F481697

General Info

Members Datasets Scaffolds Average Seq Length
807 279 1614 241

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0115846|Ga0501041_0115846_605_1495
Length 296
Sequence MWRSPARAGARAGGDGVDGPADAASFNKDVAITGASGRERWQAMGVGPHRKTKKKKKALMRFSIVVFPGSNCDHDAYHAARHVFGQDAQFVWHKETSLRGADVVILPGGFSHGDYLRTGAIARFSPIMQAVAEFAGAGGPVLGICNGFQILLEAGLLTGAMLRNRDLKFHCEHVYVRVEQLDTPFTLGASQGQILRLPIAHGEGNYFADPDVIAALEAAGRVVFRYCDPQGNTTDAANPNGSVNNIAGICNEGRNVVGLMPHPERACESALGSADGRILFESVVGALAGGGALKSA

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
184 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 3.59
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0115846 3300049577 Bacteria 1664
2 SwRhRL3b_contig_2096142 2162886006 Bacteria 1175
3 Ga0058860_11732355 3300004801 Bacteria 1182
4 Ga0065704_10003571 3300005289 Bacteria 7027
5 Ga0065712_10070028 3300005290 Bacteria 6393
6 Ga0065712_10096935 3300005290 Bacteria 2167
7 Ga0065712_10191650 3300005290 Bacteria 1146
8 Ga0065715_10200621 3300005293 Bacteria 1354
9 Ga0065715_10216017 3300005293 Bacteria 1292
10 Ga0065715_10238261 3300005293 Bacteria 1177
11 Ga0065715_10267993 3300005293 Bacteria 1119
12 Ga0065707_10001707 3300005295 Bacteria 14512
13 Ga0065707_10003508 3300005295 Bacteria 9159
14 Ga0065707_10139828 3300005295 Bacteria 1788
15 Ga0065707_10156187 3300005295 Bacteria 1606
16 Ga0065707_10162674 3300005295 Bacteria 1549
17 Ga0070676_10056420 3300005328 Bacteria 2321
18 Ga0070676_10088149 3300005328 Bacteria 1895
19 Ga0070683_100000219 3300005329 Bacteria 39225
20 Ga0070690_100007154 3300005330 Bacteria 6380
21 Ga0070690_100055635 3300005330 Bacteria 2535
22 Ga0070690_100088017 3300005330 Bacteria 2041
23 Ga0070670_100026520 3300005331 Bacteria 4985
24 Ga0070670_100032955 3300005331 Bacteria 4465
25 Ga0070670_100062782 3300005331 Bacteria 3188
26 Ga0070670_100246111 3300005331 Bacteria 1557
27 Ga0070670_100310331 3300005331 Bacteria 1381
28 Ga0070670_100980115 3300005331 Bacteria 768
29 Ga0070677_10004723 3300005333 Bacteria 4462
30 Ga0068869_100011545 3300005334 Bacteria 5798
31 Ga0070680_100120388 3300005336 Bacteria 2191
32 Ga0070680_100257781 3300005336 Bacteria 1475
33 Ga0070680_100778673 3300005336 Bacteria 824
34 Ga0070682_100070462 3300005337 Bacteria 2235
35 Ga0070660_100005652 3300005339 Bacteria 8664
36 Ga0070689_100025044 3300005340 Bacteria 4480
37 Ga0070689_100070263 3300005340 Bacteria 2733
38 Ga0070689_100074687 3300005340 Bacteria 2652
39 Ga0070689_100218139 3300005340 Bacteria 1564
40 Ga0070689_100290166 3300005340 Bacteria 1359
41 Ga0070687_100051857 3300005343 Bacteria 2127
42 Ga0070687_100318248 3300005343 Bacteria 993
43 Ga0070661_100022189 3300005344 Bacteria 4543
44 Ga0070661_100049377 3300005344 Bacteria 3080
45 Ga0070661_100159899 3300005344 Bacteria 1706
46 Ga0070661_100207398 3300005344 Bacteria 1499
47 Ga0070661_100376908 3300005344 Bacteria 1118
48 Ga0070669_100001384 3300005353 Bacteria 17486
49 Ga0070669_100001575 3300005353 Bacteria 16532
50 Ga0070669_100020512 3300005353 Bacteria 4720
51 Ga0070669_100062176 3300005353 Bacteria 2745
52 Ga0070669_100226020 3300005353 Bacteria 1481
53 Ga0070669_100231832 3300005353 Bacteria 1464
54 Ga0070675_100001786 3300005354 Bacteria 15871
55 Ga0070675_100022847 3300005354 Bacteria 4997
56 Ga0070675_100041014 3300005354 Bacteria 3780
57 Ga0070675_100090384 3300005354 Bacteria 2564
58 Ga0070675_100112127 3300005354 Bacteria 2309
59 Ga0070675_100137995 3300005354 Bacteria 2082
60 Ga0070675_100153416 3300005354 Bacteria 1976
61 Ga0070675_100215860 3300005354 Bacteria 1669
62 Ga0070675_100777534 3300005354 Bacteria 874
63 Ga0070671_100111027 3300005355 Bacteria 2303
64 Ga0070671_100270235 3300005355 Bacteria 1445
65 Ga0070674_100064679 3300005356 Bacteria 2564
66 Ga0070674_100085039 3300005356 Bacteria 2269
67 Ga0070673_100033368 3300005364 Bacteria 3886
68 Ga0070673_100356397 3300005364 Bacteria 1299
69 Ga0070673_100617415 3300005364 Bacteria 990
70 Ga0070688_100004923 3300005365 Bacteria 6989
71 Ga0070688_100030030 3300005365 Bacteria 3259
72 Ga0070688_100190303 3300005365 Bacteria 1429
73 Ga0070659_100099115 3300005366 Bacteria 2344
74 Ga0070667_100219942 3300005367 Bacteria 1690
75 Ga0070667_100544282 3300005367 Bacteria 1067
76 Ga0070667_100627280 3300005367 Bacteria 991
77 Ga0070703_10044366 3300005406 Bacteria 1398
78 Ga0070713_100029654 3300005436 Bacteria 4335
79 Ga0070701_10033165 3300005438 Bacteria 2578
80 Ga0070711_100045568 3300005439 Bacteria 2984
81 Ga0070705_100027724 3300005440 Bacteria 3095
82 Ga0070705_100334776 3300005440 Bacteria 1098
83 Ga0070705_100417183 3300005440 Bacteria 998
84 Ga0070700_100015174 3300005441 Bacteria 4363
85 Ga0070700_100128452 3300005441 Bacteria 1707
86 Ga0070700_100146332 3300005441 Bacteria 1611
87 Ga0070694_100000985 3300005444 Bacteria 16182
88 Ga0070708_100581655 3300005445 Bacteria 1056
89 Ga0070663_100039054 3300005455 Bacteria 3315
90 Ga0070663_100062387 3300005455 Bacteria 2687
91 Ga0070678_100121438 3300005456 Bacteria 2061
92 Ga0070678_100137927 3300005456 Bacteria 1948
93 Ga0070678_100380781 3300005456 Bacteria 1221
94 Ga0070662_100074043 3300005457 Bacteria 2518
95 Ga0070662_100182029 3300005457 Bacteria 1657
96 Ga0070662_100393743 3300005457 Bacteria 1142
97 Ga0070681_10008780 3300005458 Bacteria 9920
98 Ga0068867_100028157 3300005459 Bacteria 4043
99 Ga0070685_10003231 3300005466 Bacteria 8287
100 Ga0070685_10069650 3300005466 Bacteria 2081
101 Ga0070706_100617310 3300005467 Bacteria 1007
102 Ga0070707_100053047 3300005468 Bacteria 3887
103 Ga0070707_100383146 3300005468 Bacteria 1366
104 Ga0070698_100037087 3300005471 Bacteria 5028
105 Ga0070699_100007194 3300005518 Bacteria 9677
106 Ga0070699_100045188 3300005518 Bacteria 3812
107 Ga0070679_100002755 3300005530 Bacteria 15989
108 Ga0070679_100081474 3300005530 Bacteria 3226
109 Ga0070684_100657685 3300005535 Bacteria 976
110 Ga0070697_100093809 3300005536 Bacteria 2486
111 Ga0070697_100333489 3300005536 Bacteria 1308
112 Ga0070672_100011209 3300005543 Bacteria 6249
113 Ga0070672_100080730 3300005543 Bacteria 2606
114 Ga0070672_100110542 3300005543 Bacteria 2239
115 Ga0070672_100257890 3300005543 Bacteria 1470
116 Ga0070672_100266435 3300005543 Bacteria 1446
117 Ga0070672_100403643 3300005543 Bacteria 1172
118 Ga0070672_100817561 3300005543 Bacteria 820
119 Ga0070686_100002510 3300005544 Bacteria 10107
120 Ga0070686_100024933 3300005544 Bacteria 3590
121 Ga0070686_100499184 3300005544 Bacteria 944
122 Ga0070695_100251811 3300005545 Bacteria 1286
123 Ga0070696_100021526 3300005546 Bacteria 4372
124 Ga0070696_100088674 3300005546 Bacteria 2199
125 Ga0070696_100480554 3300005546 Bacteria 985
126 Ga0070696_100566631 3300005546 Bacteria 912
127 Ga0070693_100022554 3300005547 Bacteria 3350
128 Ga0070665_100043919 3300005548 Bacteria 4489
129 Ga0070665_100068450 3300005548 Bacteria 3559
130 Ga0070704_100001815 3300005549 Bacteria 11745
131 Ga0070704_100022315 3300005549 Bacteria 4118
132 Ga0070704_100314251 3300005549 Bacteria 1310
133 Ga0070704_100487129 3300005549 Bacteria 1068
134 Ga0068855_100029977 3300005563 Bacteria 6506
135 Ga0068855_100286111 3300005563 Bacteria 1829
136 Ga0068855_100350299 3300005563 Bacteria 1627
137 Ga0070664_100000947 3300005564 Bacteria 22695
138 Ga0070664_100034410 3300005564 Bacteria 4250
139 Ga0070664_100041156 3300005564 Bacteria 3898
140 Ga0070664_100042474 3300005564 Bacteria 3837
141 Ga0070664_100087200 3300005564 Bacteria 2698
142 Ga0070664_100229341 3300005564 Bacteria 1664
143 Ga0070664_100316588 3300005564 Bacteria 1413
144 Ga0070664_100436219 3300005564 Bacteria 1201
145 Ga0068857_100007177 3300005577 Bacteria 9597
146 Ga0068857_100022203 3300005577 Bacteria 5583
147 Ga0068857_100164336 3300005577 Bacteria 2015
148 Ga0068852_100419202 3300005616 Bacteria 1320
149 Ga0068859_100006829 3300005617 Bacteria 11595
150 Ga0068859_100016560 3300005617 Bacteria 7401
151 Ga0068859_100028948 3300005617 Bacteria 5557
152 Ga0068859_100091815 3300005617 Bacteria 3087
153 Ga0068859_100280547 3300005617 Bacteria 1759
154 Ga0068859_100459184 3300005617 Bacteria 1370
155 Ga0068859_100579223 3300005617 Bacteria 1216
156 Ga0068864_100021393 3300005618 Bacteria 5420
157 Ga0068864_100163472 3300005618 Bacteria 2025
158 Ga0068864_100216445 3300005618 Bacteria 1766
159 Ga0068864_100443110 3300005618 Bacteria 1241
160 Ga0068861_100004267 3300005719 Bacteria 9580
161 Ga0068861_100013918 3300005719 Bacteria 5639
162 Ga0068861_100186681 3300005719 Bacteria 1729
163 Ga0068861_100219837 3300005719 Bacteria 1605
164 Ga0068861_100225561 3300005719 Bacteria 1586
165 Ga0068861_100261863 3300005719 Bacteria 1481
166 Ga0068861_100331899 3300005719 Bacteria 1328
167 Ga0068861_100410220 3300005719 Bacteria 1204
168 Ga0068851_10118393 3300005834 Bacteria 1421
169 Ga0068870_10001156 3300005840 Bacteria 10558
170 Ga0068870_10013375 3300005840 Bacteria 3856
171 Ga0068870_10022064 3300005840 Bacteria 3125
172 Ga0068870_10543709 3300005840 Bacteria 781
173 Ga0068863_100007812 3300005841 Bacteria 10461
174 Ga0068863_100028438 3300005841 Bacteria 5338
175 Ga0068863_100334343 3300005841 Bacteria 1473
176 Ga0068858_100054807 3300005842 Bacteria 3687
177 Ga0068858_100115932 3300005842 Bacteria 2504
178 Ga0068858_100159218 3300005842 Bacteria 2125
179 Ga0068858_100457909 3300005842 Bacteria 1230
180 Ga0068860_100011127 3300005843 Bacteria 8864
181 Ga0068860_100051679 3300005843 Bacteria 3909
182 Ga0068860_100154522 3300005843 Bacteria 2211
183 Ga0068860_100161327 3300005843 Bacteria 2162
184 Ga0068862_100001245 3300005844 Bacteria 23977
185 Ga0068862_100008739 3300005844 Bacteria 8385
186 Ga0068862_100396003 3300005844 Bacteria 1291
187 Ga0068862_100424939 3300005844 Bacteria 1248
188 Ga0068862_100518515 3300005844 Bacteria 1134
189 Ga0068862_100602943 3300005844 Bacteria 1054
190 Ga0081455_10000672 3300005937 Bacteria 44265
191 Ga0081539_10004766 3300005985 Bacteria 14646
192 Ga0075363_100033864 3300006048 Bacteria 2664
193 Ga0075363_100081325 3300006048 Bacteria 1772
194 Ga0075364_10065899 3300006051 Bacteria 2378
195 Ga0075364_10141989 3300006051 Bacteria 1616
196 Ga0070712_100111218 3300006175 Bacteria 2044
197 Ga0075367_10005400 3300006178 Bacteria 6340
198 Ga0075367_10058052 3300006178 Bacteria 2302
199 Ga0075367_10363773 3300006178 Bacteria 913
200 Ga0075366_10013666 3300006195 Bacteria 4628
201 Ga0075366_10219234 3300006195 Bacteria 1159
202 Ga0075370_10072264 3300006353 Bacteria 1974
203 Ga0075370_10112496 3300006353 Bacteria 1581
204 Ga0075370_10361837 3300006353 Bacteria 867
205 Ga0068871_100041179 3300006358 Bacteria 3702
206 Ga0068871_100056540 3300006358 Bacteria 3190
207 Ga0068871_100199090 3300006358 Bacteria 1728
208 Ga0068871_100305200 3300006358 Bacteria 1398
209 Ga0075428_100000034 3300006844 Bacteria 115982
210 Ga0075428_100002264 3300006844 Bacteria 20843
211 Ga0075428_100004848 3300006844 Bacteria 14927
212 Ga0075428_100006623 3300006844 Bacteria 12884
213 Ga0075428_100008825 3300006844 Bacteria 11185
214 Ga0075428_100017352 3300006844 Bacteria 7956
215 Ga0075428_100046429 3300006844 Bacteria 4771
216 Ga0075428_100080240 3300006844 Bacteria 3561
217 Ga0075428_100084388 3300006844 Bacteria 3466
218 Ga0075428_100121925 3300006844 Bacteria 2839
219 Ga0075428_100282201 3300006844 Bacteria 1787
220 Ga0075428_100316295 3300006844 Bacteria 1678
221 Ga0075428_100433157 3300006844 Bacteria 1409
222 Ga0075430_100003140 3300006846 Bacteria 13820
223 Ga0075430_100003359 3300006846 Bacteria 13407
224 Ga0075430_100010550 3300006846 Bacteria 7821
225 Ga0075430_100012162 3300006846 Bacteria 7327
226 Ga0075430_100032343 3300006846 Bacteria 4440
227 Ga0075430_100034125 3300006846 Bacteria 4318
228 Ga0075430_100112382 3300006846 Bacteria 2271
229 Ga0075430_100220101 3300006846 Bacteria 1575
230 Ga0075430_100337137 3300006846 Bacteria 1246
231 Ga0075431_100002079 3300006847 Bacteria 19113
232 Ga0075431_100004561 3300006847 Bacteria 13608
233 Ga0075431_100010145 3300006847 Bacteria 9468
234 Ga0075431_100010433 3300006847 Bacteria 9338
235 Ga0075431_100010884 3300006847 Bacteria 9151
236 Ga0075431_100014106 3300006847 Bacteria 8075
237 Ga0075431_100020338 3300006847 Bacteria 6781
238 Ga0075431_100092168 3300006847 Bacteria 3127
239 Ga0075431_100178824 3300006847 Bacteria 2178
240 Ga0075431_100345765 3300006847 Bacteria 1496
241 Ga0075431_100364581 3300006847 Bacteria 1451
242 Ga0075433_10008408 3300006852 Bacteria 8235
243 Ga0075433_10010379 3300006852 Bacteria 7471
244 Ga0075433_10036851 3300006852 Bacteria 4216
245 Ga0075433_10071623 3300006852 Bacteria 3047
246 Ga0075433_10162556 3300006852 Bacteria 1987
247 Ga0075433_10212763 3300006852 Bacteria 1718
248 Ga0075433_10258322 3300006852 Bacteria 1545
249 Ga0075434_100002376 3300006871 Bacteria 16511
250 Ga0075434_100029389 3300006871 Bacteria 5407
251 Ga0075434_100089532 3300006871 Bacteria 3079
252 Ga0075434_100215002 3300006871 Bacteria 1942
253 Ga0075434_100261096 3300006871 Bacteria 1751
254 Ga0075434_100337789 3300006871 Bacteria 1527
255 Ga0075434_100349165 3300006871 Bacteria 1500
256 Ga0075434_100380633 3300006871 Bacteria 1432
257 Ga0075429_100009166 3300006880 Bacteria 8593
258 Ga0075429_100009170 3300006880 Bacteria 8591
259 Ga0075429_100018133 3300006880 Bacteria 6091
260 Ga0075429_100089133 3300006880 Bacteria 2689
261 Ga0075429_100091030 3300006880 Bacteria 2661
262 Ga0075429_100107157 3300006880 Bacteria 2442
263 Ga0075429_100150328 3300006880 Bacteria 2039
264 Ga0075429_100394452 3300006880 Bacteria 1212
265 Ga0068865_100056843 3300006881 Bacteria 2727
266 Ga0068865_100718020 3300006881 Bacteria 856
267 Ga0075436_100084069 3300006914 Bacteria 2209
268 Ga0097620_100006830 3300006931 Bacteria 11595
269 Ga0097620_100016560 3300006931 Bacteria 7401
270 Ga0097620_100028948 3300006931 Bacteria 5557
271 Ga0097620_100076720 3300006931 Bacteria 3382
272 Ga0097620_100091822 3300006931 Bacteria 3087
273 Ga0097620_100280536 3300006931 Bacteria 1759
274 Ga0097620_100459206 3300006931 Bacteria 1370
275 Ga0097620_100579282 3300006931 Bacteria 1216
276 Ga0075435_100052995 3300007076 Bacteria 3270
277 Ga0075435_100102114 3300007076 Bacteria 2377
278 Ga0075435_100269528 3300007076 Bacteria 1452
279 Ga0075435_100316285 3300007076 Bacteria 1336
280 Ga0075435_100406889 3300007076 Bacteria 1171
281 Ga0105240_10143262 3300009093 Bacteria 2855
282 Ga0111539_10000014 3300009094 Bacteria 307501
283 Ga0111539_10000341 3300009094 Bacteria 57424
284 Ga0111539_10001145 3300009094 Bacteria 35041
285 Ga0111539_10003597 3300009094 Bacteria 20432
286 Ga0111539_10004093 3300009094 Bacteria 19136
287 Ga0111539_10004361 3300009094 Bacteria 18532
288 Ga0111539_10004579 3300009094 Bacteria 18071
289 Ga0111539_10016401 3300009094 Bacteria 9187
290 Ga0111539_10021320 3300009094 Bacteria 7977
291 Ga0111539_10039361 3300009094 Bacteria 5700
292 Ga0111539_10066895 3300009094 Bacteria 4245
293 Ga0111539_10084294 3300009094 Bacteria 3737
294 Ga0111539_10119177 3300009094 Bacteria 3093
295 Ga0111539_10126147 3300009094 Bacteria 2999
296 Ga0111539_10135215 3300009094 Bacteria 2887
297 Ga0111539_10145366 3300009094 Bacteria 2776
298 Ga0111539_10447258 3300009094 Bacteria 1504
299 Ga0111539_10456834 3300009094 Bacteria 1487
300 Ga0111539_10560196 3300009094 Bacteria 1331
301 Ga0111539_10591806 3300009094 Bacteria 1292
302 Ga0111539_10834836 3300009094 Bacteria 1072
303 Ga0105245_10056052 3300009098 Bacteria 3541
304 Ga0105245_10190406 3300009098 Bacteria 1964
305 Ga0105247_10055318 3300009101 Bacteria 2449
306 Ga0105247_10079100 3300009101 Bacteria 2069
307 Ga0114129_10004149 3300009147 Bacteria 20479
308 Ga0114129_10004836 3300009147 Bacteria 19019
309 Ga0114129_10013593 3300009147 Bacteria 11600
310 Ga0114129_10013844 3300009147 Bacteria 11491
311 Ga0114129_10014211 3300009147 Bacteria 11343
312 Ga0114129_10015466 3300009147 Bacteria 10852
313 Ga0114129_10039384 3300009147 Bacteria 6663
314 Ga0114129_10049999 3300009147 Bacteria 5873
315 Ga0114129_10055510 3300009147 Bacteria 5551
316 Ga0114129_10062539 3300009147 Bacteria 5200
317 Ga0114129_10062547 3300009147 Bacteria 5199
318 Ga0114129_10071656 3300009147 Bacteria 4832
319 Ga0114129_10079330 3300009147 Bacteria 4565
320 Ga0114129_10121405 3300009147 Bacteria 3596
321 Ga0114129_10181224 3300009147 Bacteria 2865
322 Ga0114129_10834005 3300009147 Bacteria 1173
323 Ga0105243_10018156 3300009148 Bacteria 5324
324 Ga0105243_10363280 3300009148 Bacteria 1333
325 Ga0105248_10020327 3300009177 Bacteria 7356
326 Ga0105248_10108698 3300009177 Bacteria 3127
327 Ga0105248_10138862 3300009177 Bacteria 2741
328 Ga0105248_10173497 3300009177 Bacteria 2430
329 Ga0105248_10285486 3300009177 Bacteria 1858
330 Ga0105248_10325824 3300009177 Bacteria 1730
331 Ga0105248_10368359 3300009177 Bacteria 1617
332 Ga0105248_10648850 3300009177 Bacteria 1191
333 Ga0105249_10003903 3300009553 Bacteria 12883
334 Ga0105249_10013952 3300009553 Bacteria 7101
335 Ga0105249_10023358 3300009553 Bacteria 5548
336 Ga0105249_10024570 3300009553 Bacteria 5416
337 Ga0105249_10782234 3300009553 Bacteria 1018
338 Ga0099796_10198106 3300010159 Bacteria 813
339 Ga0105246_10147973 3300011119 Bacteria 1774
340 Ga0105246_10220687 3300011119 Bacteria 1486
341 Ga0157378_10313373 3300013297 Bacteria 1522
342 Ga0163162_10011253 3300013306 Bacteria 8722
343 Ga0157375_10006606 3300013308 Bacteria 10093
344 Ga0157375_10026999 3300013308 Bacteria 5360
345 Ga0157375_10320032 3300013308 Bacteria 1716
346 Ga0157375_10849102 3300013308 Bacteria 1060
347 Ga0157375_11084724 3300013308 Bacteria 937
348 Ga0157375_11418999 3300013308 Bacteria 818
349 Ga0163163_10000042 3300014325 Bacteria 138794
350 Ga0163163_10186786 3300014325 Bacteria 2120
351 Ga0157380_10005069 3300014326 Bacteria 9197
352 Ga0157380_10007356 3300014326 Bacteria 7819
353 Ga0157380_10313991 3300014326 Bacteria 1450
354 Ga0157380_10356635 3300014326 Bacteria 1370
355 Ga0157380_10691547 3300014326 Bacteria 1023
356 Ga0157380_10951709 3300014326 Bacteria 889
357 Ga0157377_10002737 3300014745 Bacteria 7846
358 Ga0157377_10022587 3300014745 Bacteria 3324
359 Ga0157377_10106503 3300014745 Bacteria 1679
360 Ga0157377_10120945 3300014745 Bacteria 1587
361 Ga0157377_10158123 3300014745 Bacteria 1407
362 Ga0157377_10200149 3300014745 Bacteria 1268
363 Ga0157379_10001584 3300014968 Bacteria 18746
364 Ga0157379_10046248 3300014968 Bacteria 3883
365 Ga0157376_10136315 3300014969 Bacteria 2197
366 Ga0157376_10331893 3300014969 Bacteria 1449
367 Ga0163161_10077554 3300017792 Bacteria 2441
368 Ga0163161_10135769 3300017792 Bacteria 1859
369 Ga0207697_10000997 3300025315 Bacteria 15845
370 Ga0207697_10001552 3300025315 Bacteria 12423
371 Ga0207682_10001467 3300025893 Bacteria 10892
372 Ga0207682_10056829 3300025893 Bacteria 1630
373 Ga0207710_10031208 3300025900 Bacteria 2329
374 Ga0207688_10000974 3300025901 Bacteria 14585
375 Ga0207688_10021946 3300025901 Bacteria 3491
376 Ga0207688_10103981 3300025901 Bacteria 1643
377 Ga0207647_10254515 3300025904 Bacteria 1006
378 Ga0207645_10001735 3300025907 Bacteria 17671
379 Ga0207645_10065953 3300025907 Bacteria 2314
380 Ga0207643_10005361 3300025908 Bacteria 6863
381 Ga0207643_10026083 3300025908 Bacteria 3234
382 Ga0207643_10033375 3300025908 Bacteria 2879
383 Ga0207643_10043514 3300025908 Bacteria 2534
384 Ga0207684_10775256 3300025910 Bacteria 812
385 Ga0207695_10295392 3300025913 Bacteria 1512
386 Ga0207693_10514746 3300025915 Bacteria 934
387 Ga0207663_10098872 3300025916 Bacteria 1955
388 Ga0207660_10082836 3300025917 Bacteria 2361
389 Ga0207662_10017209 3300025918 Bacteria 4087
390 Ga0207662_10035358 3300025918 Bacteria 2918
391 Ga0207662_10114098 3300025918 Bacteria 1688
392 Ga0207662_10167412 3300025918 Bacteria 1408
393 Ga0207657_10017371 3300025919 Bacteria 6902
394 Ga0207649_10112718 3300025920 Bacteria 1820
395 Ga0207649_10194719 3300025920 Bacteria 1428
396 Ga0207649_10242335 3300025920 Bacteria 1295
397 Ga0207646_10164150 3300025922 Bacteria 2005
398 Ga0207681_10008230 3300025923 Bacteria 6378
399 Ga0207681_10085782 3300025923 Bacteria 2235
400 Ga0207681_10129224 3300025923 Bacteria 1865
401 Ga0207681_10141538 3300025923 Bacteria 1792
402 Ga0207650_10004822 3300025925 Bacteria 9216
403 Ga0207650_10046594 3300025925 Bacteria 3193
404 Ga0207650_10095006 3300025925 Bacteria 2285
405 Ga0207650_10301893 3300025925 Bacteria 1308
406 Ga0207650_10362306 3300025925 Bacteria 1195
407 Ga0207659_10001691 3300025926 Bacteria 13095
408 Ga0207659_10015240 3300025926 Bacteria 4975
409 Ga0207659_10027085 3300025926 Bacteria 3876
410 Ga0207659_10071293 3300025926 Bacteria 2537
411 Ga0207659_10081522 3300025926 Bacteria 2393
412 Ga0207659_10087940 3300025926 Bacteria 2314
413 Ga0207659_10210757 3300025926 Bacteria 1557
414 Ga0207659_10233277 3300025926 Bacteria 1485
415 Ga0207659_10503069 3300025926 Bacteria 1026
416 Ga0207687_10042762 3300025927 Bacteria 3119
417 Ga0207644_10028454 3300025931 Bacteria 3869
418 Ga0207644_10207164 3300025931 Bacteria 1549
419 Ga0207690_10126014 3300025932 Bacteria 1867
420 Ga0207690_10177280 3300025932 Bacteria 1602
421 Ga0207706_10007749 3300025933 Bacteria 9913
422 Ga0207706_10144257 3300025933 Bacteria 2095
423 Ga0207706_10578902 3300025933 Bacteria 965
424 Ga0207709_10129188 3300025935 Bacteria 1719
425 Ga0207670_10041185 3300025936 Bacteria 3036
426 Ga0207670_10061586 3300025936 Bacteria 2561
427 Ga0207670_10086264 3300025936 Bacteria 2208
428 Ga0207670_10190712 3300025936 Bacteria 1551
429 Ga0207670_10299190 3300025936 Bacteria 1259
430 Ga0207669_10048614 3300025937 Bacteria 2521
431 Ga0207669_10201662 3300025937 Bacteria 1445
432 Ga0207669_10467361 3300025937 Bacteria 1003
433 Ga0207704_10021051 3300025938 Bacteria 3465
434 Ga0207704_10114771 3300025938 Bacteria 1829
435 Ga0207691_10000710 3300025940 Bacteria 32933
436 Ga0207691_10020686 3300025940 Bacteria 6222
437 Ga0207691_10028392 3300025940 Bacteria 5238
438 Ga0207691_10030055 3300025940 Bacteria 5080
439 Ga0207691_10063363 3300025940 Bacteria 3353
440 Ga0207691_10124521 3300025940 Bacteria 2281
441 Ga0207691_10263741 3300025940 Bacteria 1485
442 Ga0207691_10291749 3300025940 Unclassified 1402
443 Ga0207691_10512457 3300025940 Bacteria 1018
444 Ga0207711_10107326 3300025941 Bacteria 2479
445 Ga0207711_10127567 3300025941 Bacteria 2277
446 Ga0207711_10148857 3300025941 Bacteria 2111
447 Ga0207711_10180641 3300025941 Bacteria 1919
448 Ga0207711_10679687 3300025941 Bacteria 960
449 Ga0207689_10000278 3300025942 Bacteria 46501
450 Ga0207689_10204968 3300025942 Bacteria 1628
451 Ga0207661_10005019 3300025944 Bacteria 9278
452 Ga0207661_10029293 3300025944 Bacteria 4227
453 Ga0207679_10003114 3300025945 Bacteria 10263
454 Ga0207679_10073532 3300025945 Bacteria 2587
455 Ga0207679_10269655 3300025945 Bacteria 1455
456 Ga0207679_10287970 3300025945 Bacteria 1411
457 Ga0207679_10367109 3300025945 Bacteria 1259
458 Ga0207679_10384974 3300025945 Bacteria 1230
459 Ga0207679_10399400 3300025945 Bacteria 1209
460 Ga0207667_10167816 3300025949 Bacteria 2256
461 Ga0207667_10214998 3300025949 Bacteria 1970
462 Ga0207651_10054053 3300025960 Bacteria 2749
463 Ga0207651_10076367 3300025960 Bacteria 2395
464 Ga0207651_10150163 3300025960 Bacteria 1812
465 Ga0207651_10161164 3300025960 Bacteria 1758
466 Ga0207651_10256585 3300025960 Bacteria 1433
467 Ga0207651_10322142 3300025960 Bacteria 1292
468 Ga0207651_10380540 3300025960 Bacteria 1196
469 Ga0207712_10004476 3300025961 Bacteria 8822
470 Ga0207712_10017406 3300025961 Bacteria 4666
471 Ga0207712_10026762 3300025961 Bacteria 3846
472 Ga0207712_10116403 3300025961 Bacteria 2014
473 Ga0207668_10033106 3300025972 Bacteria 3422
474 Ga0207668_10257201 3300025972 Bacteria 1421
475 Ga0207640_10367947 3300025981 Bacteria 1161
476 Ga0207640_10594659 3300025981 Bacteria 936
477 Ga0207658_10131776 3300025986 Bacteria 2009
478 Ga0207658_10503075 3300025986 Bacteria 1079
479 Ga0207677_10122374 3300026023 Bacteria 1960
480 Ga0207703_10018831 3300026035 Bacteria 5392
481 Ga0207703_10024917 3300026035 Bacteria 4706
482 Ga0207703_10045009 3300026035 Bacteria 3549
483 Ga0207703_10089413 3300026035 Bacteria 2586
484 Ga0207703_10427311 3300026035 Bacteria 1234
485 Ga0207678_10008519 3300026067 Bacteria 9035
486 Ga0207678_10024132 3300026067 Bacteria 5313
487 Ga0207678_10106974 3300026067 Bacteria 2386
488 Ga0207678_10457628 3300026067 Bacteria 1110
489 Ga0207678_10633923 3300026067 Bacteria 938
490 Ga0207708_10012395 3300026075 Bacteria 6354
491 Ga0207708_10050074 3300026075 Bacteria 3180
492 Ga0207708_10086563 3300026075 Bacteria 2411
493 Ga0207708_10309197 3300026075 Bacteria 1287
494 Ga0207708_10394727 3300026075 Bacteria 1143
495 Ga0207641_10023576 3300026088 Bacteria 5069
496 Ga0207641_10058091 3300026088 Bacteria 3292
497 Ga0207641_10074091 3300026088 Bacteria 2936
498 Ga0207648_10000992 3300026089 Bacteria 32023
499 Ga0207648_10041868 3300026089 Bacteria 4022
500 Ga0207676_10041312 3300026095 Bacteria 3539
501 Ga0207676_10215816 3300026095 Bacteria 1705
502 Ga0207676_10508201 3300026095 Bacteria 1145
503 Ga0207674_10032040 3300026116 Bacteria 5515
504 Ga0207674_10478446 3300026116 Bacteria 1204
505 Ga0207674_10794213 3300026116 Bacteria 913
506 Ga0207675_100000943 3300026118 Bacteria 29042
507 Ga0207675_100014021 3300026118 Bacteria 7472
508 Ga0207675_100097919 3300026118 Bacteria 2762
509 Ga0207675_100133588 3300026118 Bacteria 2353
510 Ga0207675_100231258 3300026118 Bacteria 1784
511 Ga0207675_100281274 3300026118 Bacteria 1617
512 Ga0207675_100317670 3300026118 Bacteria 1520
513 Ga0207675_100657037 3300026118 Bacteria 1055
514 Ga0207683_10050140 3300026121 Bacteria 3655
515 Ga0207683_10085472 3300026121 Bacteria 2804
516 Ga0207683_10163633 3300026121 Bacteria 2013
517 Ga0207683_10215217 3300026121 Bacteria 1750
518 Ga0207683_10322182 3300026121 Bacteria 1416
519 Ga0209983_1019523 3300027665 Bacteria 1410
520 Ga0209974_10054765 3300027876 Bacteria 1345
521 Ga0209974_10071742 3300027876 Bacteria 1182
522 Ga0207428_10000005 3300027907 Bacteria 520045
523 Ga0207428_10000324 3300027907 Bacteria 61960
524 Ga0207428_10001099 3300027907 Bacteria 29427
525 Ga0207428_10004010 3300027907 Bacteria 14133
526 Ga0207428_10015674 3300027907 Bacteria 6548
527 Ga0207428_10319924 3300027907 Bacteria 1146
528 Ga0268266_10099214 3300028379 Bacteria 2563
529 Ga0268266_10724750 3300028379 Bacteria 959
530 Ga0268265_10001455 3300028380 Bacteria 19886
531 Ga0268265_10015744 3300028380 Bacteria 5181
532 Ga0268265_10032352 3300028380 Bacteria 3789
533 Ga0268265_10169772 3300028380 Bacteria 1863
534 Ga0268265_10427412 3300028380 Bacteria 1231
535 Ga0268264_10068980 3300028381 Bacteria 2989
536 Ga0268264_10073156 3300028381 Bacteria 2908
537 Ga0268264_10172442 3300028381 Bacteria 1957
538 Ga0268264_10621982 3300028381 Bacteria 1066
539 Ga0307408_100009301 3300031548 Bacteria 6478
540 Ga0307408_100134565 3300031548 Bacteria 1932
541 Ga0307408_100371376 3300031548 Bacteria 1220
542 Ga0307405_10060576 3300031731 Bacteria 2389
543 Ga0307413_10010788 3300031824 Bacteria 4454
544 Ga0307413_10173520 3300031824 Bacteria 1529
545 Ga0307413_10334888 3300031824 Bacteria 1161
546 Ga0307413_10420102 3300031824 Bacteria 1053
547 Ga0307410_10132506 3300031852 Bacteria 1833
548 Ga0307410_10261978 3300031852 Bacteria 1349
549 Ga0307406_10033333 3300031901 Bacteria 3152
550 Ga0307406_10084928 3300031901 Bacteria 2115
551 Ga0307407_10003378 3300031903 Bacteria 6533
552 Ga0307407_10056226 3300031903 Bacteria 2277
553 Ga0307412_10002806 3300031911 Bacteria 9671
554 Ga0307412_10007131 3300031911 Bacteria 6344
555 Ga0307409_100208396 3300031995 Bacteria 1754
556 Ga0307409_100285584 3300031995 Bacteria 1528
557 Ga0307409_100479494 3300031995 Bacteria 1207
558 Ga0307416_100085231 3300032002 Bacteria 2688
559 Ga0307416_100152825 3300032002 Bacteria 2120
560 Ga0307416_100342209 3300032002 Bacteria 1509
561 Ga0307416_100998245 3300032002 Bacteria 940
562 Ga0307414_10023144 3300032004 Bacteria 3934
563 Ga0307411_10023184 3300032005 Bacteria 3671
564 Ga0307411_10107810 3300032005 Bacteria 1986
565 Ga0307411_10122944 3300032005 Bacteria 1882
566 Ga0373939_0122505 3300035114 Bacteria 919
567 Ga0373943_0373710 3300035170 Bacteria 820
568 Ga0373961_0065107 3300035241 Bacteria 1115
569 Ga0373931_0064633 3300035691 Bacteria 1981
570 Ga0373937_0024505 3300036401 Bacteria 5443
571 Ga0373937_0103373 3300036401 Bacteria 2646
572 Ga0373937_0480809 3300036401 Bacteria 1180
573 Ga0395901_0209652 3300038443 Bacteria 2040
574 Ga0439439_0043774 3300041406 Bacteria 1165
575 Ga0451802_1368556 3300041460 Bacteria 1047
576 Ga0439431_0049423 3300041997 Bacteria 1088
577 Ga0439450_002469 3300042008 Bacteria 2911
578 Ga0439462_0014960 3300042015 Bacteria 1997
579 Ga0450897_016139 3300042128 Bacteria 768
580 Ga0450896_009158 3300042133 Bacteria 1378
581 Ga0439446_0006036 3300042156 Bacteria 3140
582 Ga0450908_001560 3300042184 Bacteria 4447
583 Ga0439434_0079658 3300042435 Bacteria 1038
584 Ga0439435_0023820 3300042436 Bacteria 1610
585 Ga0439435_0048705 3300042436 Bacteria 1207
586 Ga0439464_0002635 3300042439 Bacteria 4439
587 Ga0439464_0006776 3300042439 Bacteria 2987
588 Ga0450918_020522 3300042531 Bacteria 1154
589 Ga0451576_0014294 3300045051 Bacteria 8840
590 Ga0451576_0028985 3300045051 Bacteria 5927
591 Ga0451576_0031886 3300045051 Bacteria 5616
592 Ga0451576_0087794 3300045051 Bacteria 3234
593 Ga0495592_0364352 3300046454 Bacteria 923
594 Ga0495629_0035375 3300046459 Bacteria 3530
595 Ga0495629_0136719 3300046459 Bacteria 1706
596 Ga0495651_0183551 3300046462 Bacteria 1479
597 Ga0495580_0058380 3300046472 Bacteria 2714
598 Ga0495580_0334191 3300046472 Bacteria 1028
599 Ga0495584_0025494 3300046491 Bacteria 2998
600 Ga0495585_0196670 3300046492 Bacteria 1029
601 Ga0495608_0009283 3300046511 Bacteria 6877
602 Ga0495628_0031085 3300046516 Bacteria 4319
603 Ga0495630_0073969 3300046517 Bacteria 2566
604 Ga0495637_0126350 3300046520 Bacteria 980
605 Ga0495642_0002165 3300046528 Bacteria 8080
606 Ga0495642_0172794 3300046528 Bacteria 939
607 Ga0495642_0226575 3300046528 Bacteria 816
608 Ga0495652_0358108 3300046529 Bacteria 1043
609 Ga0495587_0069281 3300046536 Bacteria 2054
610 Ga0495598_0123783 3300046537 Bacteria 879
611 Ga0495621_0001405 3300046539 Bacteria 6237
612 Ga0495621_0001631 3300046539 Bacteria 5867
613 Ga0495621_0131824 3300046539 Bacteria 973
614 Ga0495667_0032780 3300046559 Bacteria 3479
615 Ga0495667_0383396 3300046559 Bacteria 886
616 Ga0495659_0012268 3300046664 Bacteria 2772
617 Ga0495659_0012788 3300046664 Bacteria 2725
618 Ga0495588_0002059 3300046674 Bacteria 8604
619 Ga0495623_0090127 3300046679 Bacteria 1883
620 Ga0495647_0224594 3300046681 Bacteria 830
621 Ga0495658_0189767 3300046683 Bacteria 1277
622 Ga0495658_0211331 3300046683 Bacteria 1212
623 Ga0495669_0000860 3300046684 Bacteria 12848
624 Ga0495669_0131939 3300046684 Bacteria 1176
625 Ga0495669_0275364 3300046684 Bacteria 809
626 Ga0495670_0109501 3300046691 Bacteria 1428
627 Ga0495670_0123219 3300046691 Bacteria 1348
628 Ga0495636_0013262 3300047318 Bacteria 3270
629 Ga0495674_0031396 3300047319 Bacteria 4826
630 Ga0495684_0000549 3300047471 Bacteria 30432
631 Ga0496102_0162121 3300048905 Bacteria 2103
632 Ga0496102_0289458 3300048905 Bacteria 1544
633 Ga0496103_0339452 3300048906 Bacteria 966
634 Ga0496104_0005396 3300048907 Bacteria 11185
635 Ga0496105_0028091 3300048908 Bacteria 4601
636 Ga0496105_0179896 3300048908 Bacteria 1732
637 Ga0496106_0050553 3300048909 Bacteria 3133
638 Ga0496106_0088390 3300048909 Bacteria 2389
639 Ga0496106_0617299 3300048909 Bacteria 868
640 Ga0496108_0001066 3300048911 Bacteria 21388
641 Ga0496108_0065836 3300048911 Bacteria 3055
642 Ga0496108_0536364 3300048911 Bacteria 1021
643 Ga0496109_0000525 3300048912 Bacteria 32426
644 Ga0496109_0512074 3300048912 Bacteria 1133
645 Ga0496110_0001750 3300048913 Bacteria 16012
646 Ga0496110_0123545 3300048913 Bacteria 2334
647 Ga0496110_0126468 3300048913 Bacteria 2306
648 Ga0496110_0191719 3300048913 Bacteria 1856
649 Ga0496111_0000267 3300048914 Bacteria 25489
650 Ga0496111_0265074 3300048914 Bacteria 1274
651 Ga0496112_0004758 3300048915 Bacteria 11577
652 Ga0496112_0249801 3300048915 Bacteria 1725
653 Ga0496113_0107779 3300048916 Bacteria 2165
654 Ga0496113_0232617 3300048916 Bacteria 1470
655 Ga0496113_0297782 3300048916 Bacteria 1291
656 Ga0496114_0102777 3300048917 Bacteria 2442
657 Ga0496114_0181747 3300048917 Bacteria 1837
658 Ga0496114_0420502 3300048917 Bacteria 1184
659 Ga0501031_0183833 3300049568 Bacteria 1365
660 Ga0501031_0252171 3300049568 Bacteria 1147
661 Ga0501032_0173367 3300049569 Bacteria 1414
662 Ga0501033_0276715 3300049570 Bacteria 1186
663 Ga0501034_0004988 3300049571 Bacteria 14603
664 Ga0501034_0196399 3300049571 Bacteria 1977
665 Ga0501036_0058815 3300049572 Bacteria 3257
666 Ga0501036_0125484 3300049572 Bacteria 2168
667 Ga0501038_0325183 3300049574 Bacteria 1202
668 Ga0501039_0294845 3300049575 Bacteria 1275
669 Ga0501040_0021557 3300049576 Bacteria 4305
670 Ga0501040_0393724 3300049576 Bacteria 995
671 Ga0501041_0018370 3300049577 Bacteria 4167
672 Ga0501041_0060552 3300049577 Bacteria 2317
673 Ga0501042_0016357 3300049578 Bacteria 5091
674 Ga0501042_0089328 3300049578 Bacteria 2211
675 Ga0501042_0372501 3300049578 Bacteria 1033
676 Ga0501043_0550625 3300049579 Bacteria 857
677 Ga0501046_0008557 3300049580 Bacteria 8905
678 Ga0501048_0094336 3300049582 Bacteria 2111
679 Ga0501071_0233753 3300049587 Bacteria 1385
680 Ga0501072_0149838 3300049588 Bacteria 1860
681 Ga0501072_0257201 3300049588 Bacteria 1390
682 Ga0501072_0404321 3300049588 Bacteria 1083
683 Ga0501072_0464601 3300049588 Bacteria 1002
684 Ga0501073_0565318 3300049589 Bacteria 786
685 Ga0501074_0180594 3300049590 Bacteria 1506
686 Ga0501075_0160248 3300049591 Bacteria 1716
687 Ga0501075_0536777 3300049591 Bacteria 893
688 Ga0501076_0015973 3300049592 Bacteria 5682
689 Ga0501076_0112747 3300049592 Bacteria 2199
690 Ga0501076_0131318 3300049592 Bacteria 2031
691 Ga0501076_0211255 3300049592 Bacteria 1586
692 Ga0501076_0295583 3300049592 Bacteria 1327
693 Ga0501077_0077836 3300049593 Bacteria 2101
694 Ga0501077_0138880 3300049593 Bacteria 1541
695 Ga0501077_0355399 3300049593 Bacteria 935
696 Ga0501079_0121635 3300049741 Bacteria 2030
697 Ga0501079_0611720 3300049741 Bacteria 857
698 Ga0501080_0301653 3300049742 Bacteria 1453
699 Ga0501080_0477481 3300049742 Bacteria 1116
700 Ga0501081_0078225 3300049743 Bacteria 2312
701 Ga0501081_0168361 3300049743 Bacteria 1581
702 Ga0501081_0188977 3300049743 Bacteria 1491
703 Ga0501035_0063823 3300049822 Bacteria 3275
704 Ga0501044_0344501 3300049823 Bacteria 1411
705 Ga0501045_0005201 3300049824 Bacteria 8998
706 Ga0501045_0007934 3300049824 Bacteria 7392
707 Ga0501045_0056059 3300049824 Bacteria 2882
708 Ga0501045_0127405 3300049824 Bacteria 1892
709 Ga0501045_0271447 3300049824 Bacteria 1263
710 Ga0501045_0293118 3300049824 Bacteria 1211
711 nmdc:mga03n38_132410_c1 3300050490 Bacteria 1237
712 nmdc:mga03n38_40412_c1 3300050490 Bacteria 2027
713 nmdc:mga00v17_110920_c1 3300050491 Bacteria 1740
714 nmdc:mga0k408_5149_c1 3300050493 Bacteria 6931
715 nmdc:mga04h51_8895_c1 3300050495 Bacteria 2701
716 nmdc:mga07m45_103956_c1 3300050496 Bacteria 1633
717 nmdc:mga07m45_27986_c1 3300050496 Bacteria 3110
718 nmdc:mga05p37_137596_c1 3300050507 Bacteria 2994
719 nmdc:mga05p37_17055_c1 3300050507 Bacteria 8759
720 nmdc:mga05p37_193208_c1 3300050507 Bacteria 2470
721 nmdc:mga05p37_2484_c1 3300050507 Bacteria 15882
722 nmdc:mga05p37_264974_c1 3300050507 Bacteria 2055
723 nmdc:mga05p37_286658_c1 3300050507 Bacteria 1961
724 nmdc:mga05p37_3104_c1 3300050507 Bacteria 19302
725 nmdc:mga05p37_4536_c1 3300050507 Bacteria 16231
726 nmdc:mga05p37_472072_c1 3300050507 Bacteria 1447
727 nmdc:mga05p37_521737_c1 3300050507 Bacteria 1359
728 nmdc:mga05p37_582055_c1 3300050507 Bacteria 1267
729 nmdc:mga05p37_58943_c1 3300050507 Bacteria 4728
730 nmdc:mga05p37_80958_c1 3300050507 Bacteria 4000
731 nmdc:mga05p37_84634_c1 3300050507 Bacteria 3907
732 nmdc:mga09592_115598_c1 3300050508 Bacteria 2303
733 nmdc:mga09592_141994_c1 3300050508 Bacteria 2070
734 nmdc:mga09592_15955_c1 3300050508 Bacteria 6137
735 nmdc:mga09592_183012_c1 3300050508 Bacteria 1813
736 nmdc:mga09592_259238_c1 3300050508 Bacteria 1507
737 nmdc:mga09592_44625_c1 3300050508 Bacteria 3732
738 nmdc:mga09592_558577_c1 3300050508 Bacteria 983
739 nmdc:mga09592_78821_c1 3300050508 Bacteria 2804
740 nmdc:mga0qj67_11081_c1 3300050509 Bacteria 6751
741 nmdc:mga0qj67_1773_c1 3300050509 Bacteria 15254
742 nmdc:mga0qj67_196120_c1 3300050509 Bacteria 1641
743 nmdc:mga0qj67_202826_c1 3300050509 Bacteria 1611
744 nmdc:mga0qj67_36447_c1 3300050509 Bacteria 3848
745 nmdc:mga0qj67_5177_c1 3300050509 Bacteria 9515
746 nmdc:mga0qj67_53404_c1 3300050509 Bacteria 3199
747 nmdc:mga0qj67_59554_c1 3300050509 Bacteria 3028
748 nmdc:mga0qj67_9732_c1 3300050509 Bacteria 7160
749 nmdc:mga06r32_100495_c1 3300050510 Bacteria 2838
750 nmdc:mga06r32_1125_c1 3300050510 Bacteria 23961
751 nmdc:mga06r32_176171_c1 3300050510 Bacteria 2123
752 nmdc:mga06r32_2439_c1 3300050510 Bacteria 16633
753 nmdc:mga06r32_24502_c1 3300050510 Bacteria 5602
754 nmdc:mga06r32_327508_c1 3300050510 Bacteria 1517
755 nmdc:mga06r32_34666_c1 3300050510 Bacteria 4760
756 nmdc:mga06r32_37607_c1 3300050510 Bacteria 4579
757 nmdc:mga06r32_40230_c1 3300050510 Bacteria 4437
758 nmdc:mga06r32_71363_c1 3300050510 Bacteria 3360
759 nmdc:mga08y16_154315_c1 3300050511 Bacteria 2386
760 nmdc:mga08y16_1861_c1 3300050511 Bacteria 21450
761 nmdc:mga08y16_225470_c1 3300050511 Bacteria 1939
762 nmdc:mga08y16_230370_c1 3300050511 Bacteria 1916
763 nmdc:mga08y16_2429_c1 3300050511 Bacteria 19134
764 nmdc:mga08y16_2491_c1 3300050511 Bacteria 18922
765 nmdc:mga08y16_297484_c1 3300050511 Bacteria 1664
766 nmdc:mga08y16_315154_c1 3300050511 Bacteria 1611
767 nmdc:mga08y16_325550_c1 3300050511 Bacteria 1581
768 nmdc:mga08y16_409583_c1 3300050511 Bacteria 1387
769 nmdc:mga08y16_41310_c1 3300050511 Bacteria 4831
770 nmdc:mga08y16_54200_c1 3300050511 Bacteria 4190
771 nmdc:mga08y16_598885_c1 3300050511 Bacteria 1111
772 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
773 nmdc:mga0n895_234179_c1 3300050512 Bacteria 1864
774 nmdc:mga0n895_3303_c1 3300050512 Bacteria 12946
775 nmdc:mga0n895_47725_c1 3300050512 Bacteria 4188
776 nmdc:mga0n895_699577_c1 3300050512 Bacteria 1010
777 nmdc:mga0n895_97414_c1 3300050512 Bacteria 2947
778 nmdc:mga0rr50_185069_c1 3300050513 Bacteria 1704
779 nmdc:mga0rr50_274367_c1 3300050513 Bacteria 1406
780 nmdc:mga0rr50_383224_c1 3300050513 Bacteria 1186
781 nmdc:mga08x19_125924_c1 3300050514 Bacteria 1720
782 nmdc:mga08x19_391833_c1 3300050514 Bacteria 973
783 nmdc:mga0a205_11610_c1 3300050515 Bacteria 8116
784 nmdc:mga0a205_177972_c1 3300050515 Bacteria 2022
785 nmdc:mga0a205_236103_c1 3300050515 Bacteria 1710
786 nmdc:mga0a205_314470_c1 3300050515 Bacteria 1438
787 nmdc:mga0a205_37153_c1 3300050515 Bacteria 4682
788 nmdc:mga0a205_3965_c1 3300050515 Bacteria 13237
789 nmdc:mga0a205_403504_c1 3300050515 Bacteria 1231
790 nmdc:mga0a205_454861_c1 3300050515 Bacteria 1140
791 nmdc:mga0a205_490859_c1 3300050515 Bacteria 1086
792 Ga0495601_0007465 3300053077 Bacteria 6414
793 Ga0495655_0060257 3300053083 Bacteria 1033
794 Ga0495619_0003759 3300053085 Bacteria 9772
795 Ga0500599_004468 3300053736 Bacteria 1733
796 Ga0501084_0199219 3300054114 Bacteria 1689
797 Ga0501084_0555539 3300054114 Bacteria 970
798 Ga0590071_001377 3300059421 Bacteria 6449
799 Ga0590074_000174 3300059423 Bacteria 7956
800 Ga0590075_000627 3300059424 Bacteria 9451
801 Ga0590077_012356 3300059426 Bacteria 1769
802 Ga0501082_0234086 3300060353 Bacteria 1598
803 Ga0501082_0879525 3300060353 Bacteria 784
804 Ga0530510_0005510 3300061734 Bacteria 8764
805 Ga0530510_0045197 3300061734 Bacteria 3182
806 Ga0530510_0148191 3300061734 Bacteria 1731
807 Ga0530510_0576268 3300061734 Bacteria 855
808 Ga0501041_0115846
809 SwRhRL3b_contig_2096142
810 Ga0058860_11732355
811 Ga0065704_10003571
812 Ga0065712_10070028
813 Ga0065712_10096935
814 Ga0065712_10191650
815 Ga0065715_10200621
816 Ga0065715_10216017
817 Ga0065715_10238261
818 Ga0065715_10267993
819 Ga0065707_10001707
820 Ga0065707_10003508
821 Ga0065707_10139828
822 Ga0065707_10156187
823 Ga0065707_10162674
824 Ga0070676_10056420
825 Ga0070676_10088149
826 Ga0070683_100000219
827 Ga0070690_100007154
828 Ga0070690_100055635
829 Ga0070690_100088017
830 Ga0070670_100026520
831 Ga0070670_100032955
832 Ga0070670_100062782
833 Ga0070670_100246111
834 Ga0070670_100310331
835 Ga0070670_100980115
836 Ga0070677_10004723
837 Ga0068869_100011545
838 Ga0070680_100120388
839 Ga0070680_100257781
840 Ga0070680_100778673
841 Ga0070682_100070462
842 Ga0070660_100005652
843 Ga0070689_100025044
844 Ga0070689_100070263
845 Ga0070689_100074687
846 Ga0070689_100218139
847 Ga0070689_100290166
848 Ga0070687_100051857
849 Ga0070687_100318248
850 Ga0070661_100022189
851 Ga0070661_100049377
852 Ga0070661_100159899
853 Ga0070661_100207398
854 Ga0070661_100376908
855 Ga0070669_100001384
856 Ga0070669_100001575
857 Ga0070669_100020512
858 Ga0070669_100062176
859 Ga0070669_100226020
860 Ga0070669_100231832
861 Ga0070675_100001786
862 Ga0070675_100022847
863 Ga0070675_100041014
864 Ga0070675_100090384
865 Ga0070675_100112127
866 Ga0070675_100137995
867 Ga0070675_100153416
868 Ga0070675_100215860
869 Ga0070675_100777534
870 Ga0070671_100111027
871 Ga0070671_100270235
872 Ga0070674_100064679
873 Ga0070674_100085039
874 Ga0070673_100033368
875 Ga0070673_100356397
876 Ga0070673_100617415
877 Ga0070688_100004923
878 Ga0070688_100030030
879 Ga0070688_100190303
880 Ga0070659_100099115
881 Ga0070667_100219942
882 Ga0070667_100544282
883 Ga0070667_100627280
884 Ga0070703_10044366
885 Ga0070713_100029654
886 Ga0070701_10033165
887 Ga0070711_100045568
888 Ga0070705_100027724
889 Ga0070705_100334776
890 Ga0070705_100417183
891 Ga0070700_100015174
892 Ga0070700_100128452
893 Ga0070700_100146332
894 Ga0070694_100000985
895 Ga0070708_100581655
896 Ga0070663_100039054
897 Ga0070663_100062387
898 Ga0070678_100121438
899 Ga0070678_100137927
900 Ga0070678_100380781
901 Ga0070662_100074043
902 Ga0070662_100182029
903 Ga0070662_100393743
904 Ga0070681_10008780
905 Ga0068867_100028157
906 Ga0070685_10003231
907 Ga0070685_10069650
908 Ga0070706_100617310
909 Ga0070707_100053047
910 Ga0070707_100383146
911 Ga0070698_100037087
912 Ga0070699_100007194
913 Ga0070699_100045188
914 Ga0070679_100002755
915 Ga0070679_100081474
916 Ga0070684_100657685
917 Ga0070697_100093809
918 Ga0070697_100333489
919 Ga0070672_100011209
920 Ga0070672_100080730
921 Ga0070672_100110542
922 Ga0070672_100257890
923 Ga0070672_100266435
924 Ga0070672_100403643
925 Ga0070672_100817561
926 Ga0070686_100002510
927 Ga0070686_100024933
928 Ga0070686_100499184
929 Ga0070695_100251811
930 Ga0070696_100021526
931 Ga0070696_100088674
932 Ga0070696_100480554
933 Ga0070696_100566631
934 Ga0070693_100022554
935 Ga0070665_100043919
936 Ga0070665_100068450
937 Ga0070704_100001815
938 Ga0070704_100022315
939 Ga0070704_100314251
940 Ga0070704_100487129
941 Ga0068855_100029977
942 Ga0068855_100286111
943 Ga0068855_100350299
944 Ga0070664_100000947
945 Ga0070664_100034410
946 Ga0070664_100041156
947 Ga0070664_100042474
948 Ga0070664_100087200
949 Ga0070664_100229341
950 Ga0070664_100316588
951 Ga0070664_100436219
952 Ga0068857_100007177
953 Ga0068857_100022203
954 Ga0068857_100164336
955 Ga0068852_100419202
956 Ga0068859_100006829
957 Ga0068859_100016560
958 Ga0068859_100028948
959 Ga0068859_100091815
960 Ga0068859_100280547
961 Ga0068859_100459184
962 Ga0068859_100579223
963 Ga0068864_100021393
964 Ga0068864_100163472
965 Ga0068864_100216445
966 Ga0068864_100443110
967 Ga0068861_100004267
968 Ga0068861_100013918
969 Ga0068861_100186681
970 Ga0068861_100219837
971 Ga0068861_100225561
972 Ga0068861_100261863
973 Ga0068861_100331899
974 Ga0068861_100410220
975 Ga0068851_10118393
976 Ga0068870_10001156
977 Ga0068870_10013375
978 Ga0068870_10022064
979 Ga0068870_10543709
980 Ga0068863_100007812
981 Ga0068863_100028438
982 Ga0068863_100334343
983 Ga0068858_100054807
984 Ga0068858_100115932
985 Ga0068858_100159218
986 Ga0068858_100457909
987 Ga0068860_100011127
988 Ga0068860_100051679
989 Ga0068860_100154522
990 Ga0068860_100161327
991 Ga0068862_100001245
992 Ga0068862_100008739
993 Ga0068862_100396003
994 Ga0068862_100424939
995 Ga0068862_100518515
996 Ga0068862_100602943
997 Ga0081455_10000672
998 Ga0081539_10004766
999 Ga0075363_100033864
1000 Ga0075363_100081325
1001 Ga0075364_10065899
1002 Ga0075364_10141989
1003 Ga0070712_100111218
1004 Ga0075367_10005400
1005 Ga0075367_10058052
1006 Ga0075367_10363773
1007 Ga0075366_10013666
1008 Ga0075366_10219234
1009 Ga0075370_10072264
1010 Ga0075370_10112496
1011 Ga0075370_10361837
1012 Ga0068871_100041179
1013 Ga0068871_100056540
1014 Ga0068871_100199090
1015 Ga0068871_100305200
1016 Ga0075428_100000034
1017 Ga0075428_100002264
1018 Ga0075428_100004848
1019 Ga0075428_100006623
1020 Ga0075428_100008825
1021 Ga0075428_100017352
1022 Ga0075428_100046429
1023 Ga0075428_100080240
1024 Ga0075428_100084388
1025 Ga0075428_100121925
1026 Ga0075428_100282201
1027 Ga0075428_100316295
1028 Ga0075428_100433157
1029 Ga0075430_100003140
1030 Ga0075430_100003359
1031 Ga0075430_100010550
1032 Ga0075430_100012162
1033 Ga0075430_100032343
1034 Ga0075430_100034125
1035 Ga0075430_100112382
1036 Ga0075430_100220101
1037 Ga0075430_100337137
1038 Ga0075431_100002079
1039 Ga0075431_100004561
1040 Ga0075431_100010145
1041 Ga0075431_100010433
1042 Ga0075431_100010884
1043 Ga0075431_100014106
1044 Ga0075431_100020338
1045 Ga0075431_100092168
1046 Ga0075431_100178824
1047 Ga0075431_100345765
1048 Ga0075431_100364581
1049 Ga0075433_10008408
1050 Ga0075433_10010379
1051 Ga0075433_10036851
1052 Ga0075433_10071623
1053 Ga0075433_10162556
1054 Ga0075433_10212763
1055 Ga0075433_10258322
1056 Ga0075434_100002376
1057 Ga0075434_100029389
1058 Ga0075434_100089532
1059 Ga0075434_100215002
1060 Ga0075434_100261096
1061 Ga0075434_100337789
1062 Ga0075434_100349165
1063 Ga0075434_100380633
1064 Ga0075429_100009166
1065 Ga0075429_100009170
1066 Ga0075429_100018133
1067 Ga0075429_100089133
1068 Ga0075429_100091030
1069 Ga0075429_100107157
1070 Ga0075429_100150328
1071 Ga0075429_100394452
1072 Ga0068865_100056843
1073 Ga0068865_100718020
1074 Ga0075436_100084069
1075 Ga0097620_100006830
1076 Ga0097620_100016560
1077 Ga0097620_100028948
1078 Ga0097620_100076720
1079 Ga0097620_100091822
1080 Ga0097620_100280536
1081 Ga0097620_100459206
1082 Ga0097620_100579282
1083 Ga0075435_100052995
1084 Ga0075435_100102114
1085 Ga0075435_100269528
1086 Ga0075435_100316285
1087 Ga0075435_100406889
1088 Ga0105240_10143262
1089 Ga0111539_10000014
1090 Ga0111539_10000341
1091 Ga0111539_10001145
1092 Ga0111539_10003597
1093 Ga0111539_10004093
1094 Ga0111539_10004361
1095 Ga0111539_10004579
1096 Ga0111539_10016401
1097 Ga0111539_10021320
1098 Ga0111539_10039361
1099 Ga0111539_10066895
1100 Ga0111539_10084294
1101 Ga0111539_10119177
1102 Ga0111539_10126147
1103 Ga0111539_10135215
1104 Ga0111539_10145366
1105 Ga0111539_10447258
1106 Ga0111539_10456834
1107 Ga0111539_10560196
1108 Ga0111539_10591806
1109 Ga0111539_10834836
1110 Ga0105245_10056052
1111 Ga0105245_10190406
1112 Ga0105247_10055318
1113 Ga0105247_10079100
1114 Ga0114129_10004149
1115 Ga0114129_10004836
1116 Ga0114129_10013593
1117 Ga0114129_10013844
1118 Ga0114129_10014211
1119 Ga0114129_10015466
1120 Ga0114129_10039384
1121 Ga0114129_10049999
1122 Ga0114129_10055510
1123 Ga0114129_10062539
1124 Ga0114129_10062547
1125 Ga0114129_10071656
1126 Ga0114129_10079330
1127 Ga0114129_10121405
1128 Ga0114129_10181224
1129 Ga0114129_10834005
1130 Ga0105243_10018156
1131 Ga0105243_10363280
1132 Ga0105248_10020327
1133 Ga0105248_10108698
1134 Ga0105248_10138862
1135 Ga0105248_10173497
1136 Ga0105248_10285486
1137 Ga0105248_10325824
1138 Ga0105248_10368359
1139 Ga0105248_10648850
1140 Ga0105249_10003903
1141 Ga0105249_10013952
1142 Ga0105249_10023358
1143 Ga0105249_10024570
1144 Ga0105249_10782234
1145 Ga0099796_10198106
1146 Ga0105246_10147973
1147 Ga0105246_10220687
1148 Ga0157378_10313373
1149 Ga0163162_10011253
1150 Ga0157375_10006606
1151 Ga0157375_10026999
1152 Ga0157375_10320032
1153 Ga0157375_10849102
1154 Ga0157375_11084724
1155 Ga0157375_11418999
1156 Ga0163163_10000042
1157 Ga0163163_10186786
1158 Ga0157380_10005069
1159 Ga0157380_10007356
1160 Ga0157380_10313991
1161 Ga0157380_10356635
1162 Ga0157380_10691547
1163 Ga0157380_10951709
1164 Ga0157377_10002737
1165 Ga0157377_10022587
1166 Ga0157377_10106503
1167 Ga0157377_10120945
1168 Ga0157377_10158123
1169 Ga0157377_10200149
1170 Ga0157379_10001584
1171 Ga0157379_10046248
1172 Ga0157376_10136315
1173 Ga0157376_10331893
1174 Ga0163161_10077554
1175 Ga0163161_10135769
1176 Ga0207697_10000997
1177 Ga0207697_10001552
1178 Ga0207682_10001467
1179 Ga0207682_10056829
1180 Ga0207710_10031208
1181 Ga0207688_10000974
1182 Ga0207688_10021946
1183 Ga0207688_10103981
1184 Ga0207647_10254515
1185 Ga0207645_10001735
1186 Ga0207645_10065953
1187 Ga0207643_10005361
1188 Ga0207643_10026083
1189 Ga0207643_10033375
1190 Ga0207643_10043514
1191 Ga0207684_10775256
1192 Ga0207695_10295392
1193 Ga0207693_10514746
1194 Ga0207663_10098872
1195 Ga0207660_10082836
1196 Ga0207662_10017209
1197 Ga0207662_10035358
1198 Ga0207662_10114098
1199 Ga0207662_10167412
1200 Ga0207657_10017371
1201 Ga0207649_10112718
1202 Ga0207649_10194719
1203 Ga0207649_10242335
1204 Ga0207646_10164150
1205 Ga0207681_10008230
1206 Ga0207681_10085782
1207 Ga0207681_10129224
1208 Ga0207681_10141538
1209 Ga0207650_10004822
1210 Ga0207650_10046594
1211 Ga0207650_10095006
1212 Ga0207650_10301893
1213 Ga0207650_10362306
1214 Ga0207659_10001691
1215 Ga0207659_10015240
1216 Ga0207659_10027085
1217 Ga0207659_10071293
1218 Ga0207659_10081522
1219 Ga0207659_10087940
1220 Ga0207659_10210757
1221 Ga0207659_10233277
1222 Ga0207659_10503069
1223 Ga0207687_10042762
1224 Ga0207644_10028454
1225 Ga0207644_10207164
1226 Ga0207690_10126014
1227 Ga0207690_10177280
1228 Ga0207706_10007749
1229 Ga0207706_10144257
1230 Ga0207706_10578902
1231 Ga0207709_10129188
1232 Ga0207670_10041185
1233 Ga0207670_10061586
1234 Ga0207670_10086264
1235 Ga0207670_10190712
1236 Ga0207670_10299190
1237 Ga0207669_10048614
1238 Ga0207669_10201662
1239 Ga0207669_10467361
1240 Ga0207704_10021051
1241 Ga0207704_10114771
1242 Ga0207691_10000710
1243 Ga0207691_10020686
1244 Ga0207691_10028392
1245 Ga0207691_10030055
1246 Ga0207691_10063363
1247 Ga0207691_10124521
1248 Ga0207691_10263741
1249 Ga0207691_10291749
1250 Ga0207691_10512457
1251 Ga0207711_10107326
1252 Ga0207711_10127567
1253 Ga0207711_10148857
1254 Ga0207711_10180641
1255 Ga0207711_10679687
1256 Ga0207689_10000278
1257 Ga0207689_10204968
1258 Ga0207661_10005019
1259 Ga0207661_10029293
1260 Ga0207679_10003114
1261 Ga0207679_10073532
1262 Ga0207679_10269655
1263 Ga0207679_10287970
1264 Ga0207679_10367109
1265 Ga0207679_10384974
1266 Ga0207679_10399400
1267 Ga0207667_10167816
1268 Ga0207667_10214998
1269 Ga0207651_10054053
1270 Ga0207651_10076367
1271 Ga0207651_10150163
1272 Ga0207651_10161164
1273 Ga0207651_10256585
1274 Ga0207651_10322142
1275 Ga0207651_10380540
1276 Ga0207712_10004476
1277 Ga0207712_10017406
1278 Ga0207712_10026762
1279 Ga0207712_10116403
1280 Ga0207668_10033106
1281 Ga0207668_10257201
1282 Ga0207640_10367947
1283 Ga0207640_10594659
1284 Ga0207658_10131776
1285 Ga0207658_10503075
1286 Ga0207677_10122374
1287 Ga0207703_10018831
1288 Ga0207703_10024917
1289 Ga0207703_10045009
1290 Ga0207703_10089413
1291 Ga0207703_10427311
1292 Ga0207678_10008519
1293 Ga0207678_10024132
1294 Ga0207678_10106974
1295 Ga0207678_10457628
1296 Ga0207678_10633923
1297 Ga0207708_10012395
1298 Ga0207708_10050074
1299 Ga0207708_10086563
1300 Ga0207708_10309197
1301 Ga0207708_10394727
1302 Ga0207641_10023576
1303 Ga0207641_10058091
1304 Ga0207641_10074091
1305 Ga0207648_10000992
1306 Ga0207648_10041868
1307 Ga0207676_10041312
1308 Ga0207676_10215816
1309 Ga0207676_10508201
1310 Ga0207674_10032040
1311 Ga0207674_10478446
1312 Ga0207674_10794213
1313 Ga0207675_100000943
1314 Ga0207675_100014021
1315 Ga0207675_100097919
1316 Ga0207675_100133588
1317 Ga0207675_100231258
1318 Ga0207675_100281274
1319 Ga0207675_100317670
1320 Ga0207675_100657037
1321 Ga0207683_10050140
1322 Ga0207683_10085472
1323 Ga0207683_10163633
1324 Ga0207683_10215217
1325 Ga0207683_10322182
1326 Ga0209983_1019523
1327 Ga0209974_10054765
1328 Ga0209974_10071742
1329 Ga0207428_10000005
1330 Ga0207428_10000324
1331 Ga0207428_10001099
1332 Ga0207428_10004010
1333 Ga0207428_10015674
1334 Ga0207428_10319924
1335 Ga0268266_10099214
1336 Ga0268266_10724750
1337 Ga0268265_10001455
1338 Ga0268265_10015744
1339 Ga0268265_10032352
1340 Ga0268265_10169772
1341 Ga0268265_10427412
1342 Ga0268264_10068980
1343 Ga0268264_10073156
1344 Ga0268264_10172442
1345 Ga0268264_10621982
1346 Ga0307408_100009301
1347 Ga0307408_100134565
1348 Ga0307408_100371376
1349 Ga0307405_10060576
1350 Ga0307413_10010788
1351 Ga0307413_10173520
1352 Ga0307413_10334888
1353 Ga0307413_10420102
1354 Ga0307410_10132506
1355 Ga0307410_10261978
1356 Ga0307406_10033333
1357 Ga0307406_10084928
1358 Ga0307407_10003378
1359 Ga0307407_10056226
1360 Ga0307412_10002806
1361 Ga0307412_10007131
1362 Ga0307409_100208396
1363 Ga0307409_100285584
1364 Ga0307409_100479494
1365 Ga0307416_100085231
1366 Ga0307416_100152825
1367 Ga0307416_100342209
1368 Ga0307416_100998245
1369 Ga0307414_10023144
1370 Ga0307411_10023184
1371 Ga0307411_10107810
1372 Ga0307411_10122944
1373 Ga0373939_0122505
1374 Ga0373943_0373710
1375 Ga0373961_0065107
1376 Ga0373931_0064633
1377 Ga0373937_0024505
1378 Ga0373937_0103373
1379 Ga0373937_0480809
1380 Ga0395901_0209652
1381 Ga0439439_0043774
1382 Ga0451802_1368556
1383 Ga0439431_0049423
1384 Ga0439450_002469
1385 Ga0439462_0014960
1386 Ga0450897_016139
1387 Ga0450896_009158
1388 Ga0439446_0006036
1389 Ga0450908_001560
1390 Ga0439434_0079658
1391 Ga0439435_0023820
1392 Ga0439435_0048705
1393 Ga0439464_0002635
1394 Ga0439464_0006776
1395 Ga0450918_020522
1396 Ga0451576_0014294
1397 Ga0451576_0028985
1398 Ga0451576_0031886
1399 Ga0451576_0087794
1400 Ga0495592_0364352
1401 Ga0495629_0035375
1402 Ga0495629_0136719
1403 Ga0495651_0183551
1404 Ga0495580_0058380
1405 Ga0495580_0334191
1406 Ga0495584_0025494
1407 Ga0495585_0196670
1408 Ga0495608_0009283
1409 Ga0495628_0031085
1410 Ga0495630_0073969
1411 Ga0495637_0126350
1412 Ga0495642_0002165
1413 Ga0495642_0172794
1414 Ga0495642_0226575
1415 Ga0495652_0358108
1416 Ga0495587_0069281
1417 Ga0495598_0123783
1418 Ga0495621_0001405
1419 Ga0495621_0001631
1420 Ga0495621_0131824
1421 Ga0495667_0032780
1422 Ga0495667_0383396
1423 Ga0495659_0012268
1424 Ga0495659_0012788
1425 Ga0495588_0002059
1426 Ga0495623_0090127
1427 Ga0495647_0224594
1428 Ga0495658_0189767
1429 Ga0495658_0211331
1430 Ga0495669_0000860
1431 Ga0495669_0131939
1432 Ga0495669_0275364
1433 Ga0495670_0109501
1434 Ga0495670_0123219
1435 Ga0495636_0013262
1436 Ga0495674_0031396
1437 Ga0495684_0000549
1438 Ga0496102_0162121
1439 Ga0496102_0289458
1440 Ga0496103_0339452
1441 Ga0496104_0005396
1442 Ga0496105_0028091
1443 Ga0496105_0179896
1444 Ga0496106_0050553
1445 Ga0496106_0088390
1446 Ga0496106_0617299
1447 Ga0496108_0001066
1448 Ga0496108_0065836
1449 Ga0496108_0536364
1450 Ga0496109_0000525
1451 Ga0496109_0512074
1452 Ga0496110_0001750
1453 Ga0496110_0123545
1454 Ga0496110_0126468
1455 Ga0496110_0191719
1456 Ga0496111_0000267
1457 Ga0496111_0265074
1458 Ga0496112_0004758
1459 Ga0496112_0249801
1460 Ga0496113_0107779
1461 Ga0496113_0232617
1462 Ga0496113_0297782
1463 Ga0496114_0102777
1464 Ga0496114_0181747
1465 Ga0496114_0420502
1466 Ga0501031_0183833
1467 Ga0501031_0252171
1468 Ga0501032_0173367
1469 Ga0501033_0276715
1470 Ga0501034_0004988
1471 Ga0501034_0196399
1472 Ga0501036_0058815
1473 Ga0501036_0125484
1474 Ga0501038_0325183
1475 Ga0501039_0294845
1476 Ga0501040_0021557
1477 Ga0501040_0393724
1478 Ga0501041_0018370
1479 Ga0501041_0060552
1480 Ga0501042_0016357
1481 Ga0501042_0089328
1482 Ga0501042_0372501
1483 Ga0501043_0550625
1484 Ga0501046_0008557
1485 Ga0501048_0094336
1486 Ga0501071_0233753
1487 Ga0501072_0149838
1488 Ga0501072_0257201
1489 Ga0501072_0404321
1490 Ga0501072_0464601
1491 Ga0501073_0565318
1492 Ga0501074_0180594
1493 Ga0501075_0160248
1494 Ga0501075_0536777
1495 Ga0501076_0015973
1496 Ga0501076_0112747
1497 Ga0501076_0131318
1498 Ga0501076_0211255
1499 Ga0501076_0295583
1500 Ga0501077_0077836
1501 Ga0501077_0138880
1502 Ga0501077_0355399
1503 Ga0501079_0121635
1504 Ga0501079_0611720
1505 Ga0501080_0301653
1506 Ga0501080_0477481
1507 Ga0501081_0078225
1508 Ga0501081_0168361
1509 Ga0501081_0188977
1510 Ga0501035_0063823
1511 Ga0501044_0344501
1512 Ga0501045_0005201
1513 Ga0501045_0007934
1514 Ga0501045_0056059
1515 Ga0501045_0127405
1516 Ga0501045_0271447
1517 Ga0501045_0293118
1518 nmdc:mga03n38_132410_c1
1519 nmdc:mga03n38_40412_c1
1520 nmdc:mga00v17_110920_c1
1521 nmdc:mga0k408_5149_c1
1522 nmdc:mga04h51_8895_c1
1523 nmdc:mga07m45_103956_c1
1524 nmdc:mga07m45_27986_c1
1525 nmdc:mga05p37_137596_c1
1526 nmdc:mga05p37_17055_c1
1527 nmdc:mga05p37_193208_c1
1528 nmdc:mga05p37_2484_c1
1529 nmdc:mga05p37_264974_c1
1530 nmdc:mga05p37_286658_c1
1531 nmdc:mga05p37_3104_c1
1532 nmdc:mga05p37_4536_c1
1533 nmdc:mga05p37_472072_c1
1534 nmdc:mga05p37_521737_c1
1535 nmdc:mga05p37_582055_c1
1536 nmdc:mga05p37_58943_c1
1537 nmdc:mga05p37_80958_c1
1538 nmdc:mga05p37_84634_c1
1539 nmdc:mga09592_115598_c1
1540 nmdc:mga09592_141994_c1
1541 nmdc:mga09592_15955_c1
1542 nmdc:mga09592_183012_c1
1543 nmdc:mga09592_259238_c1
1544 nmdc:mga09592_44625_c1
1545 nmdc:mga09592_558577_c1
1546 nmdc:mga09592_78821_c1
1547 nmdc:mga0qj67_11081_c1
1548 nmdc:mga0qj67_1773_c1
1549 nmdc:mga0qj67_196120_c1
1550 nmdc:mga0qj67_202826_c1
1551 nmdc:mga0qj67_36447_c1
1552 nmdc:mga0qj67_5177_c1
1553 nmdc:mga0qj67_53404_c1
1554 nmdc:mga0qj67_59554_c1
1555 nmdc:mga0qj67_9732_c1
1556 nmdc:mga06r32_100495_c1
1557 nmdc:mga06r32_1125_c1
1558 nmdc:mga06r32_176171_c1
1559 nmdc:mga06r32_2439_c1
1560 nmdc:mga06r32_24502_c1
1561 nmdc:mga06r32_327508_c1
1562 nmdc:mga06r32_34666_c1
1563 nmdc:mga06r32_37607_c1
1564 nmdc:mga06r32_40230_c1
1565 nmdc:mga06r32_71363_c1
1566 nmdc:mga08y16_154315_c1
1567 nmdc:mga08y16_1861_c1
1568 nmdc:mga08y16_225470_c1
1569 nmdc:mga08y16_230370_c1
1570 nmdc:mga08y16_2429_c1
1571 nmdc:mga08y16_2491_c1
1572 nmdc:mga08y16_297484_c1
1573 nmdc:mga08y16_315154_c1
1574 nmdc:mga08y16_325550_c1
1575 nmdc:mga08y16_409583_c1
1576 nmdc:mga08y16_41310_c1
1577 nmdc:mga08y16_54200_c1
1578 nmdc:mga08y16_598885_c1
1579 nmdc:mga08y16_9_c1
1580 nmdc:mga0n895_234179_c1
1581 nmdc:mga0n895_3303_c1
1582 nmdc:mga0n895_47725_c1
1583 nmdc:mga0n895_699577_c1
1584 nmdc:mga0n895_97414_c1
1585 nmdc:mga0rr50_185069_c1
1586 nmdc:mga0rr50_274367_c1
1587 nmdc:mga0rr50_383224_c1
1588 nmdc:mga08x19_125924_c1
1589 nmdc:mga08x19_391833_c1
1590 nmdc:mga0a205_11610_c1
1591 nmdc:mga0a205_177972_c1
1592 nmdc:mga0a205_236103_c1
1593 nmdc:mga0a205_314470_c1
1594 nmdc:mga0a205_37153_c1
1595 nmdc:mga0a205_3965_c1
1596 nmdc:mga0a205_403504_c1
1597 nmdc:mga0a205_454861_c1
1598 nmdc:mga0a205_490859_c1
1599 Ga0495601_0007465
1600 Ga0495655_0060257
1601 Ga0495619_0003759
1602 Ga0500599_004468
1603 Ga0501084_0199219
1604 Ga0501084_0555539
1605 Ga0590071_001377
1606 Ga0590074_000174
1607 Ga0590075_000627
1608 Ga0590077_012356
1609 Ga0501082_0234086
1610 Ga0501082_0879525
1611 Ga0530510_0005510
1612 Ga0530510_0045197
1613 Ga0530510_0148191
1614 Ga0530510_0576268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

60

277

0.89

PF01965

DJ-1_PfpI

DJ-1/PfpI family

86

163

0.88

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

81

156

0.83

PF00117

GATase

Glutamine amidotransferase class-I

73

286

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9389 1 228
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9218 1 228
4lgy-assembly1.cif.gz_A importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis 0.8806 1 225
6lyl-assembly1.cif.gz_A crystal structure of s1052d mutant of formylglycinamidine synthetase 0.8772 1 227
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8759 1 227
ID Description Score Start End Superfamily
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9603 3 228 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9587 1 229 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9577 3 229 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9461 1 229 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9449 3 229 3.40.50.880
ID Description Score Start End GO Terms
AF-X1CA12-F1-model_v4 Uncharacterized protein 0.9902 82 222 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A2V8RZ66-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9883 83 205 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A537FVQ6-F1-model_v4 Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3) 0.9878 72 206 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A424Z206-F1-model_v4 Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3) 0.9863 81 232 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787
AF-A0A1G1J8B2-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9841 120 231 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787

Map