 576 | Ga0496102_0483774 | 3300048905 | Bacteria | 1159 |
| 577 | Ga0496102_0522826 | 3300048905 | Bacteria | 1109 |
| 578 | Ga0496102_0542868 | 3300048905 | Bacteria | 1085 |
| 579 | Ga0496102_1039836 | 3300048905 | Bacteria | 739 |
| 580 | Ga0496103_0000087 | 3300048906 | Bacteria | 104566 |
| 581 | Ga0496103_0256502 | 3300048906 | Bacteria | 1125 |
| 582 | Ga0496103_0327220 | 3300048906 | Bacteria | 986 |
| 583 | Ga0496103_0551718 | 3300048906 | Bacteria | 736 |
| 584 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 585 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 586 | Ga0496104_0083908 | 3300048907 | Bacteria | 3039 |
| 587 | Ga0496104_0134827 | 3300048907 | Bacteria | 2372 |
| 588 | Ga0496104_0508878 | 3300048907 | Bacteria | 1115 |
| 589 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 590 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 591 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 592 | Ga0496105_0032204 | 3300048908 | Bacteria | 4302 |
| 593 | Ga0496105_0166836 | 3300048908 | Bacteria | 1806 |
| 594 | Ga0496105_1310310 | 3300048908 | Unclassified | 528 |
| 595 | Ga0496106_0000134 | 3300048909 | Bacteria | 55531 |
| 596 | Ga0496106_0000172 | 3300048909 | Bacteria | 47232 |
| 597 | Ga0496106_0001026 | 3300048909 | Bacteria | 20534 |
| 598 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 599 | Ga0496107_0000693 | 3300048910 | Bacteria | 19147 |
| 600 | Ga0496107_0233966 | 3300048910 | Bacteria | 1367 |
| 601 | Ga0496107_0462261 | 3300048910 | Bacteria | 942 |
| 602 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 603 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 604 | Ga0496108_0017216 | 3300048911 | Bacteria | 5911 |
| 605 | Ga0496108_0018362 | 3300048911 | Bacteria | 5728 |
| 606 | Ga0496108_0266037 | 3300048911 | Bacteria | 1492 |
| 607 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 608 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 609 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 610 | Ga0496109_0020187 | 3300048912 | Bacteria | 5885 |
| 611 | Ga0496109_0059096 | 3300048912 | Bacteria | 3503 |
| 612 | Ga0496109_0119258 | 3300048912 | Bacteria | 2456 |
| 613 | Ga0496109_0138785 | 3300048912 | Bacteria | 2273 |
| 614 | Ga0496110_0000185 | 3300048913 | Bacteria | 39094 |
| 615 | Ga0496110_0001335 | 3300048913 | Bacteria | 17714 |
| 616 | Ga0496110_0020346 | 3300048913 | Bacteria | 5604 |
| 617 | Ga0496110_0238862 | 3300048913 | Bacteria | 1653 |
| 618 | Ga0496110_0362617 | 3300048913 | Bacteria | 1320 |
| 619 | Ga0496111_0000103 | 3300048914 | Bacteria | 36804 |
| 620 | Ga0496111_0110728 | 3300048914 | Bacteria | 2022 |
| 621 | Ga0496111_0280976 | 3300048914 | Unclassified | 1234 |
| 622 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 623 | Ga0496112_0000661 | 3300048915 | Bacteria | 23981 |
| 624 | Ga0496113_0000017 | 3300048916 | Bacteria | 74327 |
| 625 | Ga0496113_0003132 | 3300048916 | Bacteria | 9842 |
| 626 | Ga0496113_0049089 | 3300048916 | Bacteria | 3142 |
| 627 | Ga0496113_0294725 | 3300048916 | Bacteria | 1298 |
| 628 | Ga0496113_0607987 | 3300048916 | Bacteria | 875 |
| 629 | Ga0496113_1353059 | 3300048916 | Unclassified | 552 |
| 630 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 631 | Ga0496114_0060718 | 3300048917 | Bacteria | 3160 |
| 632 | Ga0496114_0200298 | 3300048917 | Bacteria | 1749 |
| 633 | Ga0496114_0550438 | 3300048917 | Bacteria | 1019 |
| 634 | Ga0496114_0816191 | 3300048917 | Unclassified | 812 |
| 635 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 636 | Ga0496115_0000408 | 3300048918 | Bacteria | 35443 |
| 637 | Ga0496115_0004705 | 3300048918 | Bacteria | 9895 |
| 638 | Ga0496116_0000120 | 3300048919 | Bacteria | 166804 |
| 639 | Ga0496117_0012076 | 3300048920 | Bacteria | 7665 |
| 640 | Ga0496117_0036667 | 3300048920 | Bacteria | 3665 |
| 641 | Ga0496118_0011259 | 3300048921 | Bacteria | 8752 |
| 642 | Ga0496118_0137880 | 3300048921 | Bacteria | 1553 |
| 643 | Ga0496118_0442046 | 3300048921 | Bacteria | 663 |
| 644 | Ga0496119_0003116 | 3300048922 | Bacteria | 17493 |
| 645 | Ga0496119_0015832 | 3300048922 | Bacteria | 5776 |
| 646 | Ga0496119_0035054 | 3300048922 | Bacteria | 3294 |
| 647 | Ga0496119_0071154 | 3300048922 | Bacteria | 2037 |
| 648 | Ga0496119_0097267 | 3300048922 | Bacteria | 1659 |
| 649 | Ga0496120_0004886 | 3300048923 | Bacteria | 10919 |
| 650 | Ga0496120_0018303 | 3300048923 | Bacteria | 4522 |
| 651 | Ga0496121_0021369 | 3300048924 | Bacteria | 6342 |
| 652 | Ga0496121_0120743 | 3300048924 | Bacteria | 1980 |
| 653 | Ga0496121_0402075 | 3300048924 | Bacteria | 897 |
| 654 | Ga0496124_0069439 | 3300048927 | Bacteria | 2925 |
| 655 | Ga0496124_0131175 | 3300048927 | Bacteria | 1991 |
| 656 | Ga0496125_0087036 | 3300048928 | Bacteria | 2361 |
| 657 | Ga0496125_0111457 | 3300048928 | Bacteria | 1980 |
| 658 | Ga0496125_0157503 | 3300048928 | Bacteria | 1548 |
| 659 | Ga0496126_0156235 | 3300048929 | Bacteria | 1952 |
| 660 | Ga0496126_0231107 | 3300048929 | Bacteria | 1549 |
| 661 | Ga0501031_0000272 | 3300049568 | Bacteria | 29278 |
| 662 | Ga0501032_0006867 | 3300049569 | Bacteria | 8344 |
| 663 | Ga0501032_0268291 | 3300049569 | Unclassified | 1106 |
| 664 | Ga0501033_0005400 | 3300049570 | Bacteria | 10126 |
| 665 | Ga0501033_0461963 | 3300049570 | Bacteria | 881 |
| 666 | Ga0501034_0086802 | 3300049571 | Bacteria | 3129 |
| 667 | Ga0501034_0098666 | 3300049571 | Bacteria | 2916 |
| 668 | Ga0501034_0579231 | 3300049571 | Bacteria | 1029 |
| 669 | Ga0501034_0619377 | 3300049571 | Bacteria | 986 |
| 670 | Ga0501036_0020224 | 3300049572 | Bacteria | 5590 |
| 671 | Ga0501037_0007685 | 3300049573 | Bacteria | 7891 |
| 672 | Ga0501038_0003846 | 3300049574 | Bacteria | 13960 |
| 673 | Ga0501039_0024418 | 3300049575 | Bacteria | 4643 |
| 674 | Ga0501039_0254123 | 3300049575 | Bacteria | 1382 |
| 675 | Ga0501040_0204597 | 3300049576 | Bacteria | 1402 |
| 676 | Ga0501040_0604487 | 3300049576 | Bacteria | 792 |
| 677 | Ga0501041_0172223 | 3300049577 | Bacteria | 1355 |
| 678 | Ga0501041_0327998 | 3300049577 | Bacteria | 966 |
| 679 | Ga0501042_0029788 | 3300049578 | Bacteria | 3850 |
| 680 | Ga0501042_0077376 | 3300049578 | Bacteria | 2382 |
| 681 | Ga0501042_0552625 | 3300049578 | Bacteria | 837 |
| 682 | Ga0501043_0003675 | 3300049579 | Bacteria | 12596 |
| 683 | Ga0501043_0355156 | 3300049579 | Bacteria | 1113 |
| 684 | Ga0501043_0419878 | 3300049579 | Bacteria | 1008 |
| 685 | Ga0501046_0004234 | 3300049580 | Bacteria | 13054 |
| 686 | Ga0501046_0531382 | 3300049580 | Bacteria | 840 |
| 687 | Ga0501047_0010785 | 3300049581 | Bacteria | 8639 |
| 688 | Ga0501047_0020697 | 3300049581 | Bacteria | 6318 |
| 689 | Ga0501047_0034306 | 3300049581 | Bacteria | 4899 |
| 690 | Ga0501047_0103855 | 3300049581 | Bacteria | 2722 |
| 691 | Ga0501047_0427558 | 3300049581 | Bacteria | 1155 |
| 692 | Ga0501048_0002902 | 3300049582 | Bacteria | 13084 |
| 693 | Ga0501048_0131896 | 3300049582 | Bacteria | 1766 |
| 694 | Ga0501067_0043920 | 3300049583 | Bacteria | 2483 |
| 695 | Ga0501067_0100998 | 3300049583 | Bacteria | 1603 |
| 696 | Ga0501068_0052708 | 3300049584 | Bacteria | 2462 |
| 697 | Ga0501068_0736997 | 3300049584 | Bacteria | 645 |
| 698 | Ga0501069_0018241 | 3300049585 | Bacteria | 3785 |
| 699 | Ga0501069_0029324 | 3300049585 | Bacteria | 3019 |
| 700 | Ga0501070_0000603 | 3300049586 | Bacteria | 32865 |
| 701 | Ga0501070_0008116 | 3300049586 | Bacteria | 8885 |
| 702 | Ga0501070_0047875 | 3300049586 | Bacteria | 3552 |
| 703 | Ga0501070_0186013 | 3300049586 | Bacteria | 1708 |
| 704 | Ga0501070_0491534 | 3300049586 | Bacteria | 986 |
| 705 | Ga0501071_0006824 | 3300049587 | Bacteria | 7436 |
| 706 | Ga0501071_0124051 | 3300049587 | Bacteria | 1916 |
| 707 | Ga0501071_0408925 | 3300049587 | Bacteria | 1036 |
| 708 | Ga0501072_0491866 | 3300049588 | Bacteria | 970 |
| 709 | Ga0501072_0936519 | 3300049588 | Bacteria | 676 |
| 710 | Ga0501073_0006764 | 3300049589 | Bacteria | 8537 |
| 711 | Ga0501074_0021047 | 3300049590 | Bacteria | 4736 |
| 712 | Ga0501074_0152252 | 3300049590 | Bacteria | 1653 |
| 713 | Ga0501074_0221459 | 3300049590 | Bacteria | 1347 |
| 714 | Ga0501074_0256613 | 3300049590 | Bacteria | 1243 |
| 715 | Ga0501075_0028192 | 3300049591 | Bacteria | 4143 |
| 716 | Ga0501075_0219755 | 3300049591 | Bacteria | 1449 |
| 717 | Ga0501075_0743323 | 3300049591 | Bacteria | 747 |
| 718 | Ga0501076_0227517 | 3300049592 | Bacteria | 1525 |
| 719 | Ga0501076_1410805 | 3300049592 | Unclassified | 572 |
| 720 | Ga0501077_0142241 | 3300049593 | Bacteria | 1522 |
| 721 | Ga0501079_0043646 | 3300049741 | Bacteria | 3461 |
| 722 | Ga0501079_0166559 | 3300049741 | Bacteria | 1719 |
| 723 | Ga0501079_0578485 | 3300049741 | Bacteria | 883 |
| 724 | Ga0501080_0008650 | 3300049742 | Bacteria | 9241 |
| 725 | Ga0501080_0715709 | 3300049742 | Bacteria | 882 |
| 726 | Ga0501080_1131260 | 3300049742 | Unclassified | 675 |
| 727 | Ga0501081_0019459 | 3300049743 | Bacteria | 4521 |
| 728 | Ga0501081_0279061 | 3300049743 | Bacteria | 1223 |
| 729 | Ga0501083_0005984 | 3300049744 | Bacteria | 8613 |
| 730 | Ga0501083_0053390 | 3300049744 | Bacteria | 2713 |
| 731 | Ga0501035_0004600 | 3300049822 | Bacteria | 13082 |
| 732 | Ga0501035_0241278 | 3300049822 | Bacteria | 1537 |
| 733 | Ga0501044_0003139 | 3300049823 | Bacteria | 18693 |
| 734 | Ga0501044_0085790 | 3300049823 | Bacteria | 3181 |
| 735 | Ga0501044_0103325 | 3300049823 | Bacteria | 2864 |
| 736 | Ga0501044_0693539 | 3300049823 | Bacteria | 904 |
| 737 | Ga0501044_0809796 | 3300049823 | Bacteria | 815 |
| 738 | Ga0501045_0032626 | 3300049824 | Bacteria | 3775 |
| 739 | Ga0501045_0653861 | 3300049824 | Unclassified | 777 |
| 740 | Ga0501045_0746873 | 3300049824 | Bacteria | 721 |
| 741 | nmdc:mga03n38_970_c1 | 3300050490 | Bacteria | 7796 |
| 742 | nmdc:mga00v17_154339_c1 | 3300050491 | Unclassified | 1476 |
| 743 | nmdc:mga00v17_243411_c1 | 3300050491 | Bacteria | 1166 |
| 744 | nmdc:mga00v17_407706_c1 | 3300050491 | Bacteria | 883 |
| 745 | nmdc:mga00v17_54224_c1 | 3300050491 | Bacteria | 2445 |
| 746 | nmdc:mga00v17_948473_c1 | 3300050491 | Bacteria | 543 |
| 747 | nmdc:mga0yw44_154221_c1 | 3300050492 | Bacteria | 1500 |
| 748 | nmdc:mga0yw44_164821_c1 | 3300050492 | Bacteria | 1452 |
| 749 | nmdc:mga0yw44_187368_c1 | 3300050492 | Bacteria | 1364 |
| 750 | nmdc:mga0yw44_271335_c1 | 3300050492 | Bacteria | 1132 |
| 751 | nmdc:mga0yw44_488217_c1 | 3300050492 | Bacteria | 835 |
| 752 | nmdc:mga06z11_105634_c1 | 3300050494 | Bacteria | 1552 |
| 753 | nmdc:mga06z11_504253_c1 | 3300050494 | Unclassified | 733 |
| 754 | nmdc:mga04h51_77443_c1 | 3300050495 | Bacteria | 1173 |
| 755 | nmdc:mga07m45_143190_c1 | 3300050496 | Bacteria | 1385 |
| 756 | nmdc:mga0qj67_22501_c1 | 3300050509 | Bacteria | 4841 |
| 757 | nmdc:mga0qj67_48756_c1 | 3300050509 | Bacteria | 3346 |
| 758 | nmdc:mga06r32_105494_c1 | 3300050510 | Bacteria | 2768 |
| 759 | nmdc:mga08y16_1091760_c1 | 3300050511 | Bacteria | 773 |
| 760 | nmdc:mga08y16_1149155_c1 | 3300050511 | Bacteria | 749 |
| 761 | nmdc:mga0n895_378498_c1 | 3300050512 | Bacteria | 1432 |
| 762 | nmdc:mga0a205_281_c1 | 3300050515 | Bacteria | 37267 |
| 763 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 764 | Ga0495601_0000029 | 3300053077 | Bacteria | 111437 |
| 765 | Ga0495601_0000402 | 3300053077 | Bacteria | 22920 |
| 766 | Ga0495601_0008993 | 3300053077 | Bacteria | 5897 |
| 767 | Ga0495601_0028131 | 3300053077 | Bacteria | 3480 |
| 768 | Ga0495601_0031656 | 3300053077 | Bacteria | 3288 |
| 769 | Ga0495601_0059271 | 3300053077 | Bacteria | 2427 |
| 770 | Ga0495601_0264115 | 3300053077 | Bacteria | 1123 |
| 771 | Ga0495601_0715395 | 3300053077 | Bacteria | 638 |
| 772 | Ga0495601_0856117 | 3300053077 | Bacteria | 575 |
| 773 | Ga0495612_0001859 | 3300053078 | Bacteria | 8670 |
| 774 | Ga0495612_0004880 | 3300053078 | Bacteria | 5552 |
| 775 | Ga0495612_0013167 | 3300053078 | Bacteria | 3331 |
| 776 | Ga0495612_0064862 | 3300053078 | Bacteria | 1516 |
| 777 | Ga0495612_0107645 | 3300053078 | Bacteria | 1191 |
| 778 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 779 | Ga0495655_0076293 | 3300053083 | Bacteria | 948 |
| 780 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 781 | Ga0495595_0000547 | 3300053084 | Bacteria | 14350 |
| 782 | Ga0495595_0071534 | 3300053084 | Bacteria | 1640 |
| 783 | Ga0495595_0123199 | 3300053084 | Bacteria | 1264 |
| 784 | Ga0495595_0182647 | 3300053084 | Bacteria | 1040 |
| 785 | Ga0495595_0221538 | 3300053084 | Bacteria | 944 |
| 786 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 787 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 788 | Ga0495619_0000067 | 3300053085 | Bacteria | 83418 |
| 789 | Ga0495619_0000205 | 3300053085 | Bacteria | 42913 |
| 790 | Ga0495619_0003901 | 3300053085 | Bacteria | 9588 |
| 791 | Ga0495619_0013008 | 3300053085 | Bacteria | 5243 |
| 792 | Ga0495619_0193154 | 3300053085 | Bacteria | 1409 |
| 793 | Ga0495619_0431923 | 3300053085 | Bacteria | 908 |
| 794 | Ga0495619_0441473 | 3300053085 | Bacteria | 897 |
| 795 | Ga0500566_0001360 | 3300053094 | Bacteria | 14314 |
| 796 | Ga0500641_0007415 | 3300053096 | Bacteria | 3911 |
| 797 | Ga0500614_000636 | 3300053123 | Bacteria | 8951 |
| 798 | Ga0500628_000024 | 3300053129 | Bacteria | 64538 |
| 799 | Ga0500658_0015480 | 3300053134 | Bacteria | 2833 |
| 800 | Ga0501084_0425072 | 3300054114 | Bacteria | 1123 |
| 801 | Ga0501084_0774127 | 3300054114 | Bacteria | 808 |
| 802 | Ga0501082_0035316 | 3300060353 | Bacteria | 4308 |
| 803 | Ga0501082_0391434 | 3300060353 | Bacteria | 1213 |
| 804 | Ga0501082_1656984 | 3300060353 | Bacteria | 558 |
| 805 | Ga0530510_0456008 | 3300061734 | Bacteria | 967 |
| 806 | Ga0530510_0536454 | 3300061734 | Bacteria | 888 |
| 807 | Ga0530510_1212210 | 3300061734 | Unclassified | 579 |
| 808 | Ga0495653_0075841 | |||
| 809 | JGI24746J21847_1000063 | |||
| 810 | JGI24740J21852_10003503 | |||
| 811 | JGI24034J26672_10001204 | |||
| 812 | JGI24751J29686_10040041 | |||
| 813 | JGI25406J46586_10079445 | |||
| 814 | JGI25404J52841_10015867 | |||
| 815 | Ga0070658_10561537 | |||
| 816 | Ga0070683_100011615 | |||
| 817 | Ga0070683_100031765 | |||
| 818 | Ga0070683_100192357 | |||
| 819 | Ga0070683_100365743 | |||
| 820 | Ga0070683_100440370 | |||
| 821 | Ga0070670_100100171 | |||
| 822 | Ga0070677_10001179 | |||
| 823 | Ga0070666_10005134 | |||
| 824 | Ga0070666_10018876 | |||
| 825 | Ga0070680_100270119 | |||
| 826 | Ga0070680_100894434 | |||
| 827 | Ga0070682_100000009 | |||
| 828 | Ga0070682_100000061 | |||
| 829 | Ga0070682_100145503 | |||
| 830 | Ga0070682_100561615 | |||
| 831 | Ga0068868_100000104 | |||
| 832 | Ga0068868_100008318 | |||
| 833 | Ga0070689_100167007 | |||
| 834 | Ga0070689_100367531 | |||
| 835 | Ga0070689_101190632 | |||
| 836 | Ga0070691_10018604 | |||
| 837 | Ga0070691_10079856 | |||
| 838 | Ga0070687_100304074 | |||
| 839 | Ga0070661_100000110 | |||
| 840 | Ga0070692_10133729 | |||
| 841 | Ga0070668_100018993 | |||
| 842 | Ga0070668_100541165 | |||
| 843 | Ga0070675_100000091 | |||
| 844 | Ga0070674_100000019 | |||
| 845 | Ga0070674_100000030 | |||
| 846 | Ga0070674_100068087 | |||
| 847 | Ga0070673_100016927 | |||
| 848 | Ga0070673_101602761 | |||
| 849 | Ga0070688_100000077 | |||
| 850 | Ga0070688_100000937 | |||
| 851 | Ga0070659_100219493 | |||
| 852 | Ga0070667_100000597 | |||
| 853 | Ga0070667_100061279 | |||
| 854 | Ga0070667_100183456 | |||
| 855 | Ga0070714_100016382 | |||
| 856 | Ga0070714_101538777 | |||
| 857 | Ga0070713_100000135 | |||
| 858 | Ga0070713_101132661 | |||
| 859 | Ga0070701_10706001 | |||
| 860 | Ga0070711_100402416 | |||
| 861 | Ga0070700_100642768 | |||
| 862 | Ga0070663_100002413 | |||
| 863 | Ga0070663_100160259 | |||
| 864 | Ga0070663_100493462 | |||
| 865 | Ga0070663_101630720 | |||
| 866 | Ga0070678_100016978 | |||
| 867 | Ga0070662_100000001 | |||
| 868 | Ga0070681_10130354 | |||
| 869 | Ga0070681_10853037 | |||
| 870 | Ga0068867_100001975 | |||
| 871 | Ga0070685_10000061 | |||
| 872 | Ga0070685_10000965 | |||
| 873 | Ga0070685_10249296 | |||
| 874 | Ga0070685_10663912 | |||
| 875 | Ga0070706_100704758 | |||
| 876 | Ga0070679_100000088 | |||
| 877 | Ga0070679_100014779 | |||
| 878 | Ga0070684_100043101 | |||
| 879 | Ga0070684_100166554 | |||
| 880 | Ga0070684_100951324 | |||
| 881 | Ga0068853_100045796 | |||
| 882 | Ga0068853_100370084 | |||
| 883 | Ga0070672_100000005 | |||
| 884 | Ga0070686_100177806 | |||
| 885 | Ga0070695_100552488 | |||
| 886 | Ga0070693_100005314 | |||
| 887 | Ga0070693_100882773 | |||
| 888 | Ga0070665_100000022 | |||
| 889 | Ga0070665_100170243 | |||
| 890 | Ga0070665_100282978 | |||
| 891 | Ga0070665_100369737 | |||
| 892 | Ga0070665_101456766 | |||
| 893 | Ga0070704_100288739 | |||
| 894 | Ga0068855_100485303 | |||
| 895 | Ga0070664_100118646 | |||
| 896 | Ga0068854_100001193 | |||
| 897 | Ga0068854_100121310 | |||
| 898 | Ga0068856_100005135 | |||
| 899 | Ga0068856_100017905 | |||
| 900 | Ga0068856_100130001 | |||
| 901 | Ga0068856_100231969 | |||
| 902 | Ga0070702_100572749 | |||
| 903 | Ga0068852_100000037 | |||
| 904 | Ga0068852_100899962 | |||
| 905 | Ga0068859_100554284 | |||
| 906 | Ga0068859_101021985 | |||
| 907 | Ga0068864_100000043 | |||
| 908 | Ga0068866_10000005 | |||
| 909 | Ga0068866_10000645 | |||
| 910 | Ga0068866_10040199 | |||
| 911 | Ga0068861_100216257 | |||
| 912 | Ga0068851_10000741 | |||
| 913 | Ga0068851_10045443 | |||
| 914 | Ga0068863_100000761 | |||
| 915 | Ga0068863_100786095 | |||
| 916 | Ga0068863_101000478 | |||
| 917 | Ga0068858_100000017 | |||
| 918 | Ga0068858_100001657 | |||
| 919 | Ga0068858_100344114 | |||
| 920 | Ga0068858_100576201 | |||
| 921 | Ga0068860_100020604 | |||
| 922 | Ga0068860_100048144 | |||
| 923 | Ga0068862_100000366 | |||
| 924 | Ga0081455_10019072 | |||
| 925 | Ga0081455_10021413 | |||
| 926 | Ga0081455_10022734 | |||
| 927 | Ga0081455_10052328 | |||
| 928 | Ga0081455_10085453 | |||
| 929 | Ga0081538_10000279 | |||
| 930 | Ga0081538_10008303 | |||
| 931 | Ga0081538_10068073 | |||
| 932 | Ga0081538_10133347 | |||
| 933 | Ga0081540_1000994 | |||
| 934 | Ga0081540_1002630 | |||
| 935 | Ga0081540_1049696 | |||
| 936 | Ga0081540_1077734 | |||
| 937 | Ga0081539_10002753 | |||
| 938 | Ga0081539_10223030 | |||
| 939 | Ga0075365_10150839 | |||
| 940 | Ga0075365_10311150 | |||
| 941 | Ga0075365_10465353 | |||
| 942 | Ga0075363_100077964 | |||
| 943 | Ga0075363_100229633 | |||
| 944 | Ga0075363_100254041 | |||
| 945 | Ga0075363_100285119 | |||
| 946 | Ga0075363_100506818 | |||
| 947 | Ga0075364_10052053 | |||
| 948 | Ga0075364_10098504 | |||
| 949 | Ga0070715_10000008 | |||
| 950 | Ga0075367_10014716 | |||
| 951 | Ga0075367_10495668 | |||
| 952 | Ga0097621_100348354 | |||
| 953 | Ga0075370_10461226 | |||
| 954 | Ga0068871_100280695 | |||
| 955 | Ga0068871_100748934 | |||
| 956 | Ga0075430_100019225 | |||
| 957 | Ga0075430_100028465 | |||
| 958 | Ga0075431_100019004 | |||
| 959 | Ga0075433_10002844 | |||
| 960 | Ga0075433_10003268 | |||
| 961 | Ga0075434_101855833 | |||
| 962 | Ga0075429_101070141 | |||
| 963 | Ga0068865_100000089 | |||
| 964 | Ga0068865_100248902 | |||
| 965 | Ga0097620_100554329 | |||
| 966 | Ga0097620_101022036 | |||
| 967 | Ga0105240_10370785 | |||
| 968 | Ga0105240_10391637 | |||
| 969 | Ga0111539_10380430 | |||
| 970 | Ga0111539_12414790 | |||
| 971 | Ga0111539_12560859 | |||
| 972 | Ga0105245_10001641 | |||
| 973 | Ga0105245_10001806 | |||
| 974 | Ga0105245_10002937 | |||
| 975 | Ga0105245_10444841 | |||
| 976 | Ga0105245_10493084 | |||
| 977 | Ga0105245_10660449 | |||
| 978 | Ga0105245_10717322 | |||
| 979 | Ga0105245_11187958 | |||
| 980 | Ga0105247_10000148 | |||
| 981 | Ga0105247_10102660 | |||
| 982 | Ga0105247_10244616 | |||
| 983 | Ga0105247_10255241 | |||
| 984 | Ga0105243_10014402 | |||
| 985 | Ga0105243_10415157 | |||
| 986 | Ga0105243_10461872 | |||
| 987 | Ga0105243_11392845 | |||
| 988 | Ga0105241_10064199 | |||
| 989 | Ga0105242_10000052 | |||
| 990 | Ga0105242_10127169 | |||
| 991 | Ga0105242_12753087 | |||
| 992 | Ga0105248_10000017 | |||
| 993 | Ga0105248_10625591 | |||
| 994 | Ga0105248_10788899 | |||
| 995 | Ga0105237_10291929 | |||
| 996 | Ga0105238_10000016 | |||
| 997 | Ga0105238_10719819 | |||
| 998 | Ga0105249_10000331 | |||
| 999 | Ga0105249_10001411 | |||
| 1000 | Ga0105249_10131733 | |||
| 1001 | Ga0105249_10355377 | |||
| 1002 | Ga0105249_10494563 | |||
| 1003 | Ga0105239_10119724 | |||
| 1004 | Ga0105239_10230456 | |||
| 1005 | Ga0105239_10416869 | |||
| 1006 | Ga0105239_10485955 | |||
| 1007 | Ga0105246_10132936 | |||
| 1008 | Ga0157371_10039820 | |||
| 1009 | Ga0157370_10038083 | |||
| 1010 | Ga0157370_11130078 | |||
| 1011 | Ga0157369_10000105 | |||
| 1012 | Ga0157374_10003750 | |||
| 1013 | Ga0157374_10380572 | |||
| 1014 | Ga0157378_10014664 | |||
| 1015 | Ga0157378_10134805 | |||
| 1016 | Ga0163162_10122193 | |||
| 1017 | Ga0163162_10788476 | |||
| 1018 | Ga0163162_10842929 | |||
| 1019 | Ga0163162_11500526 | |||
| 1020 | Ga0157372_10011019 | |||
| 1021 | Ga0157372_12066595 | |||
| 1022 | Ga0157375_10000717 | |||
| 1023 | Ga0157375_10005849 | |||
| 1024 | Ga0157375_10312228 | |||
| 1025 | Ga0157375_10348654 | |||
| 1026 | Ga0157375_10532221 | |||
| 1027 | Ga0163163_10133149 | |||
| 1028 | Ga0163163_10381539 | |||
| 1029 | Ga0163163_10574443 | |||
| 1030 | Ga0163163_10976597 | |||
| 1031 | Ga0163163_11072545 | |||
| 1032 | Ga0163163_11807583 | |||
| 1033 | Ga0157380_10001737 | |||
| 1034 | Ga0157380_10002174 | |||
| 1035 | Ga0157380_10722493 | |||
| 1036 | Ga0157379_10006275 | |||
| 1037 | Ga0157379_10042444 | |||
| 1038 | Ga0157379_10077380 | |||
| 1039 | Ga0157379_10138803 | |||
| 1040 | Ga0157376_10010190 | |||
| 1041 | Ga0157376_11654243 | |||
| 1042 | Ga0163161_10000064 | |||
| 1043 | Ga0163161_10293350 | |||
| 1044 | Ga0163161_10418428 | |||
| 1045 | Ga0206356_10694035 | |||
| 1046 | Ga0154015_1686715 | |||
| 1047 | Ga0207672_1005954 | |||
| 1048 | Ga0207656_10003732 | |||
| 1049 | Ga0207656_10013531 | |||
| 1050 | Ga0207682_10000799 | |||
| 1051 | Ga0207642_10000005 | |||
| 1052 | Ga0207642_10000854 | |||
| 1053 | Ga0207642_10023091 | |||
| 1054 | Ga0207710_10000336 | |||
| 1055 | Ga0207710_10137289 | |||
| 1056 | Ga0207710_10255809 | |||
| 1057 | Ga0207680_10020951 | |||
| 1058 | Ga0207680_10035678 | |||
| 1059 | Ga0207647_10278193 | |||
| 1060 | Ga0207685_10000012 | |||
| 1061 | Ga0207684_10446306 | |||
| 1062 | Ga0207654_10074141 | |||
| 1063 | Ga0207707_10010959 | |||
| 1064 | Ga0207707_10176229 | |||
| 1065 | Ga0207695_10306591 | |||
| 1066 | Ga0207695_10379008 | |||
| 1067 | Ga0207693_10001233 | |||
| 1068 | Ga0207660_10416083 | |||
| 1069 | Ga0207662_10198248 | |||
| 1070 | Ga0207649_10000015 | |||
| 1071 | Ga0207652_10000286 | |||
| 1072 | Ga0207652_10010480 | |||
| 1073 | Ga0207681_10188746 | |||
| 1074 | Ga0207681_10810447 | |||
| 1075 | Ga0207694_10000012 | |||
| 1076 | Ga0207650_10070934 | |||
| 1077 | Ga0207659_10000147 | |||
| 1078 | Ga0207687_10000040 | |||
| 1079 | Ga0207687_10000105 | |||
| 1080 | Ga0207687_10001806 | |||
| 1081 | Ga0207687_10504596 | |||
| 1082 | Ga0207687_10551492 | |||
| 1083 | Ga0207687_10875157 | |||
| 1084 | Ga0207700_10000003 | |||
| 1085 | Ga0207664_10159989 | |||
| 1086 | Ga0207664_11063832 | |||
| 1087 | Ga0207644_10038025 | |||
| 1088 | Ga0207644_10389915 | |||
| 1089 | Ga0207690_10160986 | |||
| 1090 | Ga0207706_10000003 | |||
| 1091 | Ga0207686_10000119 | |||
| 1092 | Ga0207709_10001985 | |||
| 1093 | Ga0207709_10269087 | |||
| 1094 | Ga0207709_10519813 | |||
| 1095 | Ga0207670_10049250 | |||
| 1096 | Ga0207670_10135646 | |||
| 1097 | Ga0207669_10000029 | |||
| 1098 | Ga0207669_10000140 | |||
| 1099 | Ga0207669_10226863 | |||
| 1100 | Ga0207704_10000018 | |||
| 1101 | Ga0207704_11825032 | |||
| 1102 | Ga0207691_10000028 | |||
| 1103 | Ga0207711_10000011 | |||
| 1104 | Ga0207711_10596050 | |||
| 1105 | Ga0207661_10007629 | |||
| 1106 | Ga0207661_10015648 | |||
| 1107 | Ga0207661_10019816 | |||
| 1108 | Ga0207661_10053877 | |||
| 1109 | Ga0207661_10093192 | |||
| 1110 | Ga0207679_10019679 | |||
| 1111 | Ga0207667_10085816 | |||
| 1112 | Ga0207651_10002542 | |||
| 1113 | Ga0207651_11199120 | |||
| 1114 | Ga0207712_10000032 | |||
| 1115 | Ga0207712_10022892 | |||
| 1116 | Ga0207712_10130419 | |||
| 1117 | Ga0207712_10837356 | |||
| 1118 | Ga0207668_10019909 | |||
| 1119 | Ga0207668_10329212 | |||
| 1120 | Ga0207640_10023521 | |||
| 1121 | Ga0207640_10050126 | |||
| 1122 | Ga0207658_10000465 | |||
| 1123 | Ga0207658_10128175 | |||
| 1124 | Ga0207658_10478357 | |||
| 1125 | Ga0207677_10004907 | |||
| 1126 | Ga0207677_10019802 | |||
| 1127 | Ga0207677_10718857 | |||
| 1128 | Ga0207703_10000020 | |||
| 1129 | Ga0207703_10000030 | |||
| 1130 | Ga0207703_10314861 | |||
| 1131 | Ga0207639_10065976 | |||
| 1132 | Ga0207678_10208008 | |||
| 1133 | Ga0207678_10475134 | |||
| 1134 | Ga0207678_10823248 | |||
| 1135 | Ga0207708_10146443 | |||
| 1136 | Ga0207708_10914166 | |||
| 1137 | Ga0207708_11595524 | |||
| 1138 | Ga0207702_10000690 | |||
| 1139 | Ga0207702_10009194 | |||
| 1140 | Ga0207702_10013026 | |||
| 1141 | Ga0207702_11803884 | |||
| 1142 | Ga0207641_10001193 | |||
| 1143 | Ga0207641_10001906 | |||
| 1144 | Ga0207641_10372784 | |||
| 1145 | Ga0207648_10008953 | |||
| 1146 | Ga0207676_10000042 | |||
| 1147 | Ga0207674_10084363 | |||
| 1148 | Ga0207675_100176938 | |||
| 1149 | Ga0207675_100615370 | |||
| 1150 | Ga0207675_101291602 | |||
| 1151 | Ga0207683_10018394 | |||
| 1152 | Ga0207683_10562157 | |||
| 1153 | Ga0207698_10000015 | |||
| 1154 | Ga0207698_10123198 | |||
| 1155 | Ga0209813_10051989 | |||
| 1156 | Ga0268266_10000029 | |||
| 1157 | Ga0268266_10000485 | |||
| 1158 | Ga0268266_10023699 | |||
| 1159 | Ga0268266_10263640 | |||
| 1160 | Ga0268266_10266381 | |||
| 1161 | Ga0268266_10705621 | |||
| 1162 | Ga0268265_10001048 | |||
| 1163 | Ga0268264_10000725 | |||
| 1164 | Ga0268264_10467006 | |||
| 1165 | Ga0268264_10924361 | |||
| 1166 | Ga0265337_1000061 | |||
| 1167 | Ga0265326_10000067 | |||
| 1168 | Ga0265319_1000010 | |||
| 1169 | Ga0265319_1072955 | |||
| 1170 | Ga0265322_10000005 | |||
| 1171 | Ga0265322_10147680 | |||
| 1172 | Ga0265336_10013428 | |||
| 1173 | Ga0265338_10000051 | |||
| 1174 | Ga0265338_10135291 | |||
| 1175 | Ga0265324_10000510 | |||
| 1176 | Ga0265320_10000010 | |||
| 1177 | Ga0265329_10004168 | |||
| 1178 | Ga0265340_10176445 | |||
| 1179 | Ga0265339_10100330 | |||
| 1180 | Ga0265331_10012002 | |||
| 1181 | Ga0265331_10223414 | |||
| 1182 | Ga0265327_10000040 | |||
| 1183 | Ga0265314_10000208 | |||
| 1184 | Ga0265342_10068433 | |||
| 1185 | Ga0316576_10578517 | |||
| 1186 | Ga0307416_102370189 | |||
| 1187 | Ga0307414_10056032 | |||
| 1188 | Ga0307415_100007274 | |||
| 1189 | Ga0373952_0219959 | |||
| 1190 | Ga0373953_0112095 | |||
| 1191 | Ga0373957_0067938 | |||
| 1192 | Ga0373955_0140108 | |||
| 1193 | Ga0316574_0016220 | |||
| 1194 | Ga0373937_0001667 | |||
| 1195 | Ga0373937_0128760 | |||
| 1196 | Ga0373937_1294158 | |||
| 1197 | Ga0316584_0028222 | |||
| 1198 | Ga0395899_0468773 | |||
| 1199 | Ga0395900_0111379 | |||
| 1200 | Ga0395900_0427642 | |||
| 1201 | Ga0395900_0938445 | |||
| 1202 | Ga0395898_0093219 | |||
| 1203 | Ga0395898_0668303 | |||
| 1204 | Ga0395898_0903357 | |||
| 1205 | Ga0395898_1107309 | |||
| 1206 | Ga0395905_0133939 | |||
| 1207 | Ga0395905_0623207 | |||
| 1208 | Ga0395905_1315366 | |||
| 1209 | Ga0395901_0247715 | |||
| 1210 | Ga0395901_1242601 | |||
| 1211 | Ga0395901_1748225 | |||
| 1212 | Ga0436365_0260549 | |||
| 1213 | Ga0451833_1155571 | |||
| 1214 | Ga0451835_1131163 | |||
| 1215 | Ga0451837_0395850 | |||
| 1216 | Ga0451837_1762875 | |||
| 1217 | Ga0451839_0099500 | |||
| 1218 | Ga0451843_1072820 | |||
| 1219 | Ga0451853_1692226 | |||
| 1220 | Ga0451853_2939721 | |||
| 1221 | Ga0466963_0000012 | |||
| 1222 | Ga0466963_0027043 | |||
| 1223 | Ga0466957_0278065 | |||
| 1224 | Ga0466957_0874469 | |||
| 1225 | Ga0466960_0664726 | |||
| 1226 | Ga0466958_0040450 | |||
| 1227 | Ga0466967_0000012 | |||
| 1228 | Ga0466967_0171823 | |||
| 1229 | Ga0495592_0000176 | |||
| 1230 | Ga0495592_0316566 | |||
| 1231 | Ga0495603_0000194 | |||
| 1232 | Ga0495603_0001410 | |||
| 1233 | Ga0495603_0013396 | |||
| 1234 | Ga0495629_0003392 | |||
| 1235 | Ga0495629_0011904 | |||
| 1236 | Ga0495629_0044313 | |||
| 1237 | Ga0495629_0062302 | |||
| 1238 | Ga0495629_0296397 | |||
| 1239 | Ga0495638_0016134 | |||
| 1240 | Ga0495641_0000004 | |||
| 1241 | Ga0495641_0006093 | |||
| 1242 | Ga0495641_0016127 | |||
| 1243 | Ga0495641_0024432 | |||
| 1244 | Ga0495641_0046814 | |||
| 1245 | Ga0495651_0022610 | |||
| 1246 | Ga0495651_0154592 | |||
| 1247 | Ga0495651_0496846 | |||
| 1248 | Ga0495653_0129657 | |||
| 1249 | Ga0495582_0000002 | |||
| 1250 | Ga0495639_0115584 | |||
| 1251 | Ga0495662_0000051 | |||
| 1252 | Ga0495662_0012354 | |||
| 1253 | Ga0495662_0108159 | |||
| 1254 | Ga0495662_0211315 | |||
| 1255 | Ga0495662_0559525 | |||
| 1256 | Ga0495664_0104877 | |||
| 1257 | Ga0495584_0377913 | |||
| 1258 | Ga0495584_0670679 | |||
| 1259 | Ga0495594_0000012 | |||
| 1260 | Ga0495594_0117509 | |||
| 1261 | Ga0495606_0000895 | |||
| 1262 | Ga0495608_0000013 | |||
| 1263 | Ga0495608_0000092 | |||
| 1264 | Ga0495608_0030777 | |||
| 1265 | Ga0495608_0090400 | |||
| 1266 | Ga0495618_0000094 | |||
| 1267 | Ga0495618_0561944 | |||
| 1268 | Ga0495620_0001177 | |||
| 1269 | Ga0495620_0110416 | |||
| 1270 | Ga0495628_0011464 | |||
| 1271 | Ga0495628_0173427 | |||
| 1272 | Ga0495628_0279023 | |||
| 1273 | Ga0495628_0283957 | |||
| 1274 | Ga0495628_0363418 | |||
| 1275 | Ga0495630_0000032 | |||
| 1276 | Ga0495630_0001088 | |||
| 1277 | Ga0495630_0005122 | |||
| 1278 | Ga0495630_0128742 | |||
| 1279 | Ga0495637_0059066 | |||
| 1280 | Ga0495637_0267690 | |||
| 1281 | Ga0495644_0006649 | |||
| 1282 | Ga0495642_0215545 | |||
| 1283 | Ga0495652_0000018 | |||
| 1284 | Ga0495652_0090220 | |||
| 1285 | Ga0495640_0032590 | |||
| 1286 | Ga0495640_0522300 | |||
| 1287 | Ga0495586_0003566 | |||
| 1288 | Ga0495586_0165578 | |||
| 1289 | Ga0495587_0033413 | |||
| 1290 | Ga0495587_0075611 | |||
| 1291 | Ga0495598_0001187 | |||
| 1292 | Ga0495621_0006180 | |||
| 1293 | Ga0495597_0307911 | |||
| 1294 | Ga0495645_0043713 | |||
| 1295 | Ga0495645_0062351 | |||
| 1296 | Ga0495645_0189460 | |||
| 1297 | Ga0495622_0000578 | |||
| 1298 | Ga0495667_0000265 | |||
| 1299 | Ga0495667_0030451 | |||
| 1300 | Ga0495656_0000429 | |||
| 1301 | Ga0495668_0094173 | |||
| 1302 | Ga0495634_0000002 | |||
| 1303 | Ga0495634_0000191 | |||
| 1304 | Ga0495634_0019259 | |||
| 1305 | Ga0495634_0137071 | |||
| 1306 | Ga0495625_0000243 | |||
| 1307 | Ga0495625_0243376 | |||
| 1308 | Ga0495635_0000182 | |||
| 1309 | Ga0495635_0004480 | |||
| 1310 | Ga0495588_0000266 | |||
| 1311 | Ga0495657_0000003 | |||
| 1312 | Ga0495657_0004649 | |||
| 1313 | Ga0495657_0192481 | |||
| 1314 | Ga0495599_0004118 | |||
| 1315 | Ga0495599_0270602 | |||
| 1316 | Ga0495647_0000005 | |||
| 1317 | Ga0495647_0034599 | |||
| 1318 | Ga0495647_0055281 | |||
| 1319 | Ga0495647_0230342 | |||
| 1320 | Ga0495658_0000001 | |||
| 1321 | Ga0495658_0031777 | |||
| 1322 | Ga0495658_0743171 | |||
| 1323 | Ga0495669_0000188 | |||
| 1324 | Ga0495669_0010344 | |||
| 1325 | Ga0495669_0273938 | |||
| 1326 | Ga0495613_0000132 | |||
| 1327 | Ga0495613_0000173 | |||
| 1328 | Ga0495613_0101242 | |||
| 1329 | Ga0495613_0304261 | |||
| 1330 | Ga0495624_0000343 | |||
| 1331 | Ga0495624_0000563 | |||
| 1332 | Ga0495624_0018984 | |||
| 1333 | Ga0495624_0420887 | |||
| 1334 | Ga0495670_0028796 | |||
| 1335 | Ga0495649_0007603 | |||
| 1336 | Ga0495600_0002279 | |||
| 1337 | Ga0495600_0043677 | |||
| 1338 | Ga0495600_0045484 | |||
| 1339 | Ga0495600_0214080 | |||
| 1340 | Ga0495604_0000437 | |||
| 1341 | Ga0495604_0006534 | |||
| 1342 | Ga0495604_0088714 | |||
| 1343 | Ga0495604_0550856 | |||
| 1344 | Ga0495674_0000039 | |||
| 1345 | Ga0495672_0139049 | |||
| 1346 | Ga0495676_0000320 | |||
| 1347 | Ga0495676_0008923 | |||
| 1348 | Ga0495676_0179551 | |||
| 1349 | Ga0495676_0330236 | |||
| 1350 | Ga0495676_0427247 | |||
| 1351 | Ga0495680_0000113 | |||
| 1352 | Ga0495680_0005366 | |||
| 1353 | Ga0495680_0017421 | |||
| 1354 | Ga0495680_0181853 | |||
| 1355 | Ga0495680_0879296 | |||
| 1356 | Ga0495675_0000094 | |||
| 1357 | Ga0495675_0166063 | |||
| 1358 | Ga0495679_029636 | |||
| 1359 | Ga0495673_0052087 | |||
| 1360 | Ga0495684_0080956 | |||
| 1361 | Ga0495686_0046915 | |||
| 1362 | Ga0495686_0066554 | |||
| 1363 | Ga0495593_0128513 | |||
| 1364 | Ga0495593_0128680 | |||
| 1365 | Ga0495593_0148503 | |||
| 1366 | Ga0495602_0000034 | |||
| 1367 | Ga0495602_0000315 | |||
| 1368 | Ga0495602_0061367 | |||
| 1369 | Ga0495602_0125208 | |||
| 1370 | Ga0495602_0217397 | |||
| 1371 | Ga0495602_0220088 | |||
| 1372 | Ga0495614_0065090 | |||
| 1373 | Ga0496100_0000001 | |||
| 1374 | Ga0496100_0000006 | |||
| 1375 | Ga0496100_0333654 | |||
| 1376 | Ga0496101_0000009 | |||
| 1377 | Ga0496101_0000028 | |||
| 1378 | Ga0496101_0055455 | |||
| 1379 | Ga0496101_0223187 | |||
| 1380 | Ga0496102_0000129 | |||
| 1381 | Ga0496102_0020642 | |||
| 1382 | Ga0496102_0175324 | |||
| 1383 | Ga0496102_0483774 | |||
| 1384 | Ga0496102_0522826 | |||
| 1385 | Ga0496102_0542868 | |||
| 1386 | Ga0496102_1039836 | |||
| 1387 | Ga0496103_0000087 | |||
| 1388 | Ga0496103_0256502 | |||
| 1389 | Ga0496103_0327220 | |||
| 1390 | Ga0496103_0551718 | |||
| 1391 | Ga0496104_0000008 | |||
| 1392 | Ga0496104_0000010 | |||
| 1393 | Ga0496104_0083908 | |||
| 1394 | Ga0496104_0134827 | |||
| 1395 | Ga0496104_0508878 | |||
| 1396 | Ga0496105_0000003 | |||
| 1397 | Ga0496105_0000005 | |||
| 1398 | Ga0496105_0000051 | |||
| 1399 | Ga0496105_0032204 | |||
| 1400 | Ga0496105_0166836 | |||
| 1401 | Ga0496105_1310310 | |||
| 1402 | Ga0496106_0000134 | |||
| 1403 | Ga0496106_0000172 | |||
| 1404 | Ga0496106_0001026 | |||
| 1405 | Ga0496107_0000002 | |||
| 1406 | Ga0496107_0000693 | |||
| 1407 | Ga0496107_0233966 | |||
| 1408 | Ga0496107_0462261 | |||
| 1409 | Ga0496108_0000004 | |||
| 1410 | Ga0496108_0000005 | |||
| 1411 | Ga0496108_0017216 | |||
| 1412 | Ga0496108_0018362 | |||
| 1413 | Ga0496108_0266037 | |||
| 1414 | Ga0496109_0000002 | |||
| 1415 | Ga0496109_0000011 | |||
| 1416 | Ga0496109_0000013 | |||
| 1417 | Ga0496109_0020187 | |||
| 1418 | Ga0496109_0059096 | |||
| 1419 | Ga0496109_0119258 | |||
| 1420 | Ga0496109_0138785 | |||
| 1421 | Ga0496110_0000185 | |||
| 1422 | Ga0496110_0001335 | |||
| 1423 | Ga0496110_0020346 | |||
| 1424 | Ga0496110_0238862 | |||
| 1425 | Ga0496110_0362617 | |||
| 1426 | Ga0496111_0000103 | |||
| 1427 | Ga0496111_0110728 | |||
| 1428 | Ga0496111_0280976 | |||
| 1429 | Ga0496112_0000026 | |||
| 1430 | Ga0496112_0000661 | |||
| 1431 | Ga0496113_0000017 | |||
| 1432 | Ga0496113_0003132 | |||
| 1433 | Ga0496113_0049089 | |||
| 1434 | Ga0496113_0294725 | |||
| 1435 | Ga0496113_0607987 | |||
| 1436 | Ga0496113_1353059 | |||
| 1437 | Ga0496114_0000003 | |||
| 1438 | Ga0496114_0060718 | |||
| 1439 | Ga0496114_0200298 | |||
| 1440 | Ga0496114_0550438 | |||
| 1441 | Ga0496114_0816191 | |||
| 1442 | Ga0496115_0000022 | |||
| 1443 | Ga0496115_0000408 | |||
| 1444 | Ga0496115_0004705 | |||
| 1445 | Ga0496116_0000120 | |||
| 1446 | Ga0496117_0012076 | |||
| 1447 | Ga0496117_0036667 | |||
| 1448 | Ga0496118_0011259 | |||
| 1449 | Ga0496118_0137880 | |||
| 1450 | Ga0496118_0442046 | |||
| 1451 | Ga0496119_0003116 | |||
| 1452 | Ga0496119_0015832 | |||
| 1453 | Ga0496119_0035054 | |||
| 1454 | Ga0496119_0071154 | |||
| 1455 | Ga0496119_0097267 | |||
| 1456 | Ga0496120_0004886 | |||
| 1457 | Ga0496120_0018303 | |||
| 1458 | Ga0496121_0021369 | |||
| 1459 | Ga0496121_0120743 | |||
| 1460 | Ga0496121_0402075 | |||
| 1461 | Ga0496124_0069439 | |||
| 1462 | Ga0496124_0131175 | |||
| 1463 | Ga0496125_0087036 | |||
| 1464 | Ga0496125_0111457 | |||
| 1465 | Ga0496125_0157503 | |||
| 1466 | Ga0496126_0156235 | |||
| 1467 | Ga0496126_0231107 | |||
| 1468 | Ga0501031_0000272 | |||
| 1469 | Ga0501032_0006867 | |||
| 1470 | Ga0501032_0268291 | |||
| 1471 | Ga0501033_0005400 | |||
| 1472 | Ga0501033_0461963 | |||
| 1473 | Ga0501034_0086802 | |||
| 1474 | Ga0501034_0098666 | |||
| 1475 | Ga0501034_0579231 | |||
| 1476 | Ga0501034_0619377 | |||
| 1477 | Ga0501036_0020224 | |||
| 1478 | Ga0501037_0007685 | |||
| 1479 | Ga0501038_0003846 | |||
| 1480 | Ga0501039_0024418 | |||
| 1481 | Ga0501039_0254123 | |||
| 1482 | Ga0501040_0204597 | |||
| 1483 | Ga0501040_0604487 | |||
| 1484 | Ga0501041_0172223 | |||
| 1485 | Ga0501041_0327998 | |||
| 1486 | Ga0501042_0029788 | |||
| 1487 | Ga0501042_0077376 | |||
| 1488 | Ga0501042_0552625 | |||
| 1489 | Ga0501043_0003675 | |||
| 1490 | Ga0501043_0355156 | |||
| 1491 | Ga0501043_0419878 | |||
| 1492 | Ga0501046_0004234 | |||
| 1493 | Ga0501046_0531382 | |||
| 1494 | Ga0501047_0010785 | |||
| 1495 | Ga0501047_0020697 | |||
| 1496 | Ga0501047_0034306 | |||
| 1497 | Ga0501047_0103855 | |||
| 1498 | Ga0501047_0427558 | |||
| 1499 | Ga0501048_0002902 | |||
| 1500 | Ga0501048_0131896 | |||
| 1501 | Ga0501067_0043920 | |||
| 1502 | Ga0501067_0100998 | |||
| 1503 | Ga0501068_0052708 | |||
| 1504 | Ga0501068_0736997 | |||
| 1505 | Ga0501069_0018241 | |||
| 1506 | Ga0501069_0029324 | |||
| 1507 | Ga0501070_0000603 | |||
| 1508 | Ga0501070_0008116 | |||
| 1509 | Ga0501070_0047875 | |||
| 1510 | Ga0501070_0186013 | |||
| 1511 | Ga0501070_0491534 | |||
| 1512 | Ga0501071_0006824 | |||
| 1513 | Ga0501071_0124051 | |||
| 1514 | Ga0501071_0408925 | |||
| 1515 | Ga0501072_0491866 | |||
| 1516 | Ga0501072_0936519 | |||
| 1517 | Ga0501073_0006764 | |||
| 1518 | Ga0501074_0021047 | |||
| 1519 | Ga0501074_0152252 | |||
| 1520 | Ga0501074_0221459 | |||
| 1521 | Ga0501074_0256613 | |||
| 1522 | Ga0501075_0028192 | |||
| 1523 | Ga0501075_0219755 | |||
| 1524 | Ga0501075_0743323 | |||
| 1525 | Ga0501076_0227517 | |||
| 1526 | Ga0501076_1410805 | |||
| 1527 | Ga0501077_0142241 | |||
| 1528 | Ga0501079_0043646 | |||
| 1529 | Ga0501079_0166559 | |||
| 1530 | Ga0501079_0578485 | |||
| 1531 | Ga0501080_0008650 | |||
| 1532 | Ga0501080_0715709 | |||
| 1533 | Ga0501080_1131260 | |||
| 1534 | Ga0501081_0019459 | |||
| 1535 | Ga0501081_0279061 | |||
| 1536 | Ga0501083_0005984 | |||
| 1537 | Ga0501083_0053390 | |||
| 1538 | Ga0501035_0004600 | |||
| 1539 | Ga0501035_0241278 | |||
| 1540 | Ga0501044_0003139 | |||
| 1541 | Ga0501044_0085790 | |||
| 1542 | Ga0501044_0103325 | |||
| 1543 | Ga0501044_0693539 | |||
| 1544 | Ga0501044_0809796 | |||
| 1545 | Ga0501045_0032626 | |||
| 1546 | Ga0501045_0653861 | |||
| 1547 | Ga0501045_0746873 | |||
| 1548 | nmdc:mga03n38_970_c1 | |||
| 1549 | nmdc:mga00v17_154339_c1 | |||
| 1550 | nmdc:mga00v17_243411_c1 | |||
| 1551 | nmdc:mga00v17_407706_c1 | |||
| 1552 | nmdc:mga00v17_54224_c1 | |||
| 1553 | nmdc:mga00v17_948473_c1 | |||
| 1554 | nmdc:mga0yw44_154221_c1 | |||
| 1555 | nmdc:mga0yw44_164821_c1 | |||
| 1556 | nmdc:mga0yw44_187368_c1 | |||
| 1557 | nmdc:mga0yw44_271335_c1 | |||
| 1558 | nmdc:mga0yw44_488217_c1 | |||
| 1559 | nmdc:mga06z11_105634_c1 | |||
| 1560 | nmdc:mga06z11_504253_c1 | |||
| 1561 | nmdc:mga04h51_77443_c1 | |||
| 1562 | nmdc:mga07m45_143190_c1 | |||
| 1563 | nmdc:mga0qj67_22501_c1 | |||
| 1564 | nmdc:mga0qj67_48756_c1 | |||
| 1565 | nmdc:mga06r32_105494_c1 | |||
| 1566 | nmdc:mga08y16_1091760_c1 | |||
| 1567 | nmdc:mga08y16_1149155_c1 | |||
| 1568 | nmdc:mga0n895_378498_c1 | |||
| 1569 | nmdc:mga0a205_281_c1 | |||
| 1570 | nmdc:mga0a205_4_c1 | |||
| 1571 | Ga0495601_0000029 | |||
| 1572 | Ga0495601_0000402 | |||
| 1573 | Ga0495601_0008993 | |||
| 1574 | Ga0495601_0028131 | |||
| 1575 | Ga0495601_0031656 | |||
| 1576 | Ga0495601_0059271 | |||
| 1577 | Ga0495601_0264115 | |||
| 1578 | Ga0495601_0715395 | |||
| 1579 | Ga0495601_0856117 | |||
| 1580 | Ga0495612_0001859 | |||
| 1581 | Ga0495612_0004880 | |||
| 1582 | Ga0495612_0013167 | |||
| 1583 | Ga0495612_0064862 | |||
| 1584 | Ga0495612_0107645 | |||
| 1585 | Ga0495655_0000010 | |||
| 1586 | Ga0495655_0076293 | |||
| 1587 | Ga0495595_0000007 | |||
| 1588 | Ga0495595_0000547 | |||
| 1589 | Ga0495595_0071534 | |||
| 1590 | Ga0495595_0123199 | |||
| 1591 | Ga0495595_0182647 | |||
| 1592 | Ga0495595_0221538 | |||
| 1593 | Ga0495619_0000001 | |||
| 1594 | Ga0495619_0000026 | |||
| 1595 | Ga0495619_0000067 | |||
| 1596 | Ga0495619_0000205 | |||
| 1597 | Ga0495619_0003901 | |||
| 1598 | Ga0495619_0013008 | |||
| 1599 | Ga0495619_0193154 | |||
| 1600 | Ga0495619_0431923 | |||
| 1601 | Ga0495619_0441473 | |||
| 1602 | Ga0500566_0001360 | |||
| 1603 | Ga0500641_0007415 | |||
| 1604 | Ga0500614_000636 | |||
| 1605 | Ga0500628_000024 | |||
| 1606 | Ga0500658_0015480 | |||
| 1607 | Ga0501084_0425072 | |||
| 1608 | Ga0501084_0774127 | |||
| 1609 | Ga0501082_0035316 | |||
| 1610 | Ga0501082_0391434 | |||
| 1611 | Ga0501082_1656984 | |||
| 1612 | Ga0530510_0456008 | |||
| 1613 | Ga0530510_0536454 | |||
| 1614 | Ga0530510_1212210 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5yhx-assembly1.cif.gz_B | structure of lactococcus lactis zitr, wild type | 0.9285 | 9 | 67 |
| 1u2w-assembly1.cif.gz_A | crystal structure of the staphylococcus aureus pi258 cadc | 0.9235 | 8 | 69 |
| 3f72-assembly1.cif.gz_A | crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant | 0.9087 | 8 | 69 |
| 5zuo-assembly1.cif.gz_A | crystal structure of bz junction in diverse sequence | 0.9083 | 26 | 69 |
| 1u2w-assembly2.cif.gz_C | crystal structure of the staphylococcus aureus pi258 cadc | 0.9037 | 8 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5zuoA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9083 | 26 | 69 | 1.10.10.10 |
| 1u2wC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9037 | 8 | 69 | 1.10.10.10 |
| 3irqD00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9021 | 9 | 69 | 1.10.10.10 |
| af_P16528_22_97_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8982 | 6 | 67 | 1.10.10.10 |
| 1r22A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8958 | 11 | 69 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V0SFP9-F1-model_v4 | Rrf2 family transcriptional regulator | 0.8374 | 3 | 150 |
GO:0003700
GO:0005829 |
| AF-A0A1V1RH70-F1-model_v4 | Predicted transcriptional regulator | 0.8365 | 1 | 147 |
GO:0003700
GO:0005829 |
| AF-A0A839HIA9-F1-model_v4 | Rrf2 family transcriptional regulator | 0.8364 | 1 | 143 |
GO:0003700
GO:0005829 |
| AF-B9M872-F1-model_v4 | Helix-turn-helix iron-sulfur cluster-binding transcriptional regulator IscR | 0.836 | 1 | 147 |
GO:0003700
GO:0005829 |
| AF-A0A0G0R5Z9-F1-model_v4 | Rrf2 family transcriptional regulator | 0.835 | 1 | 139 |
GO:0003700
GO:0005829 |