F481730

General Info

Members Datasets Scaffolds Average Seq Length
808 358 792 278

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0031176|Ga0395899_0031176_575_1486
Length 303
Sequence MLGQIIRARFSRAKSLMLPPVFGVLFDGFAYGMLLFLLAVGQSVTLGMMNFINLAHCSFAMLGGYVTVVLMRQYGWPFFATLPAAFVVAALVSVVFERTLYRRLYRASELDQVLLTIGIVFISVAAAAYVFGTTQQPVQLPAYLRESFNLAGIHLVVYRAVLIVIALAITGALVAGLELTRFGAQVRAAVDNERMARGLGINVERTFAITFALGSGLAGLGGALAIEIVGLDPNFAFTYLIYVLIVVSTGGLGSVAGSFAAAAVLGISDVAGKYYVPQIGAFLIYLVMVTLLMWRPRGLFGRR

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
3 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
4 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
5 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
6 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
7 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
8 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
9 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
10 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
11 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
12 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
202 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
343 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
347 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
348 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
351 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
356 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
357 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
358 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.25
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 1.73
Rhizoplane 2.97
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100002043 3300005330 Bacteria 10759
2 Ga0068869_100005688 3300005334 Bacteria 7863
3 Ga0068869_100212924 3300005334 Bacteria 1528
4 Ga0070680_100002937 3300005336 Bacteria 12673
5 Ga0070680_100324697 3300005336 Bacteria 1307
6 Ga0070682_100035802 3300005337 Bacteria 3032
7 Ga0070682_100072846 3300005337 Bacteria 2202
8 Ga0068868_100007949 3300005338 Bacteria 7577
9 Ga0070689_100009220 3300005340 Bacteria 6987
10 Ga0070689_100400807 3300005340 Bacteria 1160
11 Ga0070691_10014151 3300005341 Bacteria 3658
12 Ga0070687_100000041 3300005343 Bacteria 40926
13 Ga0070687_100185409 3300005343 Bacteria 1250
14 Ga0070661_100057287 3300005344 Bacteria 2856
15 Ga0070668_100053800 3300005347 Bacteria 3104
16 Ga0070668_100100663 3300005347 Bacteria 2290
17 Ga0070675_100091375 3300005354 Bacteria 2550
18 Ga0070675_100151977 3300005354 Bacteria 1985
19 Ga0070674_100016960 3300005356 Bacteria 4571
20 Ga0070673_100125925 3300005364 Bacteria 2144
21 Ga0070688_100049817 3300005365 Bacteria 2608
22 Ga0070659_100190699 3300005366 Bacteria 1684
23 Ga0070667_100009580 3300005367 Bacteria 8031
24 Ga0070714_100184637 3300005435 Bacteria 1900
25 Ga0070713_100037168 3300005436 Bacteria 3936
26 Ga0070713_100065604 3300005436 Bacteria 3051
27 Ga0070701_10001599 3300005438 Bacteria 8432
28 Ga0070711_100030608 3300005439 Bacteria 3565
29 Ga0070711_100104818 3300005439 Bacteria 2064
30 Ga0070705_100001261 3300005440 Bacteria 13651
31 Ga0070705_100001759 3300005440 Bacteria 11230
32 Ga0070700_100002086 3300005441 Bacteria 10152
33 Ga0070694_100001810 3300005444 Bacteria 12668
34 Ga0070694_100019538 3300005444 Bacteria 4310
35 Ga0070694_100029729 3300005444 Bacteria 3568
36 Ga0070663_100012485 3300005455 Bacteria 5375
37 Ga0070663_100028209 3300005455 Bacteria 3819
38 Ga0070663_100117414 3300005455 Bacteria 2006
39 Ga0070678_100011585 3300005456 Bacteria 5446
40 Ga0070678_100113416 3300005456 Bacteria 2125
41 Ga0070662_100007259 3300005457 Bacteria 7182
42 Ga0070681_10034265 3300005458 Bacteria 5099
43 Ga0070681_10445370 3300005458 Bacteria 1207
44 Ga0068867_100001132 3300005459 Bacteria 18214
45 Ga0070699_100004915 3300005518 Bacteria 11789
46 Ga0070699_100184413 3300005518 Bacteria 1852
47 Ga0070679_100030351 3300005530 Bacteria 5338
48 Ga0070679_100057154 3300005530 Bacteria 3888
49 Ga0070697_100002757 3300005536 Bacteria 13527
50 Ga0070697_100040045 3300005536 Bacteria 3790
51 Ga0070697_100060873 3300005536 Bacteria 3078
52 Ga0070672_100202710 3300005543 Bacteria 1659
53 Ga0070686_100004960 3300005544 Bacteria 7341
54 Ga0070686_100026439 3300005544 Bacteria 3503
55 Ga0070695_100003802 3300005545 Bacteria 8801
56 Ga0070695_100007356 3300005545 Bacteria 6527
57 Ga0070696_100003737 3300005546 Bacteria 10164
58 Ga0070696_100005213 3300005546 Bacteria 8687
59 Ga0070696_100368441 3300005546 Bacteria 1117
60 Ga0070693_100000774 3300005547 Bacteria 14089
61 Ga0070693_100052502 3300005547 Bacteria 2337
62 Ga0070704_100000019 3300005549 Bacteria 53845
63 Ga0070704_100340236 3300005549 Bacteria 1263
64 Ga0068855_100006910 3300005563 Bacteria 13765
65 Ga0070664_100056704 3300005564 Bacteria 3329
66 Ga0068857_100183653 3300005577 Bacteria 1903
67 Ga0068857_100198190 3300005577 Bacteria 1830
68 Ga0070702_100001829 3300005615 Bacteria 8854
69 Ga0068859_100024246 3300005617 Bacteria 6087
70 Ga0068866_10000614 3300005718 Bacteria 16287
71 Ga0068861_100004375 3300005719 Bacteria 9475
72 Ga0068863_100078074 3300005841 Bacteria 3135
73 Ga0068858_100007256 3300005842 Bacteria 10738
74 Ga0068858_100055331 3300005842 Bacteria 3667
75 Ga0068858_100072953 3300005842 Bacteria 3186
76 Ga0068860_100023532 3300005843 Bacteria 5953
77 Ga0068862_100003934 3300005844 Bacteria 12633
78 Ga0081455_10000209 3300005937 Bacteria 74597
79 Ga0081538_10054414 3300005981 Bacteria 2367
80 Ga0081540_1000280 3300005983 Bacteria 53060
81 Ga0081539_10004540 3300005985 Bacteria 15228
82 Ga0081539_10039242 3300005985 Bacteria 2797
83 Ga0075365_10296642 3300006038 Bacteria 1137
84 Ga0070712_100003223 3300006175 Bacteria 10057
85 Ga0070712_100026284 3300006175 Bacteria 3876
86 Ga0070712_100159048 3300006175 Bacteria 1743
87 Ga0070712_100213252 3300006175 Bacteria 1524
88 Ga0075367_10105395 3300006178 Bacteria 1727
89 Ga0075366_10029929 3300006195 Bacteria 3199
90 Ga0097621_100000406 3300006237 Bacteria 30028
91 Ga0097621_100002538 3300006237 Bacteria 12508
92 Ga0097621_100030764 3300006237 Bacteria 4253
93 Ga0097621_100121255 3300006237 Bacteria 2218
94 Ga0068871_100007351 3300006358 Bacteria 7860
95 Ga0068871_100014697 3300006358 Bacteria 5841
96 Ga0075428_100003052 3300006844 Bacteria 18260
97 Ga0075428_100158465 3300006844 Bacteria 2458
98 Ga0075428_100174930 3300006844 Bacteria 2325
99 Ga0075428_100619032 3300006844 Bacteria 1156
100 Ga0075430_100001460 3300006846 Bacteria 19217
101 Ga0075430_100014857 3300006846 Bacteria 6630
102 Ga0075430_100303128 3300006846 Bacteria 1321
103 Ga0075431_100000372 3300006847 Bacteria 35771
104 Ga0075433_10001929 3300006852 Bacteria 15609
105 Ga0075434_100000254 3300006871 Bacteria 37644
106 Ga0075434_100000818 3300006871 Bacteria 24717
107 Ga0075434_100057100 3300006871 Bacteria 3879
108 Ga0075429_100006480 3300006880 Bacteria 10141
109 Ga0068865_100003715 3300006881 Bacteria 9165
110 Ga0075436_100000149 3300006914 Bacteria 43158
111 Ga0075436_100029252 3300006914 Bacteria 3789
112 Ga0097620_100024244 3300006931 Bacteria 6087
113 Ga0075435_100001280 3300007076 Bacteria 16160
114 Ga0075435_100051906 3300007076 Bacteria 3303
115 Ga0075435_100141868 3300007076 Bacteria 2016
116 Ga0075435_100223327 3300007076 Bacteria 1600
117 Ga0075435_100224598 3300007076 Bacteria 1595
118 Ga0099794_10161173 3300007265 Bacteria 1141
119 Ga0105240_10297805 3300009093 Bacteria 1846
120 Ga0111539_10008534 3300009094 Bacteria 13017
121 Ga0111539_10012842 3300009094 Bacteria 10482
122 Ga0111539_10033868 3300009094 Bacteria 6198
123 Ga0105245_10001530 3300009098 Bacteria 20953
124 Ga0114129_10003508 3300009147 Bacteria 22059
125 Ga0114129_10116952 3300009147 Bacteria 3674
126 Ga0114129_10666523 3300009147 Bacteria 1341
127 Ga0114129_10828921 3300009147 Bacteria 1178
128 Ga0114129_11114562 3300009147 Bacteria 987
129 Ga0105243_10000478 3300009148 Bacteria 41051
130 Ga0105243_10693075 3300009148 Bacteria 992
131 Ga0105241_10023468 3300009174 Bacteria 4575
132 Ga0105241_10071529 3300009174 Bacteria 2693
133 Ga0105242_10003114 3300009176 Bacteria 12942
134 Ga0105248_10020983 3300009177 Bacteria 7239
135 Ga0105248_10192363 3300009177 Bacteria 2299
136 Ga0105238_10155226 3300009551 Bacteria 2264
137 Ga0105249_10002781 3300009553 Bacteria 15102
138 Ga0105249_10293342 3300009553 Bacteria 1628
139 Ga0105249_10401105 3300009553 Bacteria 1402
140 Ga0105239_10044249 3300010375 Bacteria 4881
141 Ga0105239_10143444 3300010375 Bacteria 2662
142 Ga0105246_10037918 3300011119 Bacteria 3237
143 Ga0157341_1000955 3300012494 Bacteria 1623
144 Ga0157371_10061087 3300013102 Bacteria 2672
145 Ga0157378_10000362 3300013297 Bacteria 44796
146 Ga0157378_10054745 3300013297 Bacteria 3553
147 Ga0163162_10065114 3300013306 Bacteria 3691
148 Ga0163162_10482444 3300013306 Bacteria 1371
149 Ga0157372_10178558 3300013307 Bacteria 2458
150 Ga0157372_10216318 3300013307 Bacteria 2221
151 Ga0157375_10002488 3300013308 Bacteria 15965
152 Ga0163163_10240354 3300014325 Bacteria 1860
153 Ga0157380_10056450 3300014326 Bacteria 3123
154 Ga0157379_10138951 3300014968 Bacteria 2190
155 Ga0157376_10008924 3300014969 Bacteria 7260
156 Ga0157376_10098144 3300014969 Bacteria 2553
157 Ga0206356_10750345 3300020070 Bacteria 987
158 Ga0213876_10008996 3300021384 Bacteria 5381
159 Ga0213876_10029221 3300021384 Bacteria 2906
160 Ga0228598_1007242 3300024227 Bacteria 2265
161 Ga0228598_1018395 3300024227 Bacteria 1378
162 Ga0207697_10086495 3300025315 Bacteria 1325
163 Ga0207697_10130625 3300025315 Bacteria 1085
164 Ga0207653_10026706 3300025885 Bacteria 1852
165 Ga0207642_10000493 3300025899 Bacteria 12123
166 Ga0207710_10047969 3300025900 Bacteria 1910
167 Ga0207680_10114418 3300025903 Bacteria 1755
168 Ga0207699_10239344 3300025906 Unclassified 1246
169 Ga0207699_10310568 3300025906 Bacteria 1103
170 Ga0207643_10024187 3300025908 Bacteria 3352
171 Ga0207707_10031302 3300025912 Bacteria 4655
172 Ga0207707_10412329 3300025912 Bacteria 1159
173 Ga0207695_10082424 3300025913 Bacteria 3252
174 Ga0207693_10001925 3300025915 Bacteria 18182
175 Ga0207693_10026368 3300025915 Bacteria 4599
176 Ga0207693_10055864 3300025915 Bacteria 3097
177 Ga0207693_10129451 3300025915 Bacteria 1984
178 Ga0207663_10175697 3300025916 Bacteria 1525
179 Ga0207663_10251311 3300025916 Bacteria 1301
180 Ga0207663_10279510 3300025916 Bacteria 1239
181 Ga0207660_10022448 3300025917 Bacteria 4252
182 Ga0207660_10304099 3300025917 Bacteria 1270
183 Ga0207662_10001121 3300025918 Bacteria 12604
184 Ga0207662_10120427 3300025918 Bacteria 1646
185 Ga0207652_10098403 3300025921 Bacteria 2580
186 Ga0207652_10257404 3300025921 Bacteria 1574
187 Ga0207681_10346654 3300025923 Bacteria 1188
188 Ga0207659_10102681 3300025926 Bacteria 2159
189 Ga0207687_10005565 3300025927 Bacteria 8322
190 Ga0207687_10219206 3300025927 Bacteria 1497
191 Ga0207700_10045328 3300025928 Bacteria 3244
192 Ga0207700_10087336 3300025928 Bacteria 2453
193 Ga0207700_10566160 3300025928 Bacteria 1010
194 Ga0207664_10049839 3300025929 Bacteria 3299
195 Ga0207664_10144368 3300025929 Bacteria 2017
196 Ga0207644_10019902 3300025931 Bacteria 4558
197 Ga0207706_10085297 3300025933 Bacteria 2777
198 Ga0207686_10003159 3300025934 Bacteria 8864
199 Ga0207709_10001899 3300025935 Bacteria 13782
200 Ga0207670_10002655 3300025936 Bacteria 9408
201 Ga0207670_10240190 3300025936 Bacteria 1395
202 Ga0207704_10020103 3300025938 Bacteria 3524
203 Ga0207665_10086192 3300025939 Bacteria 2168
204 Ga0207691_10042975 3300025940 Bacteria 4166
205 Ga0207691_10127753 3300025940 Bacteria 2248
206 Ga0207711_10224284 3300025941 Bacteria 1720
207 Ga0207689_10000566 3300025942 Bacteria 35376
208 Ga0207689_10045532 3300025942 Bacteria 3627
209 Ga0207689_10119851 3300025942 Bacteria 2165
210 Ga0207667_10021448 3300025949 Bacteria 7157
211 Ga0207712_10026005 3300025961 Bacteria 3895
212 Ga0207712_10450730 3300025961 Bacteria 1091
213 Ga0207668_10113720 3300025972 Bacteria 2036
214 Ga0207640_10005119 3300025981 Bacteria 7130
215 Ga0207677_10005638 3300026023 Bacteria 6806
216 Ga0207703_10056292 3300026035 Bacteria 3202
217 Ga0207703_10079135 3300026035 Bacteria 2734
218 Ga0207678_10009048 3300026067 Bacteria 8768
219 Ga0207678_10036398 3300026067 Bacteria 4284
220 Ga0207678_10162545 3300026067 Bacteria 1907
221 Ga0207708_10003184 3300026075 Bacteria 12089
222 Ga0207641_10403468 3300026088 Bacteria 1313
223 Ga0207648_10000281 3300026089 Bacteria 55309
224 Ga0207674_10183215 3300026116 Bacteria 2045
225 Ga0207674_10204265 3300026116 Bacteria 1925
226 Ga0207675_100005102 3300026118 Bacteria 12637
227 Ga0207675_100180327 3300026118 Bacteria 2022
228 Ga0207683_10117842 3300026121 Bacteria 2381
229 Ga0207698_10421623 3300026142 Bacteria 1281
230 Ga0209996_1004795 3300027395 Bacteria 1727
231 Ga0209970_1010326 3300027614 Bacteria 1527
232 Ga0209588_1053410 3300027671 Bacteria 1307
233 Ga0209971_1032607 3300027682 Bacteria 1250
234 Ga0209974_10078808 3300027876 Bacteria 1131
235 Ga0207428_10001277 3300027907 Bacteria 26936
236 Ga0207428_10030877 3300027907 Bacteria 4426
237 Ga0268265_10011524 3300028380 Bacteria 5976
238 Ga0268264_10052329 3300028381 Bacteria 3404
239 Ga0265338_10263521 3300028800 Bacteria 1266
240 Ga0265770_1006487 3300030878 Bacteria 1627
241 Ga0265325_10003857 3300031241 Bacteria 9631
242 Ga0265325_10008594 3300031241 Bacteria 6016
243 Ga0265325_10043802 3300031241 Bacteria 2333
244 Ga0265339_10002186 3300031249 Bacteria 14187
245 Ga0265339_10002967 3300031249 Bacteria 11987
246 Ga0265316_10022270 3300031344 Bacteria 5347
247 Ga0265316_10211881 3300031344 Bacteria 1432
248 Ga0265313_10000229 3300031595 Bacteria 60627
249 Ga0265313_10000756 3300031595 Bacteria 33038
250 Ga0265313_10024495 3300031595 Bacteria 3222
251 Ga0265313_10038423 3300031595 Bacteria 2384
252 Ga0265342_10019040 3300031712 Bacteria 4432
253 Ga0307405_10306613 3300031731 Bacteria 1207
254 Ga0307411_10073075 3300032005 Bacteria 2331
255 Ga0373948_0002832 3300034817 Bacteria 2605
256 Ga0373950_0002685 3300034818 Bacteria 2473
257 Ga0373959_0004548 3300034820 Bacteria 2240
258 Ga0373926_0003388 3300035083 Bacteria 5135
259 Ga0373926_0013376 3300035083 Bacteria 2782
260 Ga0373934_0032159 3300035086 Bacteria 2057
261 Ga0373940_0009418 3300035088 Bacteria 2271
262 Ga0373944_0002120 3300035089 Bacteria 5039
263 Ga0373944_0007923 3300035089 Bacteria 2861
264 Ga0373951_0001484 3300035091 Bacteria 6116
265 Ga0373923_0013137 3300035111 Bacteria 3079
266 Ga0373936_0015393 3300035113 Bacteria 2931
267 Ga0373945_0005777 3300035116 Bacteria 3971
268 Ga0373945_0006857 3300035116 Bacteria 3681
269 Ga0373945_0012873 3300035116 Bacteria 2785
270 Ga0373954_0009184 3300035118 Bacteria 4349
271 Ga0373954_0066231 3300035118 Bacteria 1710
272 Ga0373956_0005298 3300035119 Bacteria 5164
273 Ga0373956_0025963 3300035119 Bacteria 2535
274 Ga0373956_0031963 3300035119 Bacteria 2308
275 Ga0373957_0034491 3300035120 Bacteria 1874
276 Ga0373960_0031574 3300035121 Bacteria 1482
277 Ga0373943_0000243 3300035170 Bacteria 22511
278 Ga0373943_0003448 3300035170 Bacteria 7194
279 Ga0373943_0003515 3300035170 Bacteria 7140
280 Ga0373943_0011291 3300035170 Bacteria 4018
281 Ga0373943_0015283 3300035170 Bacteria 3485
282 Ga0373943_0264762 3300035170 Bacteria 968
283 Ga0373946_0002288 3300035171 Bacteria 6774
284 Ga0373946_0007087 3300035171 Bacteria 4091
285 Ga0373946_0207669 3300035171 Bacteria 940
286 Ga0373946_0221667 3300035171 Bacteria 913
287 Ga0373955_0010791 3300035172 Bacteria 4330
288 Ga0373955_0012410 3300035172 Bacteria 4095
289 Ga0373955_0017584 3300035172 Bacteria 3541
290 Ga0373955_0031074 3300035172 Bacteria 2795
291 Ga0373955_0077332 3300035172 Bacteria 1873
292 Ga0373962_0053397 3300035242 Bacteria 1169
293 Ga0373962_0071811 3300035242 Bacteria 1036
294 Ga0373924_0017667 3300035410 Bacteria 2739
295 Ga0373924_0061456 3300035410 Bacteria 1572
296 Ga0373931_0042066 3300035691 Bacteria 2401
297 Ga0373931_0044097 3300035691 Bacteria 2351
298 Ga0373931_0080579 3300035691 Bacteria 1795
299 Ga0373931_0081558 3300035691 Bacteria 1786
300 Ga0373931_0113785 3300035691 Bacteria 1538
301 Ga0373931_0124955 3300035691 Bacteria 1474
302 Ga0373931_0130941 3300035691 Bacteria 1444
303 Ga0373935_0000598 3300035692 Bacteria 18824
304 Ga0373935_0004817 3300035692 Bacteria 7935
305 Ga0373935_0026646 3300035692 Bacteria 3570
306 Ga0373935_0043904 3300035692 Bacteria 2815
307 Ga0373935_0086050 3300035692 Bacteria 2050
308 Ga0373935_0604516 3300035692 Bacteria 802
309 Ga0373927_0000839 3300035695 Bacteria 23542
310 Ga0373927_0040276 3300035695 Bacteria 3031
311 Ga0373927_0162911 3300035695 Bacteria 1461
312 Ga0373927_0196002 3300035695 Bacteria 1325
313 Ga0373927_0325287 3300035695 Bacteria 1013
314 Ga0373933_0008478 3300035724 Bacteria 5608
315 Ga0373933_0062670 3300035724 Bacteria 2246
316 Ga0373947_0000796 3300035725 Bacteria 18989
317 Ga0373947_0005443 3300035725 Bacteria 7428
318 Ga0373947_0011402 3300035725 Bacteria 5101
319 Ga0373947_0039274 3300035725 Bacteria 2815
320 Ga0373947_0072751 3300035725 Bacteria 2111
321 Ga0373937_0000884 3300036401 Bacteria 25679
322 Ga0373937_0001791 3300036401 Bacteria 18052
323 Ga0373937_0008752 3300036401 Bacteria 8784
324 Ga0373937_0023033 3300036401 Bacteria 5602
325 Ga0373937_0023313 3300036401 Bacteria 5572
326 Ga0373937_0327393 3300036401 Bacteria 1450
327 Ga0373937_0456355 3300036401 Bacteria 1214
328 Ga0373925_0004142 3300037068 Bacteria 11003
329 Ga0373925_0005226 3300037068 Bacteria 9706
330 Ga0373925_0030758 3300037068 Bacteria 3941
331 Ga0373925_0054172 3300037068 Bacteria 2999
332 Ga0373925_0091387 3300037068 Bacteria 2327
333 Ga0373925_0290104 3300037068 Bacteria 1319
334 Ga0373925_0337621 3300037068 Bacteria 1222
335 Ga0395899_0031176 3300037312 Bacteria 4007
336 Ga0395900_0015232 3300037418 Bacteria 7841
337 Ga0395898_0080033 3300037466 Bacteria 3151
338 Ga0395898_0488432 3300037466 Bacteria 1171
339 Ga0395901_0081984 3300038443 Bacteria 3369
340 Ga0395901_0258676 3300038443 Bacteria 1812
341 Ga0436365_0932459 3300039437 Bacteria 27077
342 Ga0451807_0795980 3300041486 Bacteria 1368
343 Ga0451853_0997884 3300041512 Bacteria 2031
344 Ga0439451_018321 3300042009 Bacteria 1412
345 Ga0439446_0045767 3300042156 Bacteria 1298
346 Ga0439434_0012626 3300042435 Bacteria 2500
347 Ga0439435_0014037 3300042436 Bacteria 1972
348 Ga0439444_0001452 3300042437 Bacteria 3086
349 Ga0439444_0007512 3300042437 Bacteria 1677
350 Ga0439440_0069976 3300042993 Bacteria 912
351 Ga0466963_0008739 3300044694 Bacteria 6082
352 Ga0466968_0118290 3300044735 Bacteria 1197
353 Ga0466957_0003978 3300044842 Bacteria 8171
354 Ga0466957_0022422 3300044842 Bacteria 3726
355 Ga0466957_0099377 3300044842 Bacteria 1832
356 Ga0466959_0094922 3300045049 Bacteria 2139
357 Ga0451576_0015388 3300045051 Bacteria 8472
358 Ga0451576_0267165 3300045051 Bacteria 1788
359 Ga0466958_0026431 3300045836 Bacteria 3430
360 Ga0466958_0054032 3300045836 Bacteria 2435
361 Ga0495592_0010606 3300046454 Bacteria 6950
362 Ga0495592_0179612 3300046454 Bacteria 1442
363 Ga0495603_0000816 3300046455 Bacteria 17875
364 Ga0495603_0023995 3300046455 Bacteria 3689
365 Ga0495629_0000140 3300046459 Bacteria 63496
366 Ga0495629_0080581 3300046459 Bacteria 2272
367 Ga0495629_0093268 3300046459 Bacteria 2101
368 Ga0495638_0126630 3300046460 Bacteria 1505
369 Ga0495641_0010088 3300046461 Bacteria 5529
370 Ga0495651_0005708 3300046462 Bacteria 9485
371 Ga0495651_0053596 3300046462 Bacteria 3104
372 Ga0495651_0063109 3300046462 Bacteria 2833
373 Ga0495651_0192046 3300046462 Bacteria 1436
374 Ga0495653_0009696 3300046463 Bacteria 7874
375 Ga0495653_0074245 3300046463 Bacteria 2534
376 Ga0495580_0008507 3300046472 Bacteria 8157
377 Ga0495580_0058773 3300046472 Bacteria 2703
378 Ga0495580_0075751 3300046472 Bacteria 2347
379 Ga0495580_0078199 3300046472 Bacteria 2307
380 Ga0495582_0005878 3300046473 Bacteria 6837
381 Ga0495582_0020830 3300046473 Bacteria 3590
382 Ga0495582_0086278 3300046473 Bacteria 1747
383 Ga0495639_0001632 3300046475 Bacteria 10003
384 Ga0495639_0012276 3300046475 Bacteria 3694
385 Ga0495639_0140261 3300046475 Bacteria 1162
386 Ga0495662_0008367 3300046476 Bacteria 5088
387 Ga0495662_0026957 3300046476 Bacteria 2775
388 Ga0495662_0062796 3300046476 Bacteria 1794
389 Ga0495662_0214653 3300046476 Bacteria 948
390 Ga0495664_0005918 3300046477 Bacteria 6732
391 Ga0495664_0038354 3300046477 Bacteria 2828
392 Ga0495664_0153859 3300046477 Bacteria 1395
393 Ga0495584_0009796 3300046491 Bacteria 4930
394 Ga0495585_0002257 3300046492 Bacteria 13934
395 Ga0495594_0099842 3300046499 Bacteria 1632
396 Ga0495607_0037500 3300046501 Bacteria 2911
397 Ga0495607_0120896 3300046501 Bacteria 1375
398 Ga0495608_0004898 3300046511 Bacteria 9586
399 Ga0495608_0023230 3300046511 Bacteria 4250
400 Ga0495608_0094367 3300046511 Bacteria 1933
401 Ga0495608_0238621 3300046511 Bacteria 1136
402 Ga0495618_0039395 3300046514 Bacteria 2970
403 Ga0495618_0204663 3300046514 Bacteria 1249
404 Ga0495618_0305726 3300046514 Bacteria 987
405 Ga0495628_0000915 3300046516 Bacteria 27087
406 Ga0495628_0252424 3300046516 Bacteria 1316
407 Ga0495630_0007486 3300046517 Bacteria 7804
408 Ga0495630_0012741 3300046517 Bacteria 6107
409 Ga0495630_0023615 3300046517 Bacteria 4545
410 Ga0495630_0056745 3300046517 Bacteria 2934
411 Ga0495630_0058850 3300046517 Bacteria 2881
412 Ga0495630_0144516 3300046517 Bacteria 1809
413 Ga0495630_0333224 3300046517 Bacteria 1161
414 Ga0495631_0023242 3300046518 Bacteria 2876
415 Ga0495637_0091425 3300046520 Bacteria 1200
416 Ga0495643_0035193 3300046522 Bacteria 2759
417 Ga0495644_0001244 3300046523 Bacteria 10440
418 Ga0495648_0042339 3300046524 Bacteria 2866
419 Ga0495663_0009554 3300046525 Bacteria 2690
420 Ga0495666_0007872 3300046526 Bacteria 5337
421 Ga0495666_0072658 3300046526 Bacteria 1633
422 Ga0495666_0277904 3300046526 Bacteria 759
423 Ga0495652_0032347 3300046529 Bacteria 4575
424 Ga0495652_0061068 3300046529 Bacteria 3183
425 Ga0495652_0072535 3300046529 Bacteria 2869
426 Ga0495652_0077672 3300046529 Bacteria 2751
427 Ga0495652_0234771 3300046529 Bacteria 1369
428 Ga0495665_0004725 3300046531 Bacteria 7354
429 Ga0495665_0015991 3300046531 Bacteria 4043
430 Ga0495665_0086018 3300046531 Bacteria 1652
431 Ga0495640_0000714 3300046533 Bacteria 24847
432 Ga0495640_0007049 3300046533 Bacteria 8847
433 Ga0495640_0045460 3300046533 Bacteria 3046
434 Ga0495640_0190085 3300046533 Bacteria 1305
435 Ga0495586_0000698 3300046535 Bacteria 19053
436 Ga0495586_0004411 3300046535 Bacteria 7512
437 Ga0495586_0009052 3300046535 Bacteria 5294
438 Ga0495587_0007895 3300046536 Bacteria 6874
439 Ga0495587_0017665 3300046536 Bacteria 4429
440 Ga0495587_0017984 3300046536 Bacteria 4383
441 Ga0495587_0025045 3300046536 Bacteria 3650
442 Ga0495587_0037674 3300046536 Bacteria 2902
443 Ga0495645_0001324 3300046543 Bacteria 16792
444 Ga0495645_0002355 3300046543 Bacteria 12822
445 Ga0495645_0123799 3300046543 Bacteria 1818
446 Ga0495622_0011854 3300046557 Bacteria 4030
447 Ga0495633_0006563 3300046558 Bacteria 6877
448 Ga0495667_0004023 3300046559 Bacteria 9883
449 Ga0495667_0004720 3300046559 Bacteria 9213
450 Ga0495667_0005868 3300046559 Bacteria 8317
451 Ga0495667_0187173 3300046559 Bacteria 1327
452 Ga0495656_0003395 3300046615 Bacteria 5386
453 Ga0495656_0007639 3300046615 Bacteria 3832
454 Ga0495634_0003402 3300046642 Bacteria 12776
455 Ga0495634_0004925 3300046642 Bacteria 10328
456 Ga0495634_0081653 3300046642 Bacteria 2113
457 Ga0495634_0293741 3300046642 Bacteria 984
458 Ga0495635_0002459 3300046663 Bacteria 12647
459 Ga0495635_0018448 3300046663 Bacteria 4869
460 Ga0495635_0066698 3300046663 Bacteria 2468
461 Ga0495659_0002292 3300046664 Bacteria 6207
462 Ga0495659_0038500 3300046664 Bacteria 1698
463 Ga0495661_0039401 3300046665 Bacteria 2937
464 Ga0495588_0118332 3300046674 Bacteria 1396
465 Ga0495657_0032788 3300046675 Bacteria 3622
466 Ga0495657_0035218 3300046675 Bacteria 3471
467 Ga0495657_0141207 3300046675 Bacteria 1501
468 Ga0495599_0005271 3300046678 Bacteria 7714
469 Ga0495599_0008419 3300046678 Bacteria 6269
470 Ga0495599_0026248 3300046678 Bacteria 3650
471 Ga0495599_0026682 3300046678 Bacteria 3621
472 Ga0495599_0174668 3300046678 Bacteria 1325
473 Ga0495599_0214759 3300046678 Bacteria 1178
474 Ga0495623_0032008 3300046679 Bacteria 3381
475 Ga0495623_0271517 3300046679 Bacteria 947
476 Ga0495646_0048746 3300046680 Bacteria 2572
477 Ga0495646_0078337 3300046680 Bacteria 1931
478 Ga0495646_0110191 3300046680 Bacteria 1568
479 Ga0495647_0000575 3300046681 Bacteria 10842
480 Ga0495647_0003703 3300046681 Bacteria 4909
481 Ga0495658_0009443 3300046683 Bacteria 4863
482 Ga0495658_0043562 3300046683 Bacteria 2511
483 Ga0495658_0057238 3300046683 Bacteria 2226
484 Ga0495658_0155185 3300046683 Bacteria 1408
485 Ga0495658_0320832 3300046683 Bacteria 982
486 Ga0495669_0001950 3300046684 Bacteria 8478
487 Ga0495613_0040585 3300046689 Bacteria 3448
488 Ga0495613_0043171 3300046689 Bacteria 3335
489 Ga0495613_0056141 3300046689 Bacteria 2892
490 Ga0495613_0100555 3300046689 Bacteria 2088
491 Ga0495624_0002424 3300046690 Bacteria 14161
492 Ga0495624_0010799 3300046690 Bacteria 6295
493 Ga0495670_0006450 3300046691 Bacteria 5762
494 Ga0495600_0001615 3300046809 Bacteria 12569
495 Ga0495600_0009440 3300046809 Bacteria 6027
496 Ga0495600_0073084 3300046809 Bacteria 2239
497 Ga0495600_0092534 3300046809 Bacteria 1972
498 Ga0495600_0132919 3300046809 Bacteria 1617
499 Ga0495581_0006982 3300047315 Bacteria 6542
500 Ga0495581_0020190 3300047315 Bacteria 3868
501 Ga0495604_0005164 3300047317 Bacteria 10338
502 Ga0495604_0023059 3300047317 Bacteria 4967
503 Ga0495604_0049732 3300047317 Bacteria 3255
504 Ga0495604_0135662 3300047317 Bacteria 1764
505 Ga0495636_0114058 3300047318 Bacteria 1191
506 Ga0495674_0010265 3300047319 Bacteria 8868
507 Ga0495674_0062097 3300047319 Bacteria 3254
508 Ga0495674_0178681 3300047319 Bacteria 1768
509 Ga0495674_0298598 3300047319 Bacteria 1316
510 Ga0495674_0308238 3300047319 Bacteria 1292
511 Ga0495676_0012611 3300047321 Bacteria 7610
512 Ga0495676_0017588 3300047321 Bacteria 6317
513 Ga0495676_0179219 3300047321 Bacteria 1486
514 Ga0495676_0245002 3300047321 Bacteria 1225
515 Ga0495680_0004292 3300047322 Bacteria 13673
516 Ga0495680_0005608 3300047322 Bacteria 11762
517 Ga0495680_0100610 3300047322 Bacteria 2154
518 Ga0495675_0003024 3300047444 Bacteria 10101
519 Ga0495675_0222609 3300047444 Bacteria 1141
520 Ga0495684_0007919 3300047471 Bacteria 8218
521 Ga0495684_0012213 3300047471 Bacteria 6626
522 Ga0495684_0026729 3300047471 Bacteria 4435
523 Ga0495593_0015602 3300047673 Bacteria 4299
524 Ga0495593_0024515 3300047673 Bacteria 3343
525 Ga0495593_0085877 3300047673 Bacteria 1623
526 Ga0495602_0007001 3300048088 Bacteria 11838
527 Ga0495602_0043428 3300048088 Bacteria 4087
528 Ga0495614_0003972 3300048089 Bacteria 6640
529 Ga0496100_0021779 3300048903 Bacteria 3867
530 Ga0496100_0207180 3300048903 Bacteria 1432
531 Ga0496101_0026703 3300048904 Bacteria 4015
532 Ga0496102_0075742 3300048905 Bacteria 3093
533 Ga0496102_0083219 3300048905 Bacteria 2952
534 Ga0496102_0097159 3300048905 Bacteria 2731
535 Ga0496104_0023005 3300048907 Bacteria 5727
536 Ga0496105_0001448 3300048908 Bacteria 16699
537 Ga0496106_0041307 3300048909 Bacteria 3455
538 Ga0496107_0015114 3300048910 Bacteria 5407
539 Ga0496107_0055899 3300048910 Bacteria 2850
540 Ga0496108_0074080 3300048911 Bacteria 2875
541 Ga0496108_0105136 3300048911 Bacteria 2410
542 Ga0496109_0562487 3300048912 Bacteria 1075
543 Ga0496110_0028356 3300048913 Bacteria 4808
544 Ga0496110_0058864 3300048913 Bacteria 3385
545 Ga0496110_0189216 3300048913 Bacteria 1869
546 Ga0496111_0105571 3300048914 Bacteria 2073
547 Ga0496111_0117118 3300048914 Bacteria 1965
548 Ga0496112_0044146 3300048915 Bacteria 4367
549 Ga0496112_0174051 3300048915 Bacteria 2117
550 Ga0496114_0002900 3300048917 Bacteria 13140
551 Ga0496115_0008715 3300048918 Bacteria 7517
552 Ga0496117_0079713 3300048920 Bacteria 2156
553 Ga0496117_0141621 3300048920 Bacteria 1439
554 Ga0496118_0011606 3300048921 Bacteria 8578
555 Ga0496119_0144159 3300048922 Bacteria 1283
556 Ga0496121_0007736 3300048924 Bacteria 12882
557 Ga0496121_0011689 3300048924 Bacteria 9696
558 Ga0496123_0230930 3300048926 Bacteria 926
559 Ga0496124_0285354 3300048927 Bacteria 1201
560 Ga0496126_0076508 3300048929 Bacteria 2969
561 Ga0501031_0007697 3300049568 Bacteria 7013
562 Ga0501031_0037798 3300049568 Bacteria 3151
563 Ga0501031_0287584 3300049568 Bacteria 1066
564 Ga0501032_0012676 3300049569 Bacteria 6011
565 Ga0501032_0047591 3300049569 Bacteria 2895
566 Ga0501032_0114788 3300049569 Bacteria 1781
567 Ga0501033_0000969 3300049570 Bacteria 26048
568 Ga0501033_0010744 3300049570 Bacteria 7018
569 Ga0501033_0014803 3300049570 Bacteria 5922
570 Ga0501034_0069583 3300049571 Bacteria 3530
571 Ga0501034_0079371 3300049571 Bacteria 3285
572 Ga0501034_0255970 3300049571 Bacteria 1694
573 Ga0501034_0265707 3300049571 Bacteria 1658
574 Ga0501034_0371285 3300049571 Bacteria 1357
575 Ga0501036_0000528 3300049572 Bacteria 27463
576 Ga0501036_0001896 3300049572 Bacteria 16262
577 Ga0501036_0014938 3300049572 Bacteria 6477
578 Ga0501036_0073557 3300049572 Bacteria 2889
579 Ga0501036_0147985 3300049572 Bacteria 1981
580 Ga0501036_0234215 3300049572 Bacteria 1540
581 Ga0501036_0433156 3300049572 Bacteria 1096
582 Ga0501037_0013364 3300049573 Bacteria 6048
583 Ga0501037_0034705 3300049573 Bacteria 3721
584 Ga0501037_0102365 3300049573 Bacteria 2066
585 Ga0501037_0385701 3300049573 Bacteria 962
586 Ga0501038_0004135 3300049574 Bacteria 13511
587 Ga0501038_0011296 3300049574 Bacteria 8152
588 Ga0501038_0077934 3300049574 Bacteria 2797
589 Ga0501038_0104400 3300049574 Bacteria 2355
590 Ga0501038_0118204 3300049574 Bacteria 2189
591 Ga0501039_0000053 3300049575 Bacteria 94861
592 Ga0501039_0004579 3300049575 Bacteria 10449
593 Ga0501039_0028342 3300049575 Bacteria 4311
594 Ga0501039_0034849 3300049575 Bacteria 3884
595 Ga0501039_0066303 3300049575 Bacteria 2802
596 Ga0501039_0105979 3300049575 Bacteria 2195
597 Ga0501039_0155028 3300049575 Bacteria 1799
598 Ga0501040_0000761 3300049576 Bacteria 19995
599 Ga0501040_0002928 3300049576 Bacteria 11043
600 Ga0501040_0010125 3300049576 Bacteria 6163
601 Ga0501040_0012485 3300049576 Bacteria 5567
602 Ga0501040_0063836 3300049576 Bacteria 2535
603 Ga0501040_0067346 3300049576 Bacteria 2467
604 Ga0501041_0000066 3300049577 Bacteria 39606
605 Ga0501041_0005396 3300049577 Bacteria 7491
606 Ga0501042_0003840 3300049578 Bacteria 9501
607 Ga0501042_0007088 3300049578 Bacteria 7324
608 Ga0501042_0080111 3300049578 Bacteria 2340
609 Ga0501042_0118479 3300049578 Bacteria 1906
610 Ga0501042_0196660 3300049578 Bacteria 1454
611 Ga0501043_0013794 3300049579 Bacteria 6324
612 Ga0501043_0018617 3300049579 Bacteria 5450
613 Ga0501043_0097328 3300049579 Bacteria 2313
614 Ga0501043_0142012 3300049579 Bacteria 1880
615 Ga0501043_0240218 3300049579 Bacteria 1397
616 Ga0501046_0000927 3300049580 Bacteria 28785
617 Ga0501046_0002981 3300049580 Bacteria 15644
618 Ga0501046_0004708 3300049580 Bacteria 12308
619 Ga0501046_0042639 3300049580 Bacteria 3617
620 Ga0501046_0082367 3300049580 Bacteria 2485
621 Ga0501046_0082633 3300049580 Bacteria 2480
622 Ga0501046_0103981 3300049580 Bacteria 2177
623 Ga0501047_0002326 3300049581 Bacteria 18154
624 Ga0501047_0046651 3300049581 Bacteria 4187
625 Ga0501047_0057336 3300049581 Bacteria 3767
626 Ga0501048_0000221 3300049582 Bacteria 37331
627 Ga0501048_0003011 3300049582 Bacteria 12860
628 Ga0501048_0011184 3300049582 Bacteria 6690
629 Ga0501048_0016864 3300049582 Bacteria 5384
630 Ga0501048_0046995 3300049582 Bacteria 3081
631 Ga0501048_0130282 3300049582 Bacteria 1778
632 Ga0501067_0039738 3300049583 Bacteria 2612
633 Ga0501068_0057648 3300049584 Bacteria 2355
634 Ga0501069_0058755 3300049585 Bacteria 2145
635 Ga0501069_0213966 3300049585 Bacteria 1119
636 Ga0501069_0361334 3300049585 Bacteria 857
637 Ga0501070_0001477 3300049586 Bacteria 21037
638 Ga0501070_0020457 3300049586 Bacteria 5551
639 Ga0501070_0054411 3300049586 Bacteria 3319
640 Ga0501070_0055424 3300049586 Bacteria 3285
641 Ga0501070_0104869 3300049586 Bacteria 2337
642 Ga0501070_0127135 3300049586 Bacteria 2106
643 Ga0501070_0210497 3300049586 Bacteria 1596
644 Ga0501070_0516541 3300049586 Bacteria 958
645 Ga0501071_0000078 3300049587 Bacteria 34978
646 Ga0501071_0001262 3300049587 Bacteria 14342
647 Ga0501071_0037408 3300049587 Bacteria 3466
648 Ga0501071_0042700 3300049587 Bacteria 3250
649 Ga0501071_0110723 3300049587 Bacteria 2029
650 Ga0501072_0000105 3300049588 Bacteria 62421
651 Ga0501072_0006341 3300049588 Bacteria 9009
652 Ga0501072_0013652 3300049588 Bacteria 6219
653 Ga0501072_0579758 3300049588 Bacteria 885
654 Ga0501073_0024329 3300049589 Bacteria 4348
655 Ga0501074_0014441 3300049590 Bacteria 5747
656 Ga0501074_0032389 3300049590 Bacteria 3787
657 Ga0501074_0056359 3300049590 Bacteria 2832
658 Ga0501074_0147545 3300049590 Bacteria 1682
659 Ga0501074_0278443 3300049590 Bacteria 1189
660 Ga0501074_0285056 3300049590 Bacteria 1174
661 Ga0501075_0001570 3300049591 Bacteria 14931
662 Ga0501075_0002758 3300049591 Bacteria 11765
663 Ga0501075_0004043 3300049591 Bacteria 9896
664 Ga0501075_0086510 3300049591 Bacteria 2375
665 Ga0501075_0222948 3300049591 Bacteria 1438
666 Ga0501076_0002055 3300049592 Bacteria 13788
667 Ga0501076_0002404 3300049592 Bacteria 12827
668 Ga0501076_0010217 3300049592 Bacteria 6957
669 Ga0501076_0107569 3300049592 Bacteria 2252
670 Ga0501076_0186019 3300049592 Bacteria 1694
671 Ga0501076_0220064 3300049592 Bacteria 1552
672 Ga0501077_0000154 3300049593 Bacteria 38428
673 Ga0501077_0002379 3300049593 Bacteria 11287
674 Ga0501077_0028213 3300049593 Bacteria 3567
675 Ga0501077_0053871 3300049593 Bacteria 2554
676 Ga0501079_0000213 3300049741 Bacteria 34053
677 Ga0501079_0001492 3300049741 Bacteria 16563
678 Ga0501079_0030304 3300049741 Bacteria 4157
679 Ga0501079_0055081 3300049741 Bacteria 3069
680 Ga0501079_0087547 3300049741 Bacteria 2411
681 Ga0501079_0203296 3300049741 Bacteria 1547
682 Ga0501079_0232075 3300049741 Bacteria 1441
683 Ga0501080_0001183 3300049742 Bacteria 21629
684 Ga0501080_0013912 3300049742 Bacteria 7407
685 Ga0501080_0057466 3300049742 Bacteria 3622
686 Ga0501080_0110919 3300049742 Bacteria 2542
687 Ga0501080_0193397 3300049742 Bacteria 1869
688 Ga0501080_0281998 3300049742 Bacteria 1510
689 Ga0501081_0000630 3300049743 Bacteria 20114
690 Ga0501081_0006277 3300049743 Bacteria 7705
691 Ga0501081_0009585 3300049743 Bacteria 6314
692 Ga0501081_0025497 3300049743 Bacteria 3977
693 Ga0501081_0055686 3300049743 Bacteria 2732
694 Ga0501081_0074580 3300049743 Bacteria 2367
695 Ga0501081_0134530 3300049743 Bacteria 1769
696 Ga0501083_0005838 3300049744 Bacteria 8717
697 Ga0501083_0005926 3300049744 Bacteria 8653
698 Ga0501083_0150088 3300049744 Bacteria 1526
699 Ga0501035_0001020 3300049822 Bacteria 29508
700 Ga0501035_0005945 3300049822 Bacteria 11490
701 Ga0501035_0016613 3300049822 Bacteria 6785
702 Ga0501035_0058220 3300049822 Bacteria 3444
703 Ga0501035_0186422 3300049822 Bacteria 1785
704 Ga0501035_0215362 3300049822 Bacteria 1642
705 Ga0501044_0079833 3300049823 Bacteria 3314
706 Ga0501044_0379439 3300049823 Bacteria 1329
707 Ga0501045_0000451 3300049824 Bacteria 25372
708 Ga0501045_0001082 3300049824 Bacteria 18002
709 Ga0501045_0018252 3300049824 Bacteria 4989
710 Ga0501045_0053252 3300049824 Bacteria 2957
711 Ga0501045_0211635 3300049824 Bacteria 1444
712 Ga0501045_0238422 3300049824 Bacteria 1354
713 nmdc:mga0yw44_237659_c1 3300050492 Bacteria 1210
714 nmdc:mga0k408_21210_c1 3300050493 Bacteria 3648
715 nmdc:mga05p37_122041_c1 3300050507 Bacteria 3200
716 nmdc:mga05p37_1543_c1 3300050507 Bacteria 26771
717 nmdc:mga05p37_20486_c1 3300050507 Bacteria 8000
718 nmdc:mga05p37_370618_c1 3300050507 Bacteria 1680
719 nmdc:mga05p37_91717_c1 3300050507 Bacteria 3743
720 nmdc:mga09592_175084_c1 3300050508 Bacteria 1856
721 nmdc:mga09592_218931_c1 3300050508 Bacteria 1650
722 nmdc:mga09592_32945_c1 3300050508 Bacteria 4322
723 nmdc:mga09592_444636_c1 3300050508 Bacteria 1119
724 nmdc:mga09592_801_c1 3300050508 Bacteria 24351
725 nmdc:mga0qj67_114522_c1 3300050509 Bacteria 2178
726 nmdc:mga0qj67_136848_c1 3300050509 Bacteria 1985
727 nmdc:mga0qj67_258065_c1 3300050509 Bacteria 1414
728 nmdc:mga0qj67_30034_c1 3300050509 Bacteria 4226
729 nmdc:mga06r32_293_c1 3300050510 Bacteria 41537
730 nmdc:mga06r32_30198_c1 3300050510 Bacteria 5085
731 nmdc:mga06r32_322185_c1 3300050510 Bacteria 1531
732 nmdc:mga08y16_11098_c1 3300050511 Bacteria 9459
733 nmdc:mga08y16_233962_c1 3300050511 Bacteria 1900
734 nmdc:mga08y16_313918_c1 3300050511 Bacteria 1614
735 nmdc:mga08y16_4235_c1 3300050511 Bacteria 14970
736 nmdc:mga0n895_100752_c1 3300050512 Bacteria 2898
737 nmdc:mga0n895_18001_c1 3300050512 Bacteria 6530
738 nmdc:mga0n895_182053_c1 3300050512 Bacteria 2133
739 nmdc:mga0n895_363381_c1 3300050512 Bacteria 1466
740 nmdc:mga0n895_6296_c1 3300050512 Bacteria 10064
741 nmdc:mga0rr50_10311_c1 3300050513 Bacteria 5923
742 nmdc:mga0rr50_103133_c1 3300050513 Bacteria 2245
743 nmdc:mga0rr50_162042_c1 3300050513 Bacteria 1816
744 nmdc:mga0rr50_35947_c1 3300050513 Bacteria 3563
745 nmdc:mga08x19_2410_c1 3300050514 Bacteria 11344
746 nmdc:mga08x19_58983_c1 3300050514 Bacteria 2484
747 nmdc:mga08x19_70941_c1 3300050514 Bacteria 2271
748 nmdc:mga0a205_111119_c1 3300050515 Bacteria 2639
749 nmdc:mga0a205_323769_c1 3300050515 Bacteria 1412
750 nmdc:mga0a205_3271_c1 3300050515 Bacteria 14414
751 nmdc:mga0a205_441823_c1 3300050515 Bacteria 1161
752 nmdc:mga0a205_58114_c2 3300050515 Bacteria 3429
753 Ga0495601_0000210 3300053077 Bacteria 31274
754 Ga0495601_0019507 3300053077 Bacteria 4135
755 Ga0495601_0054653 3300053077 Bacteria 2526
756 Ga0495612_0000251 3300053078 Bacteria 22251
757 Ga0495612_0000283 3300053078 Bacteria 20869
758 Ga0495612_0015276 3300053078 Bacteria 3078
759 Ga0495612_0077816 3300053078 Bacteria 1390
760 Ga0495595_0002747 3300053084 Bacteria 6910
761 Ga0495595_0008339 3300053084 Bacteria 4253
762 Ga0495595_0029673 3300053084 Bacteria 2449
763 Ga0495595_0141081 3300053084 Bacteria 1182
764 Ga0495619_0000384 3300053085 Bacteria 30338
765 Ga0495619_0002085 3300053085 Bacteria 13284
766 Ga0495619_0012701 3300053085 Bacteria 5301
767 Ga0495619_0047152 3300053085 Bacteria 2836
768 Ga0495619_0163759 3300053085 Bacteria 1536
769 Ga0495619_0177259 3300053085 Bacteria 1474
770 Ga0495619_0236001 3300053085 Bacteria 1267
771 Ga0500651_0015632 3300053093 Bacteria 4661
772 Ga0500641_0020806 3300053096 Bacteria 2493
773 Ga0500594_0022650 3300053118 Bacteria 1586
774 Ga0500595_005025 3300053119 Bacteria 5821
775 Ga0500642_0001575 3300053130 Bacteria 6575
776 Ga0500604_0040369 3300053151 Bacteria 1407
777 Ga0501084_0000457 3300054114 Bacteria 31427
778 Ga0501084_0000671 3300054114 Bacteria 26137
779 Ga0501084_0032049 3300054114 Bacteria 4396
780 Ga0501084_0091849 3300054114 Bacteria 2549
781 Ga0501082_0008513 3300060353 Bacteria 8846
782 Ga0501082_0012045 3300060353 Bacteria 7431
783 Ga0501082_0055854 3300060353 Bacteria 3401
784 Ga0501082_0082032 3300060353 Bacteria 2782
785 Ga0501082_0231448 3300060353 Bacteria 1608
786 Ga0501082_0283949 3300060353 Bacteria 1441
787 Ga0501082_0344045 3300060353 Bacteria 1300
788 Ga0530510_0000714 3300061734 Bacteria 21552
789 Ga0530510_0001614 3300061734 Bacteria 15223
790 Ga0530510_0011122 3300061734 Bacteria 6312
791 Ga0530510_0024870 3300061734 Bacteria 4279
792 Ga0530510_0069821 3300061734 Bacteria 2549

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0026431 Ga0466958_0026431_2674_3405 225
2 3300035171 Ga0373946_0207669 Ga0373946_0207669_16_747 243
3 3300035695 Ga0373927_0325287 Ga0373927_0325287_17_748 243
4 3300046501 Ga0495607_0120896 Ga0495607_0120896_20_751 243
5 3300046526 Ga0495666_0277904 Ga0495666_0277904_16_747 243
6 3300048905 Ga0496102_0075742 Ga0496102_0075742_28_759 243
7 3300049743 Ga0501081_0134530 Ga0501081_0134530_10_741 243
8 3300050507 nmdc:mga05p37_122041_c1 nmdc:mga05p37_122041_c1_26_757 243
9 3300050508 nmdc:mga09592_218931_c1 nmdc:mga09592_218931_c1_18_749 243
10 3300050514 nmdc:mga08x19_2410_c1 nmdc:mga08x19_2410_c1_514_1377 243
11 3300006844 Ga0075428_100158465 Ga0075428_1001584652 244
12 3300035692 Ga0373935_0604516 Ga0373935_0604516_20_787 248
13 3300042009 Ga0439451_018321 Ga0439451_018321_569_1384 250
14 3300060353 Ga0501082_0008513 Ga0501082_0008513_7492_8307 250
15 3300050508 nmdc:mga09592_444636_c1 nmdc:mga09592_444636_c1_15_830 251
16 3300050511 nmdc:mga08y16_233962_c1 nmdc:mga08y16_233962_c1_683_1546 251
17 3300035083 Ga0373926_0003388 Ga0373926_0003388_1469_2332 252
18 3300035089 Ga0373944_0007923 Ga0373944_0007923_868_1731 252
19 3300035113 Ga0373936_0015393 Ga0373936_0015393_776_1639 252
20 3300035116 Ga0373945_0006857 Ga0373945_0006857_1760_2623 252
21 3300035170 Ga0373943_0015283 Ga0373943_0015283_42_905 252
22 3300035171 Ga0373946_0007087 Ga0373946_0007087_631_1494 252
23 3300037068 Ga0373925_0054172 Ga0373925_0054172_1200_2063 252
24 3300046472 Ga0495580_0008507 Ga0495580_0008507_5825_6688 252
25 3300046475 Ga0495639_0012276 Ga0495639_0012276_1379_2242 252
26 3300046535 Ga0495586_0004411 Ga0495586_0004411_3852_4715 252
27 3300046674 Ga0495588_0118332 Ga0495588_0118332_331_1194 252
28 3300046681 Ga0495647_0000575 Ga0495647_0000575_3015_3878 252
29 3300046683 Ga0495658_0057238 Ga0495658_0057238_642_1505 252
30 3300006844 Ga0075428_100619032 Ga0075428_1006190321 254
31 3300006847 Ga0075431_100000372 Ga0075431_10000037233 254
32 3300050508 nmdc:mga09592_175084_c1 nmdc:mga09592_175084_c1_515_1366 254
33 3300050509 nmdc:mga0qj67_30034_c1 nmdc:mga0qj67_30034_c1_3008_3859 254
34 3300050510 nmdc:mga06r32_293_c1 nmdc:mga06r32_293_c1_3898_4749 254
35 3300046522 Ga0495643_0035193 Ga0495643_0035193_1493_2356 255
36 3300048903 Ga0496100_0207180 Ga0496100_0207180_15_782 255
37 3300048926 Ga0496123_0230930 Ga0496123_0230930_36_806 255
38 3300049585 Ga0501069_0361334 Ga0501069_0361334_76_843 255
39 3300005842 Ga0068858_100072953 Ga0068858_1000729532 256
40 3300006852 Ga0075433_10001929 Ga0075433_100019298 256
41 3300006871 Ga0075434_100000818 Ga0075434_10000081824 256
42 3300006914 Ga0075436_100000149 Ga0075436_10000014916 256
43 3300007076 Ga0075435_100001280 Ga0075435_10000128014 256
44 3300009094 Ga0111539_10008534 Ga0111539_100085346 256
45 3300026035 Ga0207703_10056292 Ga0207703_100562922 256
46 3300027907 Ga0207428_10030877 Ga0207428_100308772 256
47 3300050511 nmdc:mga08y16_11098_c1 nmdc:mga08y16_11098_c1_5237_6100 256
48 3300050512 nmdc:mga0n895_6296_c1 nmdc:mga0n895_6296_c1_5028_5891 256
49 3300050513 nmdc:mga0rr50_35947_c1 nmdc:mga0rr50_35947_c1_1711_2574 256
50 3300050514 nmdc:mga08x19_70941_c1 nmdc:mga08x19_70941_c1_281_1144 256
51 3300050515 nmdc:mga0a205_3271_c1 nmdc:mga0a205_3271_c1_4174_5037 256
52 3300050515 nmdc:mga0a205_58114_c2 nmdc:mga0a205_58114_c2_2602_3417 256
53 3300020070 Ga0206356_10750345 Ga0206356_107503451 257
54 3300042993 Ga0439440_0069976 Ga0439440_0069976_12_851 258
55 3300005518 Ga0070699_100004915 Ga0070699_1000049152 259
56 3300046529 Ga0495652_0077672 Ga0495652_0077672_1959_2738 259
57 3300049744 Ga0501083_0150088 Ga0501083_0150088_13_855 259
58 3300046501 Ga0495607_0037500 Ga0495607_0037500_15_797 260
59 3300047318 Ga0495636_0114058 Ga0495636_0114058_10_792 260
60 3300005985 Ga0081539_10039242 Ga0081539_100392422 261
61 3300005440 Ga0070705_100001759 Ga0070705_1000017591 262
62 3300031241 Ga0265325_10008594 Ga0265325_100085942 262
63 3300031595 Ga0265313_10000229 Ga0265313_1000022949 262
64 3300049571 Ga0501034_0371285 Ga0501034_0371285_14_802 262
65 3300005439 Ga0070711_100104818 Ga0070711_1001048182 263
66 3300006175 Ga0070712_100003223 Ga0070712_1000032238 263
67 3300025915 Ga0207693_10001925 Ga0207693_100019259 263
68 3300046473 Ga0495582_0086278 Ga0495582_0086278_592_1443 263
69 3300005436 Ga0070713_100037168 Ga0070713_1000371683 264
70 3300005536 Ga0070697_100060873 Ga0070697_1000608734 264
71 3300048913 Ga0496110_0028356 Ga0496110_0028356_1313_2176 264
72 3300048915 Ga0496112_0174051 Ga0496112_0174051_1227_2090 264
73 3300049742 Ga0501080_0281998 Ga0501080_0281998_627_1487 264
74 3300050512 nmdc:mga0n895_363381_c1 nmdc:mga0n895_363381_c1_480_1343 264
75 3300005985 Ga0081539_10004540 Ga0081539_1000454020 265
76 3300006846 Ga0075430_100303128 Ga0075430_1003031282 265
77 3300032005 Ga0307411_10073075 Ga0307411_100730752 265
78 3300049568 Ga0501031_0037798 Ga0501031_0037798_2016_2876 265
79 3300049570 Ga0501033_0000969 Ga0501033_0000969_17031_17891 265
80 3300049572 Ga0501036_0000528 Ga0501036_0000528_4217_5077 265
81 3300049573 Ga0501037_0385701 Ga0501037_0385701_61_921 265
82 3300049574 Ga0501038_0004135 Ga0501038_0004135_5105_5965 265
83 3300049575 Ga0501039_0000053 Ga0501039_0000053_10589_11449 265
84 3300049576 Ga0501040_0002928 Ga0501040_0002928_2160_3020 265
85 3300049577 Ga0501041_0000066 Ga0501041_0000066_19578_20438 265
86 3300049578 Ga0501042_0007088 Ga0501042_0007088_2844_3704 265
87 3300049579 Ga0501043_0018617 Ga0501043_0018617_1164_2024 265
88 3300049580 Ga0501046_0000927 Ga0501046_0000927_22764_23624 265
89 3300049581 Ga0501047_0057336 Ga0501047_0057336_744_1604 265
90 3300049582 Ga0501048_0000221 Ga0501048_0000221_28121_28981 265
91 3300049587 Ga0501071_0001262 Ga0501071_0001262_7339_8199 265
92 3300049588 Ga0501072_0000105 Ga0501072_0000105_21552_22412 265
93 3300049590 Ga0501074_0056359 Ga0501074_0056359_1153_2013 265
94 3300049591 Ga0501075_0004043 Ga0501075_0004043_6877_7737 265
95 3300049592 Ga0501076_0186019 Ga0501076_0186019_379_1242 265
96 3300049593 Ga0501077_0000154 Ga0501077_0000154_14855_15715 265
97 3300049741 Ga0501079_0001492 Ga0501079_0001492_8158_9018 265
98 3300049743 Ga0501081_0000630 Ga0501081_0000630_6996_7856 265
99 3300049822 Ga0501035_0005945 Ga0501035_0005945_2140_3000 265
100 3300049824 Ga0501045_0000451 Ga0501045_0000451_12259_13119 265
101 3300050509 nmdc:mga0qj67_258065_c1 nmdc:mga0qj67_258065_c1_379_1242 265
102 3300054114 Ga0501084_0000671 Ga0501084_0000671_21586_22446 265
103 3300061734 Ga0530510_0000714 Ga0530510_0000714_17713_18573 265
104 3300005546 Ga0070696_100003737 Ga0070696_1000037374 266
105 3300025928 Ga0207700_10566160 Ga0207700_105661601 266
106 3300042436 Ga0439435_0014037 Ga0439435_0014037_1067_1930 266
107 3300042437 Ga0439444_0007512 Ga0439444_0007512_285_1148 266
108 3300049572 Ga0501036_0147985 Ga0501036_0147985_861_1724 266
109 3300049574 Ga0501038_0077934 Ga0501038_0077934_1039_1902 266
110 3300049575 Ga0501039_0034849 Ga0501039_0034849_1776_2639 266
111 3300049575 Ga0501039_0105979 Ga0501039_0105979_168_1031 266
112 3300049576 Ga0501040_0012485 Ga0501040_0012485_1483_2346 266
113 3300049576 Ga0501040_0067346 Ga0501040_0067346_713_1576 266
114 3300049578 Ga0501042_0080111 Ga0501042_0080111_22_885 266
115 3300049579 Ga0501043_0142012 Ga0501043_0142012_946_1809 266
116 3300049580 Ga0501046_0082367 Ga0501046_0082367_1059_1922 266
117 3300049582 Ga0501048_0046995 Ga0501048_0046995_1730_2593 266
118 3300049591 Ga0501075_0001570 Ga0501075_0001570_7996_8859 266
119 3300049592 Ga0501076_0002055 Ga0501076_0002055_35_898 266
120 3300049593 Ga0501077_0053871 Ga0501077_0053871_403_1266 266
121 3300049741 Ga0501079_0055081 Ga0501079_0055081_1022_1885 266
122 3300049742 Ga0501080_0057466 Ga0501080_0057466_2277_3140 266
123 3300049743 Ga0501081_0009585 Ga0501081_0009585_4195_5058 266
124 3300049824 Ga0501045_0053252 Ga0501045_0053252_1119_1982 266
125 3300049824 Ga0501045_0211635 Ga0501045_0211635_231_1094 266
126 3300060353 Ga0501082_0231448 Ga0501082_0231448_708_1571 266
127 3300061734 Ga0530510_0001614 Ga0530510_0001614_9850_10713 266
128 3300005436 Ga0070713_100065604 Ga0070713_1000656042 267
129 3300009147 Ga0114129_10666523 Ga0114129_106665231 267
130 3300009147 Ga0114129_10828921 Ga0114129_108289211 267
131 3300025936 Ga0207670_10240190 Ga0207670_102401902 267
132 3300027614 Ga0209970_1010326 Ga0209970_10103262 267
133 3300027682 Ga0209971_1032607 Ga0209971_10326071 267
134 3300027876 Ga0209974_10078808 Ga0209974_100788082 267
135 3300036401 Ga0373937_0023313 Ga0373937_0023313_4137_5000 267
136 3300036401 Ga0373937_0327393 Ga0373937_0327393_285_1148 267
137 3300041486 Ga0451807_0795980 Ga0451807_0795980_457_1317 267
138 3300042435 Ga0439434_0012626 Ga0439434_0012626_1257_2120 267
139 3300042437 Ga0439444_0001452 Ga0439444_0001452_632_1495 267
140 3300046454 Ga0495592_0010606 Ga0495592_0010606_2465_3328 267
141 3300046462 Ga0495651_0192046 Ga0495651_0192046_333_1196 267
142 3300046511 Ga0495608_0004898 Ga0495608_0004898_3731_4594 267
143 3300046516 Ga0495628_0000915 Ga0495628_0000915_23748_24611 267
144 3300046517 Ga0495630_0007486 Ga0495630_0007486_5394_6257 267
145 3300046529 Ga0495652_0061068 Ga0495652_0061068_1765_2628 267
146 3300046533 Ga0495640_0007049 Ga0495640_0007049_6829_7692 267
147 3300046535 Ga0495586_0000698 Ga0495586_0000698_6037_6900 267
148 3300046536 Ga0495587_0017984 Ga0495587_0017984_645_1508 267
149 3300046543 Ga0495645_0123799 Ga0495645_0123799_334_1197 267
150 3300046559 Ga0495667_0004720 Ga0495667_0004720_787_1650 267
151 3300046642 Ga0495634_0003402 Ga0495634_0003402_8064_8927 267
152 3300046678 Ga0495599_0026248 Ga0495599_0026248_703_1566 267
153 3300046683 Ga0495658_0043562 Ga0495658_0043562_796_1659 267
154 3300046689 Ga0495613_0043171 Ga0495613_0043171_1155_2018 267
155 3300046809 Ga0495600_0009440 Ga0495600_0009440_3573_4436 267
156 3300047317 Ga0495604_0005164 Ga0495604_0005164_7216_8079 267
157 3300047319 Ga0495674_0062097 Ga0495674_0062097_343_1206 267
158 3300047322 Ga0495680_0004292 Ga0495680_0004292_10721_11584 267
159 3300049568 Ga0501031_0287584 Ga0501031_0287584_104_967 267
160 3300049580 Ga0501046_0042639 Ga0501046_0042639_666_1529 267
161 3300049582 Ga0501048_0011184 Ga0501048_0011184_3064_3927 267
162 3300049587 Ga0501071_0042700 Ga0501071_0042700_1725_2588 267
163 3300049590 Ga0501074_0147545 Ga0501074_0147545_211_1074 267
164 3300049591 Ga0501075_0086510 Ga0501075_0086510_161_1024 267
165 3300049822 Ga0501035_0215362 Ga0501035_0215362_591_1454 267
166 3300049824 Ga0501045_0018252 Ga0501045_0018252_2637_3500 267
167 3300050510 nmdc:mga06r32_322185_c1 nmdc:mga06r32_322185_c1_32_895 267
168 3300060353 Ga0501082_0055854 Ga0501082_0055854_2321_3184 267
169 3300044842 Ga0466957_0022422 Ga0466957_0022422_2540_3403 268
170 3300005347 Ga0070668_100053800 Ga0070668_1000538002 269
171 3300005356 Ga0070674_100016960 Ga0070674_1000169603 269
172 3300005444 Ga0070694_100029729 Ga0070694_1000297292 269
173 3300005518 Ga0070699_100184413 Ga0070699_1001844132 269
174 3300005536 Ga0070697_100002757 Ga0070697_10000275717 269
175 3300005545 Ga0070695_100007356 Ga0070695_1000073566 269
176 3300005981 Ga0081538_10054414 Ga0081538_100544142 269
177 3300006038 Ga0075365_10296642 Ga0075365_102966422 269
178 3300006178 Ga0075367_10105395 Ga0075367_101053952 269
179 3300006195 Ga0075366_10029929 Ga0075366_100299293 269
180 3300006237 Ga0097621_100121255 Ga0097621_1001212552 269
181 3300006846 Ga0075430_100001460 Ga0075430_1000014606 269
182 3300006846 Ga0075430_100014857 Ga0075430_1000148577 269
183 3300009147 Ga0114129_11114562 Ga0114129_111145621 269
184 3300014325 Ga0163163_10240354 Ga0163163_102403542 269
185 3300025315 Ga0207697_10086495 Ga0207697_100864952 269
186 3300025921 Ga0207652_10098403 Ga0207652_100984033 269
187 3300025940 Ga0207691_10127753 Ga0207691_101277532 269
188 3300027395 Ga0209996_1004795 Ga0209996_10047952 269
189 3300035170 Ga0373943_0264762 Ga0373943_0264762_42_905 269
190 3300035691 Ga0373931_0044097 Ga0373931_0044097_919_1782 269
191 3300035725 Ga0373947_0039274 Ga0373947_0039274_869_1732 269
192 3300036401 Ga0373937_0456355 Ga0373937_0456355_83_946 269
193 3300044842 Ga0466957_0003978 Ga0466957_0003978_1849_2712 269
194 3300046615 Ga0495656_0007639 Ga0495656_0007639_34_897 269
195 3300046664 Ga0495659_0038500 Ga0495659_0038500_20_883 269
196 3300049741 Ga0501079_0232075 Ga0501079_0232075_569_1429 269
197 3300050492 nmdc:mga0yw44_237659_c1 nmdc:mga0yw44_237659_c1_134_994 269
198 3300050493 nmdc:mga0k408_21210_c1 nmdc:mga0k408_21210_c1_1974_2840 269
199 3300050508 nmdc:mga09592_32945_c1 nmdc:mga09592_32945_c1_3166_4029 269
200 3300050509 nmdc:mga0qj67_114522_c1 nmdc:mga0qj67_114522_c1_689_1555 269
201 3300050509 nmdc:mga0qj67_136848_c1 nmdc:mga0qj67_136848_c1_975_1838 269
202 3300050510 nmdc:mga06r32_30198_c1 nmdc:mga06r32_30198_c1_340_1206 269
203 3300053119 Ga0500595_005025 Ga0500595_005025_2150_3013 269
204 3300005334 Ga0068869_100212924 Ga0068869_1002129242 270
205 3300005354 Ga0070675_100091375 Ga0070675_1000913752 270
206 3300005365 Ga0070688_100049817 Ga0070688_1000498172 270
207 3300005536 Ga0070697_100040045 Ga0070697_1000400454 270
208 3300005543 Ga0070672_100202710 Ga0070672_1002027102 270
209 3300006175 Ga0070712_100213252 Ga0070712_1002132522 270
210 3300006914 Ga0075436_100029252 Ga0075436_1000292522 270
211 3300007076 Ga0075435_100224598 Ga0075435_1002245982 270
212 3300025939 Ga0207665_10086192 Ga0207665_100861922 270
213 3300025940 Ga0207691_10042975 Ga0207691_100429751 270
214 3300025942 Ga0207689_10119851 Ga0207689_101198512 270
215 3300035119 Ga0373956_0031963 Ga0373956_0031963_213_1076 270
216 3300035724 Ga0373933_0062670 Ga0373933_0062670_310_1173 270
217 3300036401 Ga0373937_0000884 Ga0373937_0000884_6426_7289 270
218 3300046475 Ga0495639_0140261 Ga0495639_0140261_190_1053 270
219 3300049569 Ga0501032_0047591 Ga0501032_0047591_1954_2820 270
220 3300049570 Ga0501033_0010744 Ga0501033_0010744_2090_2956 270
221 3300049571 Ga0501034_0069583 Ga0501034_0069583_2090_2956 270
222 3300049572 Ga0501036_0001896 Ga0501036_0001896_14137_15003 270
223 3300049573 Ga0501037_0034705 Ga0501037_0034705_1482_2348 270
224 3300049575 Ga0501039_0155028 Ga0501039_0155028_152_1018 270
225 3300049579 Ga0501043_0097328 Ga0501043_0097328_155_1021 270
226 3300049580 Ga0501046_0004708 Ga0501046_0004708_578_1444 270
227 3300049582 Ga0501048_0016864 Ga0501048_0016864_4012_4878 270
228 3300049583 Ga0501067_0039738 Ga0501067_0039738_203_1069 270
229 3300049584 Ga0501068_0057648 Ga0501068_0057648_1473_2339 270
230 3300049589 Ga0501073_0024329 Ga0501073_0024329_1529_2395 270
231 3300049590 Ga0501074_0014441 Ga0501074_0014441_979_1845 270
232 3300049592 Ga0501076_0220064 Ga0501076_0220064_625_1488 270
233 3300049742 Ga0501080_0110919 Ga0501080_0110919_1238_2104 270
234 3300049742 Ga0501080_0193397 Ga0501080_0193397_866_1729 270
235 3300049744 Ga0501083_0005838 Ga0501083_0005838_5478_6344 270
236 3300049822 Ga0501035_0186422 Ga0501035_0186422_137_1003 270
237 3300049824 Ga0501045_0238422 Ga0501045_0238422_167_1030 270
238 3300050507 nmdc:mga05p37_370618_c1 nmdc:mga05p37_370618_c1_743_1606 270
239 3300054114 Ga0501084_0091849 Ga0501084_0091849_276_1139 270
240 3300005455 Ga0070663_100028209 Ga0070663_1000282092 271
241 3300007265 Ga0099794_10161173 Ga0099794_101611732 271
242 3300026067 Ga0207678_10036398 Ga0207678_100363984 271
243 3300027671 Ga0209588_1053410 Ga0209588_10534102 271
244 3300035091 Ga0373951_0001484 Ga0373951_0001484_2518_3381 271
245 3300035691 Ga0373931_0130941 Ga0373931_0130941_10_876 271
246 3300048922 Ga0496119_0144159 Ga0496119_0144159_49_867 271
247 3300048927 Ga0496124_0285354 Ga0496124_0285354_348_1166 271
248 3300049586 Ga0501070_0516541 Ga0501070_0516541_123_938 271
249 3300050511 nmdc:mga08y16_313918_c1 nmdc:mga08y16_313918_c1_784_1599 271
250 3300060353 Ga0501082_0344045 Ga0501082_0344045_56_922 271
251 3300006871 Ga0075434_100000254 Ga0075434_10000025437 272
252 3300007076 Ga0075435_100051906 Ga0075435_1000519063 272
253 3300013306 Ga0163162_10482444 Ga0163162_104824442 272
254 3300025929 Ga0207664_10144368 Ga0207664_101443682 272
255 3300030878 Ga0265770_1006487 Ga0265770_10064872 272
256 3300050512 nmdc:mga0n895_18001_c1 nmdc:mga0n895_18001_c1_1727_2590 272
257 3300050513 nmdc:mga0rr50_10311_c1 nmdc:mga0rr50_10311_c1_3313_4176 272
258 3300050514 nmdc:mga08x19_58983_c1 nmdc:mga08x19_58983_c1_679_1542 272
259 3300005343 Ga0070687_100185409 Ga0070687_1001854092 273
260 3300005544 Ga0070686_100026439 Ga0070686_1000264393 273
261 3300006237 Ga0097621_100002538 Ga0097621_1000025387 273
262 3300009147 Ga0114129_10116952 Ga0114129_101169521 273
263 3300009553 Ga0105249_10293342 Ga0105249_102933422 273
264 3300025927 Ga0207687_10219206 Ga0207687_102192062 273
265 3300025961 Ga0207712_10450730 Ga0207712_104507301 273
266 3300026118 Ga0207675_100180327 Ga0207675_1001803272 273
267 3300035116 Ga0373945_0005777 Ga0373945_0005777_2872_3732 273
268 3300035170 Ga0373943_0003448 Ga0373943_0003448_858_1718 273
269 3300035691 Ga0373931_0081558 Ga0373931_0081558_139_1002 273
270 3300035692 Ga0373935_0026646 Ga0373935_0026646_1905_2765 273
271 3300035695 Ga0373927_0040276 Ga0373927_0040276_1133_1993 273
272 3300037068 Ga0373925_0091387 Ga0373925_0091387_686_1546 273
273 3300037068 Ga0373925_0337621 Ga0373925_0337621_293_1159 273
274 3300046476 Ga0495662_0026957 Ga0495662_0026957_1096_1956 273
275 3300046514 Ga0495618_0039395 Ga0495618_0039395_1333_2193 273
276 3300046516 Ga0495628_0252424 Ga0495628_0252424_142_1002 273
277 3300046517 Ga0495630_0023615 Ga0495630_0023615_2528_3388 273
278 3300046526 Ga0495666_0072658 Ga0495666_0072658_698_1558 273
279 3300046531 Ga0495665_0086018 Ga0495665_0086018_19_879 273
280 3300046533 Ga0495640_0000714 Ga0495640_0000714_19545_20405 273
281 3300046535 Ga0495586_0009052 Ga0495586_0009052_470_1330 273
282 3300046543 Ga0495645_0001324 Ga0495645_0001324_11568_12428 273
283 3300046642 Ga0495634_0081653 Ga0495634_0081653_49_909 273
284 3300046663 Ga0495635_0002459 Ga0495635_0002459_906_1766 273
285 3300047319 Ga0495674_0010265 Ga0495674_0010265_6676_7536 273
286 3300047471 Ga0495684_0012213 Ga0495684_0012213_810_1670 273
287 3300048911 Ga0496108_0105136 Ga0496108_0105136_985_1851 273
288 3300048914 Ga0496111_0117118 Ga0496111_0117118_204_1070 273
289 3300049572 Ga0501036_0433156 Ga0501036_0433156_99_962 273
290 3300049575 Ga0501039_0028342 Ga0501039_0028342_2130_2993 273
291 3300049576 Ga0501040_0010125 Ga0501040_0010125_3692_4555 273
292 3300049578 Ga0501042_0196660 Ga0501042_0196660_551_1414 273
293 3300049580 Ga0501046_0082633 Ga0501046_0082633_1339_2202 273
294 3300049582 Ga0501048_0130282 Ga0501048_0130282_134_997 273
295 3300049585 Ga0501069_0213966 Ga0501069_0213966_23_886 273
296 3300049587 Ga0501071_0110723 Ga0501071_0110723_133_996 273
297 3300049588 Ga0501072_0006341 Ga0501072_0006341_1928_2791 273
298 3300049590 Ga0501074_0278443 Ga0501074_0278443_13_876 273
299 3300049591 Ga0501075_0222948 Ga0501075_0222948_76_939 273
300 3300049741 Ga0501079_0203296 Ga0501079_0203296_638_1501 273
301 3300049743 Ga0501081_0074580 Ga0501081_0074580_221_1084 273
302 3300050507 nmdc:mga05p37_20486_c1 nmdc:mga05p37_20486_c1_2648_3511 273
303 3300053078 Ga0495612_0000251 Ga0495612_0000251_16456_17316 273
304 3300053085 Ga0495619_0002085 Ga0495619_0002085_5064_5924 273
305 3300054114 Ga0501084_0032049 Ga0501084_0032049_681_1544 273
306 3300060353 Ga0501082_0082032 Ga0501082_0082032_711_1574 273
307 3300025923 Ga0207681_10346654 Ga0207681_103466541 274
308 3300049572 Ga0501036_0073557 Ga0501036_0073557_352_1215 274
309 3300049575 Ga0501039_0004579 Ga0501039_0004579_7644_8507 274
310 3300049576 Ga0501040_0000761 Ga0501040_0000761_5199_6062 274
311 3300049577 Ga0501041_0005396 Ga0501041_0005396_1109_1972 274
312 3300049578 Ga0501042_0003840 Ga0501042_0003840_131_994 274
313 3300049579 Ga0501043_0240218 Ga0501043_0240218_199_1062 274
314 3300049580 Ga0501046_0002981 Ga0501046_0002981_13483_14346 274
315 3300049582 Ga0501048_0003011 Ga0501048_0003011_11542_12405 274
316 3300049586 Ga0501070_0127135 Ga0501070_0127135_345_1208 274
317 3300049587 Ga0501071_0000078 Ga0501071_0000078_5397_6260 274
318 3300049588 Ga0501072_0013652 Ga0501072_0013652_1110_1973 274
319 3300049590 Ga0501074_0032389 Ga0501074_0032389_1388_2251 274
320 3300049591 Ga0501075_0002758 Ga0501075_0002758_1684_2547 274
321 3300049592 Ga0501076_0002404 Ga0501076_0002404_10462_11325 274
322 3300049593 Ga0501077_0002379 Ga0501077_0002379_4690_5553 274
323 3300049741 Ga0501079_0000213 Ga0501079_0000213_4247_5110 274
324 3300049742 Ga0501080_0001183 Ga0501080_0001183_9214_10077 274
325 3300049743 Ga0501081_0006277 Ga0501081_0006277_5050_5913 274
326 3300049744 Ga0501083_0005926 Ga0501083_0005926_6518_7381 274
327 3300049824 Ga0501045_0001082 Ga0501045_0001082_5722_6585 274
328 3300054114 Ga0501084_0000457 Ga0501084_0000457_24814_25677 274
329 3300061734 Ga0530510_0011122 Ga0530510_0011122_2891_3754 274
330 3300025915 Ga0207693_10026368 Ga0207693_100263685 275
331 3300025915 Ga0207693_10129451 Ga0207693_101294512 275
332 3300035083 Ga0373926_0013376 Ga0373926_0013376_270_1130 275
333 3300035089 Ga0373944_0002120 Ga0373944_0002120_1767_2627 275
334 3300035116 Ga0373945_0012873 Ga0373945_0012873_1492_2352 275
335 3300035170 Ga0373943_0000243 Ga0373943_0000243_7299_8159 275
336 3300035171 Ga0373946_0002288 Ga0373946_0002288_737_1597 275
337 3300035692 Ga0373935_0000598 Ga0373935_0000598_9640_10500 275
338 3300035695 Ga0373927_0000839 Ga0373927_0000839_14358_15218 275
339 3300035725 Ga0373947_0000796 Ga0373947_0000796_13534_14394 275
340 3300037068 Ga0373925_0004142 Ga0373925_0004142_1541_2401 275
341 3300046459 Ga0495629_0093268 Ga0495629_0093268_64_924 275
342 3300046460 Ga0495638_0126630 Ga0495638_0126630_191_1054 275
343 3300046531 Ga0495665_0015991 Ga0495665_0015991_2882_3742 275
344 3300046642 Ga0495634_0004925 Ga0495634_0004925_5565_6425 275
345 3300046689 Ga0495613_0056141 Ga0495613_0056141_937_1797 275
346 3300046690 Ga0495624_0002424 Ga0495624_0002424_10392_11252 275
347 3300047315 Ga0495581_0006982 Ga0495581_0006982_4891_5751 275
348 3300047319 Ga0495674_0308238 Ga0495674_0308238_382_1242 275
349 3300047321 Ga0495676_0017588 Ga0495676_0017588_1841_2701 275
350 3300047471 Ga0495684_0007919 Ga0495684_0007919_6352_7212 275
351 3300047673 Ga0495593_0024515 Ga0495593_0024515_886_1746 275
352 3300050515 nmdc:mga0a205_111119_c1 nmdc:mga0a205_111119_c1_1582_2445 275
353 3300060353 Ga0501082_0012045 Ga0501082_0012045_367_1230 275
354 3300005530 Ga0070679_100030351 Ga0070679_1000303512 276
355 3300005983 Ga0081540_1000280 Ga0081540_100028055 277
356 3300006844 Ga0075428_100174930 Ga0075428_1001749302 277
357 3300050507 nmdc:mga05p37_91717_c1 nmdc:mga05p37_91717_c1_791_1654 277
358 3300035172 Ga0373955_0017584 Ga0373955_0017584_1520_2383 278
359 3300035410 Ga0373924_0061456 Ga0373924_0061456_236_1114 278
360 3300036401 Ga0373937_0023033 Ga0373937_0023033_2803_3666 278
361 3300046511 Ga0495608_0094367 Ga0495608_0094367_322_1185 278
362 3300046536 Ga0495587_0025045 Ga0495587_0025045_2755_3618 278
363 3300046675 Ga0495657_0032788 Ga0495657_0032788_734_1597 278
364 3300048088 Ga0495602_0043428 Ga0495602_0043428_1415_2278 278
365 3300053077 Ga0495601_0019507 Ga0495601_0019507_245_1123 278
366 3300053078 Ga0495612_0077816 Ga0495612_0077816_245_1123 278
367 3300053084 Ga0495595_0008339 Ga0495595_0008339_1830_2693 278
368 3300049585 Ga0501069_0058755 Ga0501069_0058755_503_1366 279
369 3300049586 Ga0501070_0001477 Ga0501070_0001477_267_1130 279
370 3300049586 Ga0501070_0055424 Ga0501070_0055424_645_1508 279
371 3300049592 Ga0501076_0107569 Ga0501076_0107569_352_1215 279
372 3300049741 Ga0501079_0030304 Ga0501079_0030304_197_1060 279
373 3300049743 Ga0501081_0055686 Ga0501081_0055686_481_1344 279
374 3300049822 Ga0501035_0001020 Ga0501035_0001020_14272_15135 279
375 iso_pu_bacteria 2917699015 2917703562 279
376 3300005444 Ga0070694_100019538 Ga0070694_1000195383 280
377 3300028800 Ga0265338_10263521 Ga0265338_102635211 281
378 3300031241 Ga0265325_10043802 Ga0265325_100438022 281
379 3300031249 Ga0265339_10002186 Ga0265339_100021867 281
380 3300031595 Ga0265313_10000756 Ga0265313_1000075620 281
381 3300031712 Ga0265342_10019040 Ga0265342_100190402 281
382 3300035695 Ga0373927_0162911 Ga0373927_0162911_396_1256 281
383 3300036401 Ga0373937_0008752 Ga0373937_0008752_400_1260 281
384 3300046477 Ga0495664_0153859 Ga0495664_0153859_340_1200 281
385 3300046514 Ga0495618_0204663 Ga0495618_0204663_294_1154 281
386 3300046517 Ga0495630_0144516 Ga0495630_0144516_15_875 281
387 3300046529 Ga0495652_0234771 Ga0495652_0234771_78_938 281
388 3300046642 Ga0495634_0293741 Ga0495634_0293741_98_958 281
389 3300046678 Ga0495599_0174668 Ga0495599_0174668_355_1215 281
390 3300047319 Ga0495674_0298598 Ga0495674_0298598_276_1136 281
391 3300049590 Ga0501074_0285056 Ga0501074_0285056_235_1098 281
392 3300049576 Ga0501040_0063836 Ga0501040_0063836_1425_2288 282
393 iso_pu_bacteria 2932828146 2932837044 282
394 iso_pu_bacteria 2935616580 2935616985 282
395 iso_pu_bacteria 2935703347 2935711737 282
396 iso_pu_bacteria 2935801545 2935810203 282
397 iso_pu_bacteria 2935837841 2935846852 282
398 iso_pu_bacteria 2935855204 2935855610 282
399 iso_pu_bacteria 2935864058 2935870248 282
400 iso_pu_bacteria 2935873716 2935876035 282
401 iso_pu_bacteria 2936002035 2936010670 282
402 iso_pu_bacteria 2941538514 2941547299 282
403 iso_pu_bacteria 8016511872 8016521586 282
404 iso_pu_bacteria 8017057580 8017064051 282
405 iso_pu_bacteria 8019576017 8019583376 282
406 iso_pu_bacteria 8019586578 8019591188 282
407 3300005366 Ga0070659_100190699 Ga0070659_1001906992 283
408 3300005458 Ga0070681_10445370 Ga0070681_104453702 283
409 3300025912 Ga0207707_10412329 Ga0207707_104123292 283
410 3300049588 Ga0501072_0579758 Ga0501072_0579758_22_873 283
411 iso_pu_bacteria 2643221547 2643758415 283
412 3300005435 Ga0070714_100184637 Ga0070714_1001846372 286
413 3300005455 Ga0070663_100117414 Ga0070663_1001174142 286
414 3300024227 Ga0228598_1007242 Ga0228598_10072422 286
415 3300025906 Ga0207699_10239344 Ga0207699_102393441 286
416 3300025916 Ga0207663_10279510 Ga0207663_102795101 286
417 3300025928 Ga0207700_10087336 Ga0207700_100873362 286
418 3300026067 Ga0207678_10162545 Ga0207678_101625452 286
419 3300035171 Ga0373946_0221667 Ga0373946_0221667_13_873 286
420 3300035172 Ga0373955_0031074 Ga0373955_0031074_1172_2032 286
421 3300035410 Ga0373924_0017667 Ga0373924_0017667_386_1246 286
422 3300035692 Ga0373935_0043904 Ga0373935_0043904_162_1022 286
423 3300035725 Ga0373947_0011402 Ga0373947_0011402_1952_2812 286
424 3300036401 Ga0373937_0001791 Ga0373937_0001791_6978_7838 286
425 3300037068 Ga0373925_0030758 Ga0373925_0030758_798_1658 286
426 3300044694 Ga0466963_0008739 Ga0466963_0008739_3818_4678 286
427 3300044735 Ga0466968_0118290 Ga0466968_0118290_23_883 286
428 3300044842 Ga0466957_0099377 Ga0466957_0099377_480_1340 286
429 3300045049 Ga0466959_0094922 Ga0466959_0094922_64_924 286
430 3300045836 Ga0466958_0054032 Ga0466958_0054032_1199_2059 286
431 3300046462 Ga0495651_0063109 Ga0495651_0063109_999_1859 286
432 3300046514 Ga0495618_0305726 Ga0495618_0305726_28_888 286
433 3300046524 Ga0495648_0042339 Ga0495648_0042339_415_1278 286
434 3300046536 Ga0495587_0037674 Ga0495587_0037674_700_1560 286
435 3300046543 Ga0495645_0002355 Ga0495645_0002355_2659_3519 286
436 3300046559 Ga0495667_0004023 Ga0495667_0004023_4128_4988 286
437 3300046675 Ga0495657_0141207 Ga0495657_0141207_502_1362 286
438 3300046678 Ga0495599_0008419 Ga0495599_0008419_2242_3102 286
439 3300046678 Ga0495599_0026682 Ga0495599_0026682_2303_3163 286
440 3300046678 Ga0495599_0214759 Ga0495599_0214759_104_964 286
441 3300046679 Ga0495623_0032008 Ga0495623_0032008_62_922 286
442 3300046680 Ga0495646_0048746 Ga0495646_0048746_24_884 286
443 3300046809 Ga0495600_0092534 Ga0495600_0092534_746_1606 286
444 3300047317 Ga0495604_0135662 Ga0495604_0135662_675_1535 286
445 3300047322 Ga0495680_0100610 Ga0495680_0100610_863_1723 286
446 3300047444 Ga0495675_0222609 Ga0495675_0222609_188_1048 286
447 3300047471 Ga0495684_0026729 Ga0495684_0026729_2313_3173 286
448 3300048088 Ga0495602_0007001 Ga0495602_0007001_9325_10185 286
449 3300048905 Ga0496102_0097159 Ga0496102_0097159_1762_2625 286
450 3300048913 Ga0496110_0189216 Ga0496110_0189216_421_1284 286
451 3300048915 Ga0496112_0044146 Ga0496112_0044146_115_978 286
452 3300048920 Ga0496117_0079713 Ga0496117_0079713_593_1456 286
453 3300048920 Ga0496117_0141621 Ga0496117_0141621_246_1109 286
454 3300048921 Ga0496118_0011606 Ga0496118_0011606_3799_4662 286
455 3300048924 Ga0496121_0007736 Ga0496121_0007736_5208_6071 286
456 3300048924 Ga0496121_0011689 Ga0496121_0011689_4930_5793 286
457 3300048929 Ga0496126_0076508 Ga0496126_0076508_1298_2161 286
458 3300049571 Ga0501034_0265707 Ga0501034_0265707_762_1622 286
459 3300049573 Ga0501037_0102365 Ga0501037_0102365_495_1355 286
460 3300049574 Ga0501038_0104400 Ga0501038_0104400_1198_2058 286
461 3300049578 Ga0501042_0118479 Ga0501042_0118479_847_1707 286
462 3300049579 Ga0501043_0013794 Ga0501043_0013794_4066_4926 286
463 3300049580 Ga0501046_0103981 Ga0501046_0103981_199_1059 286
464 3300049581 Ga0501047_0002326 Ga0501047_0002326_5204_6064 286
465 3300049586 Ga0501070_0054411 Ga0501070_0054411_439_1299 286
466 3300049586 Ga0501070_0210497 Ga0501070_0210497_480_1340 286
467 3300049592 Ga0501076_0010217 Ga0501076_0010217_2742_3602 286
468 3300049741 Ga0501079_0087547 Ga0501079_0087547_141_1001 286
469 3300049742 Ga0501080_0013912 Ga0501080_0013912_5256_6116 286
470 3300049743 Ga0501081_0025497 Ga0501081_0025497_2797_3657 286
471 3300049822 Ga0501035_0058220 Ga0501035_0058220_291_1151 286
472 3300049823 Ga0501044_0079833 Ga0501044_0079833_2049_2909 286
473 3300053077 Ga0495601_0000210 Ga0495601_0000210_21091_21951 286
474 3300053078 Ga0495612_0000283 Ga0495612_0000283_9342_10202 286
475 3300053084 Ga0495595_0002747 Ga0495595_0002747_5535_6395 286
476 3300053085 Ga0495619_0236001 Ga0495619_0236001_128_988 286
477 3300053093 Ga0500651_0015632 Ga0500651_0015632_2798_3661 286
478 3300053118 Ga0500594_0022650 Ga0500594_0022650_383_1246 286
479 3300053130 Ga0500642_0001575 Ga0500642_0001575_5275_6138 286
480 3300053151 Ga0500604_0040369 Ga0500604_0040369_404_1267 286
481 3300060353 Ga0501082_0283949 Ga0501082_0283949_149_1009 286
482 3300061734 Ga0530510_0024870 Ga0530510_0024870_448_1308 286
483 3300005330 Ga0070690_100002043 Ga0070690_1000020432 287
484 3300005334 Ga0068869_100005688 Ga0068869_1000056884 287
485 3300005336 Ga0070680_100002937 Ga0070680_1000029372 287
486 3300005336 Ga0070680_100324697 Ga0070680_1003246972 287
487 3300005337 Ga0070682_100035802 Ga0070682_1000358023 287
488 3300005337 Ga0070682_100072846 Ga0070682_1000728461 287
489 3300005338 Ga0068868_100007949 Ga0068868_1000079492 287
490 3300005340 Ga0070689_100009220 Ga0070689_1000092208 287
491 3300005340 Ga0070689_100400807 Ga0070689_1004008071 287
492 3300005341 Ga0070691_10014151 Ga0070691_100141514 287
493 3300005343 Ga0070687_100000041 Ga0070687_1000000414 287
494 3300005344 Ga0070661_100057287 Ga0070661_1000572873 287
495 3300005347 Ga0070668_100100663 Ga0070668_1001006632 287
496 3300005354 Ga0070675_100151977 Ga0070675_1001519772 287
497 3300005364 Ga0070673_100125925 Ga0070673_1001259252 287
498 3300005367 Ga0070667_100009580 Ga0070667_1000095809 287
499 3300005438 Ga0070701_10001599 Ga0070701_100015993 287
500 3300005439 Ga0070711_100030608 Ga0070711_1000306082 287
501 3300005440 Ga0070705_100001261 Ga0070705_1000012616 287
502 3300005441 Ga0070700_100002086 Ga0070700_10000208613 287
503 3300005444 Ga0070694_100001810 Ga0070694_10000181017 287
504 3300005455 Ga0070663_100012485 Ga0070663_1000124854 287
505 3300005456 Ga0070678_100011585 Ga0070678_1000115857 287
506 3300005456 Ga0070678_100113416 Ga0070678_1001134162 287
507 3300005457 Ga0070662_100007259 Ga0070662_1000072595 287
508 3300005458 Ga0070681_10034265 Ga0070681_100342655 287
509 3300005459 Ga0068867_100001132 Ga0068867_1000011326 287
510 3300005530 Ga0070679_100057154 Ga0070679_1000571541 287
511 3300005544 Ga0070686_100004960 Ga0070686_1000049602 287
512 3300005545 Ga0070695_100003802 Ga0070695_1000038024 287
513 3300005546 Ga0070696_100005213 Ga0070696_1000052136 287
514 3300005546 Ga0070696_100368441 Ga0070696_1003684411 287
515 3300005547 Ga0070693_100000774 Ga0070693_1000007744 287
516 3300005547 Ga0070693_100052502 Ga0070693_1000525022 287
517 3300005549 Ga0070704_100000019 Ga0070704_10000001917 287
518 3300005549 Ga0070704_100340236 Ga0070704_1003402362 287
519 3300005563 Ga0068855_100006910 Ga0068855_10000691010 287
520 3300005564 Ga0070664_100056704 Ga0070664_1000567042 287
521 3300005577 Ga0068857_100183653 Ga0068857_1001836531 287
522 3300005577 Ga0068857_100198190 Ga0068857_1001981902 287
523 3300005615 Ga0070702_100001829 Ga0070702_1000018292 287
524 3300005617 Ga0068859_100024246 Ga0068859_1000242464 287
525 3300005718 Ga0068866_10000614 Ga0068866_1000061414 287
526 3300005719 Ga0068861_100004375 Ga0068861_1000043754 287
527 3300005841 Ga0068863_100078074 Ga0068863_1000780744 287
528 3300005842 Ga0068858_100007256 Ga0068858_1000072568 287
529 3300005842 Ga0068858_100055331 Ga0068858_1000553313 287
530 3300005843 Ga0068860_100023532 Ga0068860_1000235325 287
531 3300005844 Ga0068862_100003934 Ga0068862_1000039346 287
532 3300005937 Ga0081455_10000209 Ga0081455_1000020959 287
533 3300006175 Ga0070712_100026284 Ga0070712_1000262843 287
534 3300006175 Ga0070712_100159048 Ga0070712_1001590482 287
535 3300006237 Ga0097621_100000406 Ga0097621_10000040630 287
536 3300006237 Ga0097621_100030764 Ga0097621_1000307642 287
537 3300006358 Ga0068871_100007351 Ga0068871_1000073517 287
538 3300006358 Ga0068871_100014697 Ga0068871_1000146973 287
539 3300006844 Ga0075428_100003052 Ga0075428_10000305219 287
540 3300006871 Ga0075434_100057100 Ga0075434_1000571005 287
541 3300006880 Ga0075429_100006480 Ga0075429_10000648011 287
542 3300006881 Ga0068865_100003715 Ga0068865_1000037154 287
543 3300006931 Ga0097620_100024244 Ga0097620_1000242444 287
544 3300007076 Ga0075435_100141868 Ga0075435_1001418682 287
545 3300007076 Ga0075435_100223327 Ga0075435_1002233272 287
546 3300009093 Ga0105240_10297805 Ga0105240_102978052 287
547 3300009094 Ga0111539_10012842 Ga0111539_1001284212 287
548 3300009094 Ga0111539_10033868 Ga0111539_100338682 287
549 3300009098 Ga0105245_10001530 Ga0105245_1000153025 287
550 3300009147 Ga0114129_10003508 Ga0114129_1000350819 287
551 3300009148 Ga0105243_10000478 Ga0105243_100004785 287
552 3300009148 Ga0105243_10693075 Ga0105243_106930751 287
553 3300009174 Ga0105241_10023468 Ga0105241_100234682 287
554 3300009174 Ga0105241_10071529 Ga0105241_100715292 287
555 3300009176 Ga0105242_10003114 Ga0105242_1000311412 287
556 3300009177 Ga0105248_10020983 Ga0105248_100209832 287
557 3300009177 Ga0105248_10192363 Ga0105248_101923632 287
558 3300009551 Ga0105238_10155226 Ga0105238_101552262 287
559 3300009553 Ga0105249_10002781 Ga0105249_100027815 287
560 3300009553 Ga0105249_10401105 Ga0105249_104011052 287
561 3300010375 Ga0105239_10044249 Ga0105239_100442492 287
562 3300010375 Ga0105239_10143444 Ga0105239_101434442 287
563 3300011119 Ga0105246_10037918 Ga0105246_100379182 287
564 3300012494 Ga0157341_1000955 Ga0157341_10009552 287
565 3300013102 Ga0157371_10061087 Ga0157371_100610873 287
566 3300013297 Ga0157378_10000362 Ga0157378_1000036210 287
567 3300013297 Ga0157378_10054745 Ga0157378_100547451 287
568 3300013306 Ga0163162_10065114 Ga0163162_100651145 287
569 3300013307 Ga0157372_10178558 Ga0157372_101785582 287
570 3300013307 Ga0157372_10216318 Ga0157372_102163182 287
571 3300013308 Ga0157375_10002488 Ga0157375_1000248816 287
572 3300014326 Ga0157380_10056450 Ga0157380_100564504 287
573 3300014968 Ga0157379_10138951 Ga0157379_101389513 287
574 3300014969 Ga0157376_10008924 Ga0157376_100089242 287
575 3300014969 Ga0157376_10098144 Ga0157376_100981442 287
576 3300021384 Ga0213876_10008996 Ga0213876_100089963 287
577 3300021384 Ga0213876_10029221 Ga0213876_100292213 287
578 3300024227 Ga0228598_1018395 Ga0228598_10183952 287
579 3300025315 Ga0207697_10130625 Ga0207697_101306251 287
580 3300025885 Ga0207653_10026706 Ga0207653_100267062 287
581 3300025899 Ga0207642_10000493 Ga0207642_100004935 287
582 3300025900 Ga0207710_10047969 Ga0207710_100479692 287
583 3300025903 Ga0207680_10114418 Ga0207680_101144182 287
584 3300025906 Ga0207699_10310568 Ga0207699_103105681 287
585 3300025908 Ga0207643_10024187 Ga0207643_100241873 287
586 3300025912 Ga0207707_10031302 Ga0207707_100313022 287
587 3300025913 Ga0207695_10082424 Ga0207695_100824242 287
588 3300025915 Ga0207693_10055864 Ga0207693_100558642 287
589 3300025916 Ga0207663_10175697 Ga0207663_101756972 287
590 3300025916 Ga0207663_10251311 Ga0207663_102513111 287
591 3300025917 Ga0207660_10022448 Ga0207660_100224483 287
592 3300025917 Ga0207660_10304099 Ga0207660_103040992 287
593 3300025918 Ga0207662_10001121 Ga0207662_100011212 287
594 3300025918 Ga0207662_10120427 Ga0207662_101204271 287
595 3300025921 Ga0207652_10257404 Ga0207652_102574041 287
596 3300025926 Ga0207659_10102681 Ga0207659_101026812 287
597 3300025927 Ga0207687_10005565 Ga0207687_100055654 287
598 3300025928 Ga0207700_10045328 Ga0207700_100453283 287
599 3300025929 Ga0207664_10049839 Ga0207664_100498394 287
600 3300025931 Ga0207644_10019902 Ga0207644_100199024 287
601 3300025933 Ga0207706_10085297 Ga0207706_100852972 287
602 3300025934 Ga0207686_10003159 Ga0207686_100031597 287
603 3300025935 Ga0207709_10001899 Ga0207709_1000189910 287
604 3300025936 Ga0207670_10002655 Ga0207670_1000265510 287
605 3300025938 Ga0207704_10020103 Ga0207704_100201034 287
606 3300025941 Ga0207711_10224284 Ga0207711_102242842 287
607 3300025942 Ga0207689_10000566 Ga0207689_1000056617 287
608 3300025942 Ga0207689_10045532 Ga0207689_100455323 287
609 3300025949 Ga0207667_10021448 Ga0207667_100214483 287
610 3300025961 Ga0207712_10026005 Ga0207712_100260055 287
611 3300025972 Ga0207668_10113720 Ga0207668_101137202 287
612 3300025981 Ga0207640_10005119 Ga0207640_100051194 287
613 3300026023 Ga0207677_10005638 Ga0207677_100056384 287
614 3300026035 Ga0207703_10079135 Ga0207703_100791353 287
615 3300026067 Ga0207678_10009048 Ga0207678_100090486 287
616 3300026075 Ga0207708_10003184 Ga0207708_1000318417 287
617 3300026088 Ga0207641_10403468 Ga0207641_104034681 287
618 3300026089 Ga0207648_10000281 Ga0207648_1000028117 287
619 3300026116 Ga0207674_10183215 Ga0207674_101832152 287
620 3300026116 Ga0207674_10204265 Ga0207674_102042652 287
621 3300026118 Ga0207675_100005102 Ga0207675_1000051022 287
622 3300026121 Ga0207683_10117842 Ga0207683_101178422 287
623 3300026142 Ga0207698_10421623 Ga0207698_104216232 287
624 3300027907 Ga0207428_10001277 Ga0207428_1000127719 287
625 3300028380 Ga0268265_10011524 Ga0268265_100115244 287
626 3300028381 Ga0268264_10052329 Ga0268264_100523293 287
627 3300031241 Ga0265325_10003857 Ga0265325_1000385711 287
628 3300031249 Ga0265339_10002967 Ga0265339_100029676 287
629 3300031344 Ga0265316_10022270 Ga0265316_100222702 287
630 3300031344 Ga0265316_10211881 Ga0265316_102118811 287
631 3300031595 Ga0265313_10024495 Ga0265313_100244953 287
632 3300031595 Ga0265313_10038423 Ga0265313_100384233 287
633 3300031731 Ga0307405_10306613 Ga0307405_103066131 287
634 3300034817 Ga0373948_0002832 Ga0373948_0002832_711_1574 287
635 3300034818 Ga0373950_0002685 Ga0373950_0002685_177_1040 287
636 3300034820 Ga0373959_0004548 Ga0373959_0004548_1029_1892 287
637 3300035086 Ga0373934_0032159 Ga0373934_0032159_808_1671 287
638 3300035088 Ga0373940_0009418 Ga0373940_0009418_786_1649 287
639 3300035111 Ga0373923_0013137 Ga0373923_0013137_1313_2176 287
640 3300035118 Ga0373954_0009184 Ga0373954_0009184_1350_2213 287
641 3300035118 Ga0373954_0066231 Ga0373954_0066231_732_1595 287
642 3300035119 Ga0373956_0005298 Ga0373956_0005298_732_1595 287
643 3300035119 Ga0373956_0025963 Ga0373956_0025963_1219_2082 287
644 3300035120 Ga0373957_0034491 Ga0373957_0034491_847_1710 287
645 3300035121 Ga0373960_0031574 Ga0373960_0031574_218_1081 287
646 3300035170 Ga0373943_0003515 Ga0373943_0003515_1430_2293 287
647 3300035170 Ga0373943_0011291 Ga0373943_0011291_227_1090 287
648 3300035172 Ga0373955_0010791 Ga0373955_0010791_776_1639 287
649 3300035172 Ga0373955_0012410 Ga0373955_0012410_508_1371 287
650 3300035172 Ga0373955_0077332 Ga0373955_0077332_568_1431 287
651 3300035242 Ga0373962_0053397 Ga0373962_0053397_238_1101 287
652 3300035242 Ga0373962_0071811 Ga0373962_0071811_97_960 287
653 3300035691 Ga0373931_0042066 Ga0373931_0042066_641_1504 287
654 3300035691 Ga0373931_0080579 Ga0373931_0080579_205_1068 287
655 3300035691 Ga0373931_0113785 Ga0373931_0113785_534_1397 287
656 3300035691 Ga0373931_0124955 Ga0373931_0124955_593_1456 287
657 3300035692 Ga0373935_0004817 Ga0373935_0004817_5911_6774 287
658 3300035692 Ga0373935_0086050 Ga0373935_0086050_928_1791 287
659 3300035695 Ga0373927_0196002 Ga0373927_0196002_53_916 287
660 3300035724 Ga0373933_0008478 Ga0373933_0008478_996_1859 287
661 3300035725 Ga0373947_0005443 Ga0373947_0005443_1036_1899 287
662 3300035725 Ga0373947_0072751 Ga0373947_0072751_260_1123 287
663 3300037068 Ga0373925_0005226 Ga0373925_0005226_4889_5752 287
664 3300037068 Ga0373925_0290104 Ga0373925_0290104_216_1079 287
665 3300037312 Ga0395899_0031176 Ga0395899_0031176_575_1486 287
666 3300037418 Ga0395900_0015232 Ga0395900_0015232_4376_5287 287
667 3300037466 Ga0395898_0080033 Ga0395898_0080033_599_1462 287
668 3300037466 Ga0395898_0488432 Ga0395898_0488432_220_1131 287
669 3300038443 Ga0395901_0081984 Ga0395901_0081984_2311_3174 287
670 3300038443 Ga0395901_0258676 Ga0395901_0258676_866_1729 287
671 3300039437 Ga0436365_0932459 Ga0436365_0932459_2677_3540 287
672 3300041512 Ga0451853_0997884 Ga0451853_0997884_1082_1945 287
673 3300042156 Ga0439446_0045767 Ga0439446_0045767_61_924 287
674 3300045051 Ga0451576_0015388 Ga0451576_0015388_5777_6640 287
675 3300045051 Ga0451576_0267165 Ga0451576_0267165_797_1663 287
676 3300046454 Ga0495592_0179612 Ga0495592_0179612_19_882 287
677 3300046455 Ga0495603_0000816 Ga0495603_0000816_13033_13896 287
678 3300046455 Ga0495603_0023995 Ga0495603_0023995_684_1547 287
679 3300046459 Ga0495629_0000140 Ga0495629_0000140_6911_7774 287
680 3300046459 Ga0495629_0080581 Ga0495629_0080581_905_1768 287
681 3300046461 Ga0495641_0010088 Ga0495641_0010088_852_1715 287
682 3300046462 Ga0495651_0005708 Ga0495651_0005708_189_1052 287
683 3300046462 Ga0495651_0053596 Ga0495651_0053596_783_1646 287
684 3300046463 Ga0495653_0009696 Ga0495653_0009696_4597_5460 287
685 3300046463 Ga0495653_0074245 Ga0495653_0074245_988_1851 287
686 3300046472 Ga0495580_0058773 Ga0495580_0058773_232_1095 287
687 3300046472 Ga0495580_0075751 Ga0495580_0075751_1247_2110 287
688 3300046472 Ga0495580_0078199 Ga0495580_0078199_303_1166 287
689 3300046473 Ga0495582_0005878 Ga0495582_0005878_4584_5447 287
690 3300046473 Ga0495582_0020830 Ga0495582_0020830_2076_2939 287
691 3300046475 Ga0495639_0001632 Ga0495639_0001632_4319_5182 287
692 3300046476 Ga0495662_0008367 Ga0495662_0008367_92_958 287
693 3300046476 Ga0495662_0062796 Ga0495662_0062796_841_1704 287
694 3300046476 Ga0495662_0214653 Ga0495662_0214653_12_875 287
695 3300046477 Ga0495664_0005918 Ga0495664_0005918_4882_5745 287
696 3300046477 Ga0495664_0038354 Ga0495664_0038354_1115_1978 287
697 3300046491 Ga0495584_0009796 Ga0495584_0009796_825_1688 287
698 3300046492 Ga0495585_0002257 Ga0495585_0002257_3756_4619 287
699 3300046499 Ga0495594_0099842 Ga0495594_0099842_702_1565 287
700 3300046511 Ga0495608_0023230 Ga0495608_0023230_733_1596 287
701 3300046511 Ga0495608_0238621 Ga0495608_0238621_25_888 287
702 3300046517 Ga0495630_0012741 Ga0495630_0012741_3132_3995 287
703 3300046517 Ga0495630_0056745 Ga0495630_0056745_675_1538 287
704 3300046517 Ga0495630_0058850 Ga0495630_0058850_627_1490 287
705 3300046517 Ga0495630_0333224 Ga0495630_0333224_224_1087 287
706 3300046518 Ga0495631_0023242 Ga0495631_0023242_674_1537 287
707 3300046520 Ga0495637_0091425 Ga0495637_0091425_320_1183 287
708 3300046523 Ga0495644_0001244 Ga0495644_0001244_4686_5549 287
709 3300046525 Ga0495663_0009554 Ga0495663_0009554_1197_2060 287
710 3300046526 Ga0495666_0007872 Ga0495666_0007872_684_1547 287
711 3300046529 Ga0495652_0032347 Ga0495652_0032347_2273_3136 287
712 3300046529 Ga0495652_0072535 Ga0495652_0072535_1010_1873 287
713 3300046531 Ga0495665_0004725 Ga0495665_0004725_1141_2004 287
714 3300046533 Ga0495640_0045460 Ga0495640_0045460_1254_2117 287
715 3300046533 Ga0495640_0190085 Ga0495640_0190085_143_1009 287
716 3300046536 Ga0495587_0007895 Ga0495587_0007895_5755_6618 287
717 3300046536 Ga0495587_0017665 Ga0495587_0017665_419_1282 287
718 3300046557 Ga0495622_0011854 Ga0495622_0011854_70_933 287
719 3300046558 Ga0495633_0006563 Ga0495633_0006563_4473_5336 287
720 3300046559 Ga0495667_0005868 Ga0495667_0005868_4702_5565 287
721 3300046559 Ga0495667_0187173 Ga0495667_0187173_317_1180 287
722 3300046615 Ga0495656_0003395 Ga0495656_0003395_3663_4526 287
723 3300046663 Ga0495635_0018448 Ga0495635_0018448_579_1445 287
724 3300046663 Ga0495635_0066698 Ga0495635_0066698_759_1622 287
725 3300046664 Ga0495659_0002292 Ga0495659_0002292_1308_2171 287
726 3300046665 Ga0495661_0039401 Ga0495661_0039401_149_1012 287
727 3300046675 Ga0495657_0035218 Ga0495657_0035218_617_1480 287
728 3300046678 Ga0495599_0005271 Ga0495599_0005271_3298_4161 287
729 3300046679 Ga0495623_0271517 Ga0495623_0271517_37_900 287
730 3300046680 Ga0495646_0078337 Ga0495646_0078337_244_1107 287
731 3300046680 Ga0495646_0110191 Ga0495646_0110191_334_1197 287
732 3300046681 Ga0495647_0003703 Ga0495647_0003703_1081_1944 287
733 3300046683 Ga0495658_0009443 Ga0495658_0009443_1386_2249 287
734 3300046683 Ga0495658_0155185 Ga0495658_0155185_61_927 287
735 3300046683 Ga0495658_0320832 Ga0495658_0320832_20_883 287
736 3300046684 Ga0495669_0001950 Ga0495669_0001950_4908_5771 287
737 3300046689 Ga0495613_0040585 Ga0495613_0040585_525_1388 287
738 3300046689 Ga0495613_0100555 Ga0495613_0100555_335_1198 287
739 3300046690 Ga0495624_0010799 Ga0495624_0010799_935_1798 287
740 3300046691 Ga0495670_0006450 Ga0495670_0006450_3348_4211 287
741 3300046809 Ga0495600_0001615 Ga0495600_0001615_9262_10125 287
742 3300046809 Ga0495600_0073084 Ga0495600_0073084_300_1163 287
743 3300046809 Ga0495600_0132919 Ga0495600_0132919_197_1060 287
744 3300047315 Ga0495581_0020190 Ga0495581_0020190_416_1279 287
745 3300047317 Ga0495604_0023059 Ga0495604_0023059_2026_2889 287
746 3300047317 Ga0495604_0049732 Ga0495604_0049732_1673_2536 287
747 3300047319 Ga0495674_0178681 Ga0495674_0178681_306_1169 287
748 3300047321 Ga0495676_0012611 Ga0495676_0012611_1396_2259 287
749 3300047321 Ga0495676_0179219 Ga0495676_0179219_256_1119 287
750 3300047321 Ga0495676_0245002 Ga0495676_0245002_103_966 287
751 3300047322 Ga0495680_0005608 Ga0495680_0005608_4091_4954 287
752 3300047444 Ga0495675_0003024 Ga0495675_0003024_7129_7992 287
753 3300047673 Ga0495593_0015602 Ga0495593_0015602_3177_4040 287
754 3300047673 Ga0495593_0085877 Ga0495593_0085877_699_1562 287
755 3300048089 Ga0495614_0003972 Ga0495614_0003972_3958_4821 287
756 3300048903 Ga0496100_0021779 Ga0496100_0021779_667_1530 287
757 3300048904 Ga0496101_0026703 Ga0496101_0026703_3013_3876 287
758 3300048905 Ga0496102_0083219 Ga0496102_0083219_558_1421 287
759 3300048907 Ga0496104_0023005 Ga0496104_0023005_4664_5527 287
760 3300048908 Ga0496105_0001448 Ga0496105_0001448_10216_11079 287
761 3300048909 Ga0496106_0041307 Ga0496106_0041307_599_1462 287
762 3300048910 Ga0496107_0015114 Ga0496107_0015114_2649_3512 287
763 3300048910 Ga0496107_0055899 Ga0496107_0055899_1432_2295 287
764 3300048911 Ga0496108_0074080 Ga0496108_0074080_1645_2508 287
765 3300048912 Ga0496109_0562487 Ga0496109_0562487_37_900 287
766 3300048913 Ga0496110_0058864 Ga0496110_0058864_2486_3349 287
767 3300048914 Ga0496111_0105571 Ga0496111_0105571_295_1158 287
768 3300048917 Ga0496114_0002900 Ga0496114_0002900_2652_3515 287
769 3300048918 Ga0496115_0008715 Ga0496115_0008715_4339_5202 287
770 3300049568 Ga0501031_0007697 Ga0501031_0007697_2216_3079 287
771 3300049569 Ga0501032_0012676 Ga0501032_0012676_1798_2661 287
772 3300049569 Ga0501032_0114788 Ga0501032_0114788_856_1719 287
773 3300049570 Ga0501033_0014803 Ga0501033_0014803_2859_3722 287
774 3300049571 Ga0501034_0079371 Ga0501034_0079371_1267_2130 287
775 3300049571 Ga0501034_0255970 Ga0501034_0255970_259_1122 287
776 3300049572 Ga0501036_0014938 Ga0501036_0014938_542_1405 287
777 3300049572 Ga0501036_0234215 Ga0501036_0234215_52_915 287
778 3300049573 Ga0501037_0013364 Ga0501037_0013364_3877_4740 287
779 3300049574 Ga0501038_0011296 Ga0501038_0011296_5124_5987 287
780 3300049574 Ga0501038_0118204 Ga0501038_0118204_663_1526 287
781 3300049575 Ga0501039_0066303 Ga0501039_0066303_1811_2674 287
782 3300049581 Ga0501047_0046651 Ga0501047_0046651_1966_2829 287
783 3300049586 Ga0501070_0020457 Ga0501070_0020457_1950_2813 287
784 3300049586 Ga0501070_0104869 Ga0501070_0104869_700_1563 287
785 3300049587 Ga0501071_0037408 Ga0501071_0037408_774_1637 287
786 3300049593 Ga0501077_0028213 Ga0501077_0028213_53_916 287
787 3300049822 Ga0501035_0016613 Ga0501035_0016613_4943_5806 287
788 3300049823 Ga0501044_0379439 Ga0501044_0379439_203_1066 287
789 3300050507 nmdc:mga05p37_1543_c1 nmdc:mga05p37_1543_c1_13306_14169 287
790 3300050508 nmdc:mga09592_801_c1 nmdc:mga09592_801_c1_10054_10917 287
791 3300050511 nmdc:mga08y16_4235_c1 nmdc:mga08y16_4235_c1_783_1646 287
792 3300050512 nmdc:mga0n895_100752_c1 nmdc:mga0n895_100752_c1_1385_2248 287
793 3300050512 nmdc:mga0n895_182053_c1 nmdc:mga0n895_182053_c1_355_1221 287
794 3300050513 nmdc:mga0rr50_103133_c1 nmdc:mga0rr50_103133_c1_996_1859 287
795 3300050513 nmdc:mga0rr50_162042_c1 nmdc:mga0rr50_162042_c1_386_1252 287
796 3300050515 nmdc:mga0a205_323769_c1 nmdc:mga0a205_323769_c1_140_1006 287
797 3300050515 nmdc:mga0a205_441823_c1 nmdc:mga0a205_441823_c1_56_922 287
798 3300053077 Ga0495601_0054653 Ga0495601_0054653_734_1597 287
799 3300053078 Ga0495612_0015276 Ga0495612_0015276_1454_2317 287
800 3300053084 Ga0495595_0029673 Ga0495595_0029673_552_1415 287
801 3300053084 Ga0495595_0141081 Ga0495595_0141081_110_973 287
802 3300053085 Ga0495619_0000384 Ga0495619_0000384_24820_25683 287
803 3300053085 Ga0495619_0012701 Ga0495619_0012701_3083_3946 287
804 3300053085 Ga0495619_0047152 Ga0495619_0047152_43_906 287
805 3300053085 Ga0495619_0163759 Ga0495619_0163759_560_1423 287
806 3300053085 Ga0495619_0177259 Ga0495619_0177259_263_1126 287
807 3300053096 Ga0500641_0020806 Ga0500641_0020806_1389_2252 287
808 3300061734 Ga0530510_0069821 Ga0530510_0069821_760_1623 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

24

292

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5776 7 279
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5657 9 274
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5433 7 279
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5292 9 274
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5251 5 279
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8628 9 278 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8492 9 277 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8261 9 278 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8099 9 277 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7898 11 277 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1I3PWN8-F1-model_v4 Branched-chain amino acid transport system permease protein 0.9822 3 287 GO:0005886
GO:0006865
GO:0022857
AF-A0A522GJA6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9801 4 287 GO:0005886
GO:0006865
GO:0022857
AF-A0A643FZD4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9791 1 287 GO:0005886
GO:0006865
GO:0022857
AF-A0A060ICN4-F1-model_v4 High-affinity branched-chain amino acid ABC transporter permease protein 0.979 3 250 GO:0005886
GO:0006865
GO:0022857
AF-A0A0H2MN97-F1-model_v4 High-affinity branched-chain amino acid transport system permease protein LivH 0.9787 6 287 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
86.63 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map