F481730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 808 | 358 | 792 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0031176|Ga0395899_0031176_575_1486 |
| Length | 303 |
| Sequence | MLGQIIRARFSRAKSLMLPPVFGVLFDGFAYGMLLFLLAVGQSVTLGMMNFINLAHCSFAMLGGYVTVVLMRQYGWPFFATLPAAFVVAALVSVVFERTLYRRLYRASELDQVLLTIGIVFISVAAAAYVFGTTQQPVQLPAYLRESFNLAGIHLVVYRAVLIVIALAITGALVAGLELTRFGAQVRAAVDNERMARGLGINVERTFAITFALGSGLAGLGGALAIEIVGLDPNFAFTYLIYVLIVVSTGGLGSVAGSFAAAAVLGISDVAGKYYVPQIGAFLIYLVMVTLLMWRPRGLFGRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 3 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 4 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 5 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 6 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 7 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 8 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 9 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 10 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 11 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 12 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 168 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 169 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 202 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 206 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 347 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 348 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 349 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 350 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 355 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 356 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 357 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 358 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 0.25 |
| Isolates | 1.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.36 |
| Nodule | 1.73 |
| Rhizoplane | 2.97 |
| Rhizosphere | 92.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100002043 | 3300005330 | Bacteria | 10759 |
| 2 | Ga0068869_100005688 | 3300005334 | Bacteria | 7863 |
| 3 | Ga0068869_100212924 | 3300005334 | Bacteria | 1528 |
| 4 | Ga0070680_100002937 | 3300005336 | Bacteria | 12673 |
| 5 | Ga0070680_100324697 | 3300005336 | Bacteria | 1307 |
| 6 | Ga0070682_100035802 | 3300005337 | Bacteria | 3032 |
| 7 | Ga0070682_100072846 | 3300005337 | Bacteria | 2202 |
| 8 | Ga0068868_100007949 | 3300005338 | Bacteria | 7577 |
| 9 | Ga0070689_100009220 | 3300005340 | Bacteria | 6987 |
| 10 | Ga0070689_100400807 | 3300005340 | Bacteria | 1160 |
| 11 | Ga0070691_10014151 | 3300005341 | Bacteria | 3658 |
| 12 | Ga0070687_100000041 | 3300005343 | Bacteria | 40926 |
| 13 | Ga0070687_100185409 | 3300005343 | Bacteria | 1250 |
| 14 | Ga0070661_100057287 | 3300005344 | Bacteria | 2856 |
| 15 | Ga0070668_100053800 | 3300005347 | Bacteria | 3104 |
| 16 | Ga0070668_100100663 | 3300005347 | Bacteria | 2290 |
| 17 | Ga0070675_100091375 | 3300005354 | Bacteria | 2550 |
| 18 | Ga0070675_100151977 | 3300005354 | Bacteria | 1985 |
| 19 | Ga0070674_100016960 | 3300005356 | Bacteria | 4571 |
| 20 | Ga0070673_100125925 | 3300005364 | Bacteria | 2144 |
| 21 | Ga0070688_100049817 | 3300005365 | Bacteria | 2608 |
| 22 | Ga0070659_100190699 | 3300005366 | Bacteria | 1684 |
| 23 | Ga0070667_100009580 | 3300005367 | Bacteria | 8031 |
| 24 | Ga0070714_100184637 | 3300005435 | Bacteria | 1900 |
| 25 | Ga0070713_100037168 | 3300005436 | Bacteria | 3936 |
| 26 | Ga0070713_100065604 | 3300005436 | Bacteria | 3051 |
| 27 | Ga0070701_10001599 | 3300005438 | Bacteria | 8432 |
| 28 | Ga0070711_100030608 | 3300005439 | Bacteria | 3565 |
| 29 | Ga0070711_100104818 | 3300005439 | Bacteria | 2064 |
| 30 | Ga0070705_100001261 | 3300005440 | Bacteria | 13651 |
| 31 | Ga0070705_100001759 | 3300005440 | Bacteria | 11230 |
| 32 | Ga0070700_100002086 | 3300005441 | Bacteria | 10152 |
| 33 | Ga0070694_100001810 | 3300005444 | Bacteria | 12668 |
| 34 | Ga0070694_100019538 | 3300005444 | Bacteria | 4310 |
| 35 | Ga0070694_100029729 | 3300005444 | Bacteria | 3568 |
| 36 | Ga0070663_100012485 | 3300005455 | Bacteria | 5375 |
| 37 | Ga0070663_100028209 | 3300005455 | Bacteria | 3819 |
| 38 | Ga0070663_100117414 | 3300005455 | Bacteria | 2006 |
| 39 | Ga0070678_100011585 | 3300005456 | Bacteria | 5446 |
| 40 | Ga0070678_100113416 | 3300005456 | Bacteria | 2125 |
| 41 | Ga0070662_100007259 | 3300005457 | Bacteria | 7182 |
| 42 | Ga0070681_10034265 | 3300005458 | Bacteria | 5099 |
| 43 | Ga0070681_10445370 | 3300005458 | Bacteria | 1207 |
| 44 | Ga0068867_100001132 | 3300005459 | Bacteria | 18214 |
| 45 | Ga0070699_100004915 | 3300005518 | Bacteria | 11789 |
| 46 | Ga0070699_100184413 | 3300005518 | Bacteria | 1852 |
| 47 | Ga0070679_100030351 | 3300005530 | Bacteria | 5338 |
| 48 | Ga0070679_100057154 | 3300005530 | Bacteria | 3888 |
| 49 | Ga0070697_100002757 | 3300005536 | Bacteria | 13527 |
| 50 | Ga0070697_100040045 | 3300005536 | Bacteria | 3790 |
| 51 | Ga0070697_100060873 | 3300005536 | Bacteria | 3078 |
| 52 | Ga0070672_100202710 | 3300005543 | Bacteria | 1659 |
| 53 | Ga0070686_100004960 | 3300005544 | Bacteria | 7341 |
| 54 | Ga0070686_100026439 | 3300005544 | Bacteria | 3503 |
| 55 | Ga0070695_100003802 | 3300005545 | Bacteria | 8801 |
| 56 | Ga0070695_100007356 | 3300005545 | Bacteria | 6527 |
| 57 | Ga0070696_100003737 | 3300005546 | Bacteria | 10164 |
| 58 | Ga0070696_100005213 | 3300005546 | Bacteria | 8687 |
| 59 | Ga0070696_100368441 | 3300005546 | Bacteria | 1117 |
| 60 | Ga0070693_100000774 | 3300005547 | Bacteria | 14089 |
| 61 | Ga0070693_100052502 | 3300005547 | Bacteria | 2337 |
| 62 | Ga0070704_100000019 | 3300005549 | Bacteria | 53845 |
| 63 | Ga0070704_100340236 | 3300005549 | Bacteria | 1263 |
| 64 | Ga0068855_100006910 | 3300005563 | Bacteria | 13765 |
| 65 | Ga0070664_100056704 | 3300005564 | Bacteria | 3329 |
| 66 | Ga0068857_100183653 | 3300005577 | Bacteria | 1903 |
| 67 | Ga0068857_100198190 | 3300005577 | Bacteria | 1830 |
| 68 | Ga0070702_100001829 | 3300005615 | Bacteria | 8854 |
| 69 | Ga0068859_100024246 | 3300005617 | Bacteria | 6087 |
| 70 | Ga0068866_10000614 | 3300005718 | Bacteria | 16287 |
| 71 | Ga0068861_100004375 | 3300005719 | Bacteria | 9475 |
| 72 | Ga0068863_100078074 | 3300005841 | Bacteria | 3135 |
| 73 | Ga0068858_100007256 | 3300005842 | Bacteria | 10738 |
| 74 | Ga0068858_100055331 | 3300005842 | Bacteria | 3667 |
| 75 | Ga0068858_100072953 | 3300005842 | Bacteria | 3186 |
| 76 | Ga0068860_100023532 | 3300005843 | Bacteria | 5953 |
| 77 | Ga0068862_100003934 | 3300005844 | Bacteria | 12633 |
| 78 | Ga0081455_10000209 | 3300005937 | Bacteria | 74597 |
| 79 | Ga0081538_10054414 | 3300005981 | Bacteria | 2367 |
| 80 | Ga0081540_1000280 | 3300005983 | Bacteria | 53060 |
| 81 | Ga0081539_10004540 | 3300005985 | Bacteria | 15228 |
| 82 | Ga0081539_10039242 | 3300005985 | Bacteria | 2797 |
| 83 | Ga0075365_10296642 | 3300006038 | Bacteria | 1137 |
| 84 | Ga0070712_100003223 | 3300006175 | Bacteria | 10057 |
| 85 | Ga0070712_100026284 | 3300006175 | Bacteria | 3876 |
| 86 | Ga0070712_100159048 | 3300006175 | Bacteria | 1743 |
| 87 | Ga0070712_100213252 | 3300006175 | Bacteria | 1524 |
| 88 | Ga0075367_10105395 | 3300006178 | Bacteria | 1727 |
| 89 | Ga0075366_10029929 | 3300006195 | Bacteria | 3199 |
| 90 | Ga0097621_100000406 | 3300006237 | Bacteria | 30028 |
| 91 | Ga0097621_100002538 | 3300006237 | Bacteria | 12508 |
| 92 | Ga0097621_100030764 | 3300006237 | Bacteria | 4253 |
| 93 | Ga0097621_100121255 | 3300006237 | Bacteria | 2218 |
| 94 | Ga0068871_100007351 | 3300006358 | Bacteria | 7860 |
| 95 | Ga0068871_100014697 | 3300006358 | Bacteria | 5841 |
| 96 | Ga0075428_100003052 | 3300006844 | Bacteria | 18260 |
| 97 | Ga0075428_100158465 | 3300006844 | Bacteria | 2458 |
| 98 | Ga0075428_100174930 | 3300006844 | Bacteria | 2325 |
| 99 | Ga0075428_100619032 | 3300006844 | Bacteria | 1156 |
| 100 | Ga0075430_100001460 | 3300006846 | Bacteria | 19217 |
| 101 | Ga0075430_100014857 | 3300006846 | Bacteria | 6630 |
| 102 | Ga0075430_100303128 | 3300006846 | Bacteria | 1321 |
| 103 | Ga0075431_100000372 | 3300006847 | Bacteria | 35771 |
| 104 | Ga0075433_10001929 | 3300006852 | Bacteria | 15609 |
| 105 | Ga0075434_100000254 | 3300006871 | Bacteria | 37644 |
| 106 | Ga0075434_100000818 | 3300006871 | Bacteria | 24717 |
| 107 | Ga0075434_100057100 | 3300006871 | Bacteria | 3879 |
| 108 | Ga0075429_100006480 | 3300006880 | Bacteria | 10141 |
| 109 | Ga0068865_100003715 | 3300006881 | Bacteria | 9165 |
| 110 | Ga0075436_100000149 | 3300006914 | Bacteria | 43158 |
| 111 | Ga0075436_100029252 | 3300006914 | Bacteria | 3789 |
| 112 | Ga0097620_100024244 | 3300006931 | Bacteria | 6087 |
| 113 | Ga0075435_100001280 | 3300007076 | Bacteria | 16160 |
| 114 | Ga0075435_100051906 | 3300007076 | Bacteria | 3303 |
| 115 | Ga0075435_100141868 | 3300007076 | Bacteria | 2016 |
| 116 | Ga0075435_100223327 | 3300007076 | Bacteria | 1600 |
| 117 | Ga0075435_100224598 | 3300007076 | Bacteria | 1595 |
| 118 | Ga0099794_10161173 | 3300007265 | Bacteria | 1141 |
| 119 | Ga0105240_10297805 | 3300009093 | Bacteria | 1846 |
| 120 | Ga0111539_10008534 | 3300009094 | Bacteria | 13017 |
| 121 | Ga0111539_10012842 | 3300009094 | Bacteria | 10482 |
| 122 | Ga0111539_10033868 | 3300009094 | Bacteria | 6198 |
| 123 | Ga0105245_10001530 | 3300009098 | Bacteria | 20953 |
| 124 | Ga0114129_10003508 | 3300009147 | Bacteria | 22059 |
| 125 | Ga0114129_10116952 | 3300009147 | Bacteria | 3674 |
| 126 | Ga0114129_10666523 | 3300009147 | Bacteria | 1341 |
| 127 | Ga0114129_10828921 | 3300009147 | Bacteria | 1178 |
| 128 | Ga0114129_11114562 | 3300009147 | Bacteria | 987 |
| 129 | Ga0105243_10000478 | 3300009148 | Bacteria | 41051 |
| 130 | Ga0105243_10693075 | 3300009148 | Bacteria | 992 |
| 131 | Ga0105241_10023468 | 3300009174 | Bacteria | 4575 |
| 132 | Ga0105241_10071529 | 3300009174 | Bacteria | 2693 |
| 133 | Ga0105242_10003114 | 3300009176 | Bacteria | 12942 |
| 134 | Ga0105248_10020983 | 3300009177 | Bacteria | 7239 |
| 135 | Ga0105248_10192363 | 3300009177 | Bacteria | 2299 |
| 136 | Ga0105238_10155226 | 3300009551 | Bacteria | 2264 |
| 137 | Ga0105249_10002781 | 3300009553 | Bacteria | 15102 |
| 138 | Ga0105249_10293342 | 3300009553 | Bacteria | 1628 |
| 139 | Ga0105249_10401105 | 3300009553 | Bacteria | 1402 |
| 140 | Ga0105239_10044249 | 3300010375 | Bacteria | 4881 |
| 141 | Ga0105239_10143444 | 3300010375 | Bacteria | 2662 |
| 142 | Ga0105246_10037918 | 3300011119 | Bacteria | 3237 |
| 143 | Ga0157341_1000955 | 3300012494 | Bacteria | 1623 |
| 144 | Ga0157371_10061087 | 3300013102 | Bacteria | 2672 |
| 145 | Ga0157378_10000362 | 3300013297 | Bacteria | 44796 |
| 146 | Ga0157378_10054745 | 3300013297 | Bacteria | 3553 |
| 147 | Ga0163162_10065114 | 3300013306 | Bacteria | 3691 |
| 148 | Ga0163162_10482444 | 3300013306 | Bacteria | 1371 |
| 149 | Ga0157372_10178558 | 3300013307 | Bacteria | 2458 |
| 150 | Ga0157372_10216318 | 3300013307 | Bacteria | 2221 |
| 151 | Ga0157375_10002488 | 3300013308 | Bacteria | 15965 |
| 152 | Ga0163163_10240354 | 3300014325 | Bacteria | 1860 |
| 153 | Ga0157380_10056450 | 3300014326 | Bacteria | 3123 |
| 154 | Ga0157379_10138951 | 3300014968 | Bacteria | 2190 |
| 155 | Ga0157376_10008924 | 3300014969 | Bacteria | 7260 |
| 156 | Ga0157376_10098144 | 3300014969 | Bacteria | 2553 |
| 157 | Ga0206356_10750345 | 3300020070 | Bacteria | 987 |
| 158 | Ga0213876_10008996 | 3300021384 | Bacteria | 5381 |
| 159 | Ga0213876_10029221 | 3300021384 | Bacteria | 2906 |
| 160 | Ga0228598_1007242 | 3300024227 | Bacteria | 2265 |
| 161 | Ga0228598_1018395 | 3300024227 | Bacteria | 1378 |
| 162 | Ga0207697_10086495 | 3300025315 | Bacteria | 1325 |
| 163 | Ga0207697_10130625 | 3300025315 | Bacteria | 1085 |
| 164 | Ga0207653_10026706 | 3300025885 | Bacteria | 1852 |
| 165 | Ga0207642_10000493 | 3300025899 | Bacteria | 12123 |
| 166 | Ga0207710_10047969 | 3300025900 | Bacteria | 1910 |
| 167 | Ga0207680_10114418 | 3300025903 | Bacteria | 1755 |
| 168 | Ga0207699_10239344 | 3300025906 | Unclassified | 1246 |
| 169 | Ga0207699_10310568 | 3300025906 | Bacteria | 1103 |
| 170 | Ga0207643_10024187 | 3300025908 | Bacteria | 3352 |
| 171 | Ga0207707_10031302 | 3300025912 | Bacteria | 4655 |
| 172 | Ga0207707_10412329 | 3300025912 | Bacteria | 1159 |
| 173 | Ga0207695_10082424 | 3300025913 | Bacteria | 3252 |
| 174 | Ga0207693_10001925 | 3300025915 | Bacteria | 18182 |
| 175 | Ga0207693_10026368 | 3300025915 | Bacteria | 4599 |
| 176 | Ga0207693_10055864 | 3300025915 | Bacteria | 3097 |
| 177 | Ga0207693_10129451 | 3300025915 | Bacteria | 1984 |
| 178 | Ga0207663_10175697 | 3300025916 | Bacteria | 1525 |
| 179 | Ga0207663_10251311 | 3300025916 | Bacteria | 1301 |
| 180 | Ga0207663_10279510 | 3300025916 | Bacteria | 1239 |
| 181 | Ga0207660_10022448 | 3300025917 | Bacteria | 4252 |
| 182 | Ga0207660_10304099 | 3300025917 | Bacteria | 1270 |
| 183 | Ga0207662_10001121 | 3300025918 | Bacteria | 12604 |
| 184 | Ga0207662_10120427 | 3300025918 | Bacteria | 1646 |
| 185 | Ga0207652_10098403 | 3300025921 | Bacteria | 2580 |
| 186 | Ga0207652_10257404 | 3300025921 | Bacteria | 1574 |
| 187 | Ga0207681_10346654 | 3300025923 | Bacteria | 1188 |
| 188 | Ga0207659_10102681 | 3300025926 | Bacteria | 2159 |
| 189 | Ga0207687_10005565 | 3300025927 | Bacteria | 8322 |
| 190 | Ga0207687_10219206 | 3300025927 | Bacteria | 1497 |
| 191 | Ga0207700_10045328 | 3300025928 | Bacteria | 3244 |
| 192 | Ga0207700_10087336 | 3300025928 | Bacteria | 2453 |
| 193 | Ga0207700_10566160 | 3300025928 | Bacteria | 1010 |
| 194 | Ga0207664_10049839 | 3300025929 | Bacteria | 3299 |
| 195 | Ga0207664_10144368 | 3300025929 | Bacteria | 2017 |
| 196 | Ga0207644_10019902 | 3300025931 | Bacteria | 4558 |
| 197 | Ga0207706_10085297 | 3300025933 | Bacteria | 2777 |
| 198 | Ga0207686_10003159 | 3300025934 | Bacteria | 8864 |
| 199 | Ga0207709_10001899 | 3300025935 | Bacteria | 13782 |
| 200 | Ga0207670_10002655 | 3300025936 | Bacteria | 9408 |
| 201 | Ga0207670_10240190 | 3300025936 | Bacteria | 1395 |
| 202 | Ga0207704_10020103 | 3300025938 | Bacteria | 3524 |
| 203 | Ga0207665_10086192 | 3300025939 | Bacteria | 2168 |
| 204 | Ga0207691_10042975 | 3300025940 | Bacteria | 4166 |
| 205 | Ga0207691_10127753 | 3300025940 | Bacteria | 2248 |
| 206 | Ga0207711_10224284 | 3300025941 | Bacteria | 1720 |
| 207 | Ga0207689_10000566 | 3300025942 | Bacteria | 35376 |
| 208 | Ga0207689_10045532 | 3300025942 | Bacteria | 3627 |
| 209 | Ga0207689_10119851 | 3300025942 | Bacteria | 2165 |
| 210 | Ga0207667_10021448 | 3300025949 | Bacteria | 7157 |
| 211 | Ga0207712_10026005 | 3300025961 | Bacteria | 3895 |
| 212 | Ga0207712_10450730 | 3300025961 | Bacteria | 1091 |
| 213 | Ga0207668_10113720 | 3300025972 | Bacteria | 2036 |
| 214 | Ga0207640_10005119 | 3300025981 | Bacteria | 7130 |
| 215 | Ga0207677_10005638 | 3300026023 | Bacteria | 6806 |
| 216 | Ga0207703_10056292 | 3300026035 | Bacteria | 3202 |
| 217 | Ga0207703_10079135 | 3300026035 | Bacteria | 2734 |
| 218 | Ga0207678_10009048 | 3300026067 | Bacteria | 8768 |
| 219 | Ga0207678_10036398 | 3300026067 | Bacteria | 4284 |
| 220 | Ga0207678_10162545 | 3300026067 | Bacteria | 1907 |
| 221 | Ga0207708_10003184 | 3300026075 | Bacteria | 12089 |
| 222 | Ga0207641_10403468 | 3300026088 | Bacteria | 1313 |
| 223 | Ga0207648_10000281 | 3300026089 | Bacteria | 55309 |
| 224 | Ga0207674_10183215 | 3300026116 | Bacteria | 2045 |
| 225 | Ga0207674_10204265 | 3300026116 | Bacteria | 1925 |
| 226 | Ga0207675_100005102 | 3300026118 | Bacteria | 12637 |
| 227 | Ga0207675_100180327 | 3300026118 | Bacteria | 2022 |
| 228 | Ga0207683_10117842 | 3300026121 | Bacteria | 2381 |
| 229 | Ga0207698_10421623 | 3300026142 | Bacteria | 1281 |
| 230 | Ga0209996_1004795 | 3300027395 | Bacteria | 1727 |
| 231 | Ga0209970_1010326 | 3300027614 | Bacteria | 1527 |
| 232 | Ga0209588_1053410 | 3300027671 | Bacteria | 1307 |
| 233 | Ga0209971_1032607 | 3300027682 | Bacteria | 1250 |
| 234 | Ga0209974_10078808 | 3300027876 | Bacteria | 1131 |
| 235 | Ga0207428_10001277 | 3300027907 | Bacteria | 26936 |
| 236 | Ga0207428_10030877 | 3300027907 | Bacteria | 4426 |
| 237 | Ga0268265_10011524 | 3300028380 | Bacteria | 5976 |
| 238 | Ga0268264_10052329 | 3300028381 | Bacteria | 3404 |
| 239 | Ga0265338_10263521 | 3300028800 | Bacteria | 1266 |
| 240 | Ga0265770_1006487 | 3300030878 | Bacteria | 1627 |
| 241 | Ga0265325_10003857 | 3300031241 | Bacteria | 9631 |
| 242 | Ga0265325_10008594 | 3300031241 | Bacteria | 6016 |
| 243 | Ga0265325_10043802 | 3300031241 | Bacteria | 2333 |
| 244 | Ga0265339_10002186 | 3300031249 | Bacteria | 14187 |
| 245 | Ga0265339_10002967 | 3300031249 | Bacteria | 11987 |
| 246 | Ga0265316_10022270 | 3300031344 | Bacteria | 5347 |
| 247 | Ga0265316_10211881 | 3300031344 | Bacteria | 1432 |
| 248 | Ga0265313_10000229 | 3300031595 | Bacteria | 60627 |
| 249 | Ga0265313_10000756 | 3300031595 | Bacteria | 33038 |
| 250 | Ga0265313_10024495 | 3300031595 | Bacteria | 3222 |
| 251 | Ga0265313_10038423 | 3300031595 | Bacteria | 2384 |
| 252 | Ga0265342_10019040 | 3300031712 | Bacteria | 4432 |
| 253 | Ga0307405_10306613 | 3300031731 | Bacteria | 1207 |
| 254 | Ga0307411_10073075 | 3300032005 | Bacteria | 2331 |
| 255 | Ga0373948_0002832 | 3300034817 | Bacteria | 2605 |
| 256 | Ga0373950_0002685 | 3300034818 | Bacteria | 2473 |
| 257 | Ga0373959_0004548 | 3300034820 | Bacteria | 2240 |
| 258 | Ga0373926_0003388 | 3300035083 | Bacteria | 5135 |
| 259 | Ga0373926_0013376 | 3300035083 | Bacteria | 2782 |
| 260 | Ga0373934_0032159 | 3300035086 | Bacteria | 2057 |
| 261 | Ga0373940_0009418 | 3300035088 | Bacteria | 2271 |
| 262 | Ga0373944_0002120 | 3300035089 | Bacteria | 5039 |
| 263 | Ga0373944_0007923 | 3300035089 | Bacteria | 2861 |
| 264 | Ga0373951_0001484 | 3300035091 | Bacteria | 6116 |
| 265 | Ga0373923_0013137 | 3300035111 | Bacteria | 3079 |
| 266 | Ga0373936_0015393 | 3300035113 | Bacteria | 2931 |
| 267 | Ga0373945_0005777 | 3300035116 | Bacteria | 3971 |
| 268 | Ga0373945_0006857 | 3300035116 | Bacteria | 3681 |
| 269 | Ga0373945_0012873 | 3300035116 | Bacteria | 2785 |
| 270 | Ga0373954_0009184 | 3300035118 | Bacteria | 4349 |
| 271 | Ga0373954_0066231 | 3300035118 | Bacteria | 1710 |
| 272 | Ga0373956_0005298 | 3300035119 | Bacteria | 5164 |
| 273 | Ga0373956_0025963 | 3300035119 | Bacteria | 2535 |
| 274 | Ga0373956_0031963 | 3300035119 | Bacteria | 2308 |
| 275 | Ga0373957_0034491 | 3300035120 | Bacteria | 1874 |
| 276 | Ga0373960_0031574 | 3300035121 | Bacteria | 1482 |
| 277 | Ga0373943_0000243 | 3300035170 | Bacteria | 22511 |
| 278 | Ga0373943_0003448 | 3300035170 | Bacteria | 7194 |
| 279 | Ga0373943_0003515 | 3300035170 | Bacteria | 7140 |
| 280 | Ga0373943_0011291 | 3300035170 | Bacteria | 4018 |
| 281 | Ga0373943_0015283 | 3300035170 | Bacteria | 3485 |
| 282 | Ga0373943_0264762 | 3300035170 | Bacteria | 968 |
| 283 | Ga0373946_0002288 | 3300035171 | Bacteria | 6774 |
| 284 | Ga0373946_0007087 | 3300035171 | Bacteria | 4091 |
| 285 | Ga0373946_0207669 | 3300035171 | Bacteria | 940 |
| 286 | Ga0373946_0221667 | 3300035171 | Bacteria | 913 |
| 287 | Ga0373955_0010791 | 3300035172 | Bacteria | 4330 |
| 288 | Ga0373955_0012410 | 3300035172 | Bacteria | 4095 |
| 289 | Ga0373955_0017584 | 3300035172 | Bacteria | 3541 |
| 290 | Ga0373955_0031074 | 3300035172 | Bacteria | 2795 |
| 291 | Ga0373955_0077332 | 3300035172 | Bacteria | 1873 |
| 292 | Ga0373962_0053397 | 3300035242 | Bacteria | 1169 |
| 293 | Ga0373962_0071811 | 3300035242 | Bacteria | 1036 |
| 294 | Ga0373924_0017667 | 3300035410 | Bacteria | 2739 |
| 295 | Ga0373924_0061456 | 3300035410 | Bacteria | 1572 |
| 296 | Ga0373931_0042066 | 3300035691 | Bacteria | 2401 |
| 297 | Ga0373931_0044097 | 3300035691 | Bacteria | 2351 |
| 298 | Ga0373931_0080579 | 3300035691 | Bacteria | 1795 |
| 299 | Ga0373931_0081558 | 3300035691 | Bacteria | 1786 |
| 300 | Ga0373931_0113785 | 3300035691 | Bacteria | 1538 |
| 301 | Ga0373931_0124955 | 3300035691 | Bacteria | 1474 |
| 302 | Ga0373931_0130941 | 3300035691 | Bacteria | 1444 |
| 303 | Ga0373935_0000598 | 3300035692 | Bacteria | 18824 |
| 304 | Ga0373935_0004817 | 3300035692 | Bacteria | 7935 |
| 305 | Ga0373935_0026646 | 3300035692 | Bacteria | 3570 |
| 306 | Ga0373935_0043904 | 3300035692 | Bacteria | 2815 |
| 307 | Ga0373935_0086050 | 3300035692 | Bacteria | 2050 |
| 308 | Ga0373935_0604516 | 3300035692 | Bacteria | 802 |
| 309 | Ga0373927_0000839 | 3300035695 | Bacteria | 23542 |
| 310 | Ga0373927_0040276 | 3300035695 | Bacteria | 3031 |
| 311 | Ga0373927_0162911 | 3300035695 | Bacteria | 1461 |
| 312 | Ga0373927_0196002 | 3300035695 | Bacteria | 1325 |
| 313 | Ga0373927_0325287 | 3300035695 | Bacteria | 1013 |
| 314 | Ga0373933_0008478 | 3300035724 | Bacteria | 5608 |
| 315 | Ga0373933_0062670 | 3300035724 | Bacteria | 2246 |
| 316 | Ga0373947_0000796 | 3300035725 | Bacteria | 18989 |
| 317 | Ga0373947_0005443 | 3300035725 | Bacteria | 7428 |
| 318 | Ga0373947_0011402 | 3300035725 | Bacteria | 5101 |
| 319 | Ga0373947_0039274 | 3300035725 | Bacteria | 2815 |
| 320 | Ga0373947_0072751 | 3300035725 | Bacteria | 2111 |
| 321 | Ga0373937_0000884 | 3300036401 | Bacteria | 25679 |
| 322 | Ga0373937_0001791 | 3300036401 | Bacteria | 18052 |
| 323 | Ga0373937_0008752 | 3300036401 | Bacteria | 8784 |
| 324 | Ga0373937_0023033 | 3300036401 | Bacteria | 5602 |
| 325 | Ga0373937_0023313 | 3300036401 | Bacteria | 5572 |
| 326 | Ga0373937_0327393 | 3300036401 | Bacteria | 1450 |
| 327 | Ga0373937_0456355 | 3300036401 | Bacteria | 1214 |
| 328 | Ga0373925_0004142 | 3300037068 | Bacteria | 11003 |
| 329 | Ga0373925_0005226 | 3300037068 | Bacteria | 9706 |
| 330 | Ga0373925_0030758 | 3300037068 | Bacteria | 3941 |
| 331 | Ga0373925_0054172 | 3300037068 | Bacteria | 2999 |
| 332 | Ga0373925_0091387 | 3300037068 | Bacteria | 2327 |
| 333 | Ga0373925_0290104 | 3300037068 | Bacteria | 1319 |
| 334 | Ga0373925_0337621 | 3300037068 | Bacteria | 1222 |
| 335 | Ga0395899_0031176 | 3300037312 | Bacteria | 4007 |
| 336 | Ga0395900_0015232 | 3300037418 | Bacteria | 7841 |
| 337 | Ga0395898_0080033 | 3300037466 | Bacteria | 3151 |
| 338 | Ga0395898_0488432 | 3300037466 | Bacteria | 1171 |
| 339 | Ga0395901_0081984 | 3300038443 | Bacteria | 3369 |
| 340 | Ga0395901_0258676 | 3300038443 | Bacteria | 1812 |
| 341 | Ga0436365_0932459 | 3300039437 | Bacteria | 27077 |
| 342 | Ga0451807_0795980 | 3300041486 | Bacteria | 1368 |
| 343 | Ga0451853_0997884 | 3300041512 | Bacteria | 2031 |
| 344 | Ga0439451_018321 | 3300042009 | Bacteria | 1412 |
| 345 | Ga0439446_0045767 | 3300042156 | Bacteria | 1298 |
| 346 | Ga0439434_0012626 | 3300042435 | Bacteria | 2500 |
| 347 | Ga0439435_0014037 | 3300042436 | Bacteria | 1972 |
| 348 | Ga0439444_0001452 | 3300042437 | Bacteria | 3086 |
| 349 | Ga0439444_0007512 | 3300042437 | Bacteria | 1677 |
| 350 | Ga0439440_0069976 | 3300042993 | Bacteria | 912 |
| 351 | Ga0466963_0008739 | 3300044694 | Bacteria | 6082 |
| 352 | Ga0466968_0118290 | 3300044735 | Bacteria | 1197 |
| 353 | Ga0466957_0003978 | 3300044842 | Bacteria | 8171 |
| 354 | Ga0466957_0022422 | 3300044842 | Bacteria | 3726 |
| 355 | Ga0466957_0099377 | 3300044842 | Bacteria | 1832 |
| 356 | Ga0466959_0094922 | 3300045049 | Bacteria | 2139 |
| 357 | Ga0451576_0015388 | 3300045051 | Bacteria | 8472 |
| 358 | Ga0451576_0267165 | 3300045051 | Bacteria | 1788 |
| 359 | Ga0466958_0026431 | 3300045836 | Bacteria | 3430 |
| 360 | Ga0466958_0054032 | 3300045836 | Bacteria | 2435 |
| 361 | Ga0495592_0010606 | 3300046454 | Bacteria | 6950 |
| 362 | Ga0495592_0179612 | 3300046454 | Bacteria | 1442 |
| 363 | Ga0495603_0000816 | 3300046455 | Bacteria | 17875 |
| 364 | Ga0495603_0023995 | 3300046455 | Bacteria | 3689 |
| 365 | Ga0495629_0000140 | 3300046459 | Bacteria | 63496 |
| 366 | Ga0495629_0080581 | 3300046459 | Bacteria | 2272 |
| 367 | Ga0495629_0093268 | 3300046459 | Bacteria | 2101 |
| 368 | Ga0495638_0126630 | 3300046460 | Bacteria | 1505 |
| 369 | Ga0495641_0010088 | 3300046461 | Bacteria | 5529 |
| 370 | Ga0495651_0005708 | 3300046462 | Bacteria | 9485 |
| 371 | Ga0495651_0053596 | 3300046462 | Bacteria | 3104 |
| 372 | Ga0495651_0063109 | 3300046462 | Bacteria | 2833 |
| 373 | Ga0495651_0192046 | 3300046462 | Bacteria | 1436 |
| 374 | Ga0495653_0009696 | 3300046463 | Bacteria | 7874 |
| 375 | Ga0495653_0074245 | 3300046463 | Bacteria | 2534 |
| 376 | Ga0495580_0008507 | 3300046472 | Bacteria | 8157 |
| 377 | Ga0495580_0058773 | 3300046472 | Bacteria | 2703 |
| 378 | Ga0495580_0075751 | 3300046472 | Bacteria | 2347 |
| 379 | Ga0495580_0078199 | 3300046472 | Bacteria | 2307 |
| 380 | Ga0495582_0005878 | 3300046473 | Bacteria | 6837 |
| 381 | Ga0495582_0020830 | 3300046473 | Bacteria | 3590 |
| 382 | Ga0495582_0086278 | 3300046473 | Bacteria | 1747 |
| 383 | Ga0495639_0001632 | 3300046475 | Bacteria | 10003 |
| 384 | Ga0495639_0012276 | 3300046475 | Bacteria | 3694 |
| 385 | Ga0495639_0140261 | 3300046475 | Bacteria | 1162 |
| 386 | Ga0495662_0008367 | 3300046476 | Bacteria | 5088 |
| 387 | Ga0495662_0026957 | 3300046476 | Bacteria | 2775 |
| 388 | Ga0495662_0062796 | 3300046476 | Bacteria | 1794 |
| 389 | Ga0495662_0214653 | 3300046476 | Bacteria | 948 |
| 390 | Ga0495664_0005918 | 3300046477 | Bacteria | 6732 |
| 391 | Ga0495664_0038354 | 3300046477 | Bacteria | 2828 |
| 392 | Ga0495664_0153859 | 3300046477 | Bacteria | 1395 |
| 393 | Ga0495584_0009796 | 3300046491 | Bacteria | 4930 |
| 394 | Ga0495585_0002257 | 3300046492 | Bacteria | 13934 |
| 395 | Ga0495594_0099842 | 3300046499 | Bacteria | 1632 |
| 396 | Ga0495607_0037500 | 3300046501 | Bacteria | 2911 |
| 397 | Ga0495607_0120896 | 3300046501 | Bacteria | 1375 |
| 398 | Ga0495608_0004898 | 3300046511 | Bacteria | 9586 |
| 399 | Ga0495608_0023230 | 3300046511 | Bacteria | 4250 |
| 400 | Ga0495608_0094367 | 3300046511 | Bacteria | 1933 |
| 401 | Ga0495608_0238621 | 3300046511 | Bacteria | 1136 |
| 402 | Ga0495618_0039395 | 3300046514 | Bacteria | 2970 |
| 403 | Ga0495618_0204663 | 3300046514 | Bacteria | 1249 |
| 404 | Ga0495618_0305726 | 3300046514 | Bacteria | 987 |
| 405 | Ga0495628_0000915 | 3300046516 | Bacteria | 27087 |
| 406 | Ga0495628_0252424 | 3300046516 | Bacteria | 1316 |
| 407 | Ga0495630_0007486 | 3300046517 | Bacteria | 7804 |
| 408 | Ga0495630_0012741 | 3300046517 | Bacteria | 6107 |
| 409 | Ga0495630_0023615 | 3300046517 | Bacteria | 4545 |
| 410 | Ga0495630_0056745 | 3300046517 | Bacteria | 2934 |
| 411 | Ga0495630_0058850 | 3300046517 | Bacteria | 2881 |
| 412 | Ga0495630_0144516 | 3300046517 | Bacteria | 1809 |
| 413 | Ga0495630_0333224 | 3300046517 | Bacteria | 1161 |
| 414 | Ga0495631_0023242 | 3300046518 | Bacteria | 2876 |
| 415 | Ga0495637_0091425 | 3300046520 | Bacteria | 1200 |
| 416 | Ga0495643_0035193 | 3300046522 | Bacteria | 2759 |
| 417 | Ga0495644_0001244 | 3300046523 | Bacteria | 10440 |
| 418 | Ga0495648_0042339 | 3300046524 | Bacteria | 2866 |
| 419 | Ga0495663_0009554 | 3300046525 | Bacteria | 2690 |
| 420 | Ga0495666_0007872 | 3300046526 | Bacteria | 5337 |
| 421 | Ga0495666_0072658 | 3300046526 | Bacteria | 1633 |
| 422 | Ga0495666_0277904 | 3300046526 | Bacteria | 759 |
| 423 | Ga0495652_0032347 | 3300046529 | Bacteria | 4575 |
| 424 | Ga0495652_0061068 | 3300046529 | Bacteria | 3183 |
| 425 | Ga0495652_0072535 | 3300046529 | Bacteria | 2869 |
| 426 | Ga0495652_0077672 | 3300046529 | Bacteria | 2751 |
| 427 | Ga0495652_0234771 | 3300046529 | Bacteria | 1369 |
| 428 | Ga0495665_0004725 | 3300046531 | Bacteria | 7354 |
| 429 | Ga0495665_0015991 | 3300046531 | Bacteria | 4043 |
| 430 | Ga0495665_0086018 | 3300046531 | Bacteria | 1652 |
| 431 | Ga0495640_0000714 | 3300046533 | Bacteria | 24847 |
| 432 | Ga0495640_0007049 | 3300046533 | Bacteria | 8847 |
| 433 | Ga0495640_0045460 | 3300046533 | Bacteria | 3046 |
| 434 | Ga0495640_0190085 | 3300046533 | Bacteria | 1305 |
| 435 | Ga0495586_0000698 | 3300046535 | Bacteria | 19053 |
| 436 | Ga0495586_0004411 | 3300046535 | Bacteria | 7512 |
| 437 | Ga0495586_0009052 | 3300046535 | Bacteria | 5294 |
| 438 | Ga0495587_0007895 | 3300046536 | Bacteria | 6874 |
| 439 | Ga0495587_0017665 | 3300046536 | Bacteria | 4429 |
| 440 | Ga0495587_0017984 | 3300046536 | Bacteria | 4383 |
| 441 | Ga0495587_0025045 | 3300046536 | Bacteria | 3650 |
| 442 | Ga0495587_0037674 | 3300046536 | Bacteria | 2902 |
| 443 | Ga0495645_0001324 | 3300046543 | Bacteria | 16792 |
| 444 | Ga0495645_0002355 | 3300046543 | Bacteria | 12822 |
| 445 | Ga0495645_0123799 | 3300046543 | Bacteria | 1818 |
| 446 | Ga0495622_0011854 | 3300046557 | Bacteria | 4030 |
| 447 | Ga0495633_0006563 | 3300046558 | Bacteria | 6877 |
| 448 | Ga0495667_0004023 | 3300046559 | Bacteria | 9883 |
| 449 | Ga0495667_0004720 | 3300046559 | Bacteria | 9213 |
| 450 | Ga0495667_0005868 | 3300046559 | Bacteria | 8317 |
| 451 | Ga0495667_0187173 | 3300046559 | Bacteria | 1327 |
| 452 | Ga0495656_0003395 | 3300046615 | Bacteria | 5386 |
| 453 | Ga0495656_0007639 | 3300046615 | Bacteria | 3832 |
| 454 | Ga0495634_0003402 | 3300046642 | Bacteria | 12776 |
| 455 | Ga0495634_0004925 | 3300046642 | Bacteria | 10328 |
| 456 | Ga0495634_0081653 | 3300046642 | Bacteria | 2113 |
| 457 | Ga0495634_0293741 | 3300046642 | Bacteria | 984 |
| 458 | Ga0495635_0002459 | 3300046663 | Bacteria | 12647 |
| 459 | Ga0495635_0018448 | 3300046663 | Bacteria | 4869 |
| 460 | Ga0495635_0066698 | 3300046663 | Bacteria | 2468 |
| 461 | Ga0495659_0002292 | 3300046664 | Bacteria | 6207 |
| 462 | Ga0495659_0038500 | 3300046664 | Bacteria | 1698 |
| 463 | Ga0495661_0039401 | 3300046665 | Bacteria | 2937 |
| 464 | Ga0495588_0118332 | 3300046674 | Bacteria | 1396 |
| 465 | Ga0495657_0032788 | 3300046675 | Bacteria | 3622 |
| 466 | Ga0495657_0035218 | 3300046675 | Bacteria | 3471 |
| 467 | Ga0495657_0141207 | 3300046675 | Bacteria | 1501 |
| 468 | Ga0495599_0005271 | 3300046678 | Bacteria | 7714 |
| 469 | Ga0495599_0008419 | 3300046678 | Bacteria | 6269 |
| 470 | Ga0495599_0026248 | 3300046678 | Bacteria | 3650 |
| 471 | Ga0495599_0026682 | 3300046678 | Bacteria | 3621 |
| 472 | Ga0495599_0174668 | 3300046678 | Bacteria | 1325 |
| 473 | Ga0495599_0214759 | 3300046678 | Bacteria | 1178 |
| 474 | Ga0495623_0032008 | 3300046679 | Bacteria | 3381 |
| 475 | Ga0495623_0271517 | 3300046679 | Bacteria | 947 |
| 476 | Ga0495646_0048746 | 3300046680 | Bacteria | 2572 |
| 477 | Ga0495646_0078337 | 3300046680 | Bacteria | 1931 |
| 478 | Ga0495646_0110191 | 3300046680 | Bacteria | 1568 |
| 479 | Ga0495647_0000575 | 3300046681 | Bacteria | 10842 |
| 480 | Ga0495647_0003703 | 3300046681 | Bacteria | 4909 |
| 481 | Ga0495658_0009443 | 3300046683 | Bacteria | 4863 |
| 482 | Ga0495658_0043562 | 3300046683 | Bacteria | 2511 |
| 483 | Ga0495658_0057238 | 3300046683 | Bacteria | 2226 |
| 484 | Ga0495658_0155185 | 3300046683 | Bacteria | 1408 |
| 485 | Ga0495658_0320832 | 3300046683 | Bacteria | 982 |
| 486 | Ga0495669_0001950 | 3300046684 | Bacteria | 8478 |
| 487 | Ga0495613_0040585 | 3300046689 | Bacteria | 3448 |
| 488 | Ga0495613_0043171 | 3300046689 | Bacteria | 3335 |
| 489 | Ga0495613_0056141 | 3300046689 | Bacteria | 2892 |
| 490 | Ga0495613_0100555 | 3300046689 | Bacteria | 2088 |
| 491 | Ga0495624_0002424 | 3300046690 | Bacteria | 14161 |
| 492 | Ga0495624_0010799 | 3300046690 | Bacteria | 6295 |
| 493 | Ga0495670_0006450 | 3300046691 | Bacteria | 5762 |
| 494 | Ga0495600_0001615 | 3300046809 | Bacteria | 12569 |
| 495 | Ga0495600_0009440 | 3300046809 | Bacteria | 6027 |
| 496 | Ga0495600_0073084 | 3300046809 | Bacteria | 2239 |
| 497 | Ga0495600_0092534 | 3300046809 | Bacteria | 1972 |
| 498 | Ga0495600_0132919 | 3300046809 | Bacteria | 1617 |
| 499 | Ga0495581_0006982 | 3300047315 | Bacteria | 6542 |
| 500 | Ga0495581_0020190 | 3300047315 | Bacteria | 3868 |
| 501 | Ga0495604_0005164 | 3300047317 | Bacteria | 10338 |
| 502 | Ga0495604_0023059 | 3300047317 | Bacteria | 4967 |
| 503 | Ga0495604_0049732 | 3300047317 | Bacteria | 3255 |
| 504 | Ga0495604_0135662 | 3300047317 | Bacteria | 1764 |
| 505 | Ga0495636_0114058 | 3300047318 | Bacteria | 1191 |
| 506 | Ga0495674_0010265 | 3300047319 | Bacteria | 8868 |
| 507 | Ga0495674_0062097 | 3300047319 | Bacteria | 3254 |
| 508 | Ga0495674_0178681 | 3300047319 | Bacteria | 1768 |
| 509 | Ga0495674_0298598 | 3300047319 | Bacteria | 1316 |
| 510 | Ga0495674_0308238 | 3300047319 | Bacteria | 1292 |
| 511 | Ga0495676_0012611 | 3300047321 | Bacteria | 7610 |
| 512 | Ga0495676_0017588 | 3300047321 | Bacteria | 6317 |
| 513 | Ga0495676_0179219 | 3300047321 | Bacteria | 1486 |
| 514 | Ga0495676_0245002 | 3300047321 | Bacteria | 1225 |
| 515 | Ga0495680_0004292 | 3300047322 | Bacteria | 13673 |
| 516 | Ga0495680_0005608 | 3300047322 | Bacteria | 11762 |
| 517 | Ga0495680_0100610 | 3300047322 | Bacteria | 2154 |
| 518 | Ga0495675_0003024 | 3300047444 | Bacteria | 10101 |
| 519 | Ga0495675_0222609 | 3300047444 | Bacteria | 1141 |
| 520 | Ga0495684_0007919 | 3300047471 | Bacteria | 8218 |
| 521 | Ga0495684_0012213 | 3300047471 | Bacteria | 6626 |
| 522 | Ga0495684_0026729 | 3300047471 | Bacteria | 4435 |
| 523 | Ga0495593_0015602 | 3300047673 | Bacteria | 4299 |
| 524 | Ga0495593_0024515 | 3300047673 | Bacteria | 3343 |
| 525 | Ga0495593_0085877 | 3300047673 | Bacteria | 1623 |
| 526 | Ga0495602_0007001 | 3300048088 | Bacteria | 11838 |
| 527 | Ga0495602_0043428 | 3300048088 | Bacteria | 4087 |
| 528 | Ga0495614_0003972 | 3300048089 | Bacteria | 6640 |
| 529 | Ga0496100_0021779 | 3300048903 | Bacteria | 3867 |
| 530 | Ga0496100_0207180 | 3300048903 | Bacteria | 1432 |
| 531 | Ga0496101_0026703 | 3300048904 | Bacteria | 4015 |
| 532 | Ga0496102_0075742 | 3300048905 | Bacteria | 3093 |
| 533 | Ga0496102_0083219 | 3300048905 | Bacteria | 2952 |
| 534 | Ga0496102_0097159 | 3300048905 | Bacteria | 2731 |
| 535 | Ga0496104_0023005 | 3300048907 | Bacteria | 5727 |
| 536 | Ga0496105_0001448 | 3300048908 | Bacteria | 16699 |
| 537 | Ga0496106_0041307 | 3300048909 | Bacteria | 3455 |
| 538 | Ga0496107_0015114 | 3300048910 | Bacteria | 5407 |
| 539 | Ga0496107_0055899 | 3300048910 | Bacteria | 2850 |
| 540 | Ga0496108_0074080 | 3300048911 | Bacteria | 2875 |
| 541 | Ga0496108_0105136 | 3300048911 | Bacteria | 2410 |
| 542 | Ga0496109_0562487 | 3300048912 | Bacteria | 1075 |
| 543 | Ga0496110_0028356 | 3300048913 | Bacteria | 4808 |
| 544 | Ga0496110_0058864 | 3300048913 | Bacteria | 3385 |
| 545 | Ga0496110_0189216 | 3300048913 | Bacteria | 1869 |
| 546 | Ga0496111_0105571 | 3300048914 | Bacteria | 2073 |
| 547 | Ga0496111_0117118 | 3300048914 | Bacteria | 1965 |
| 548 | Ga0496112_0044146 | 3300048915 | Bacteria | 4367 |
| 549 | Ga0496112_0174051 | 3300048915 | Bacteria | 2117 |
| 550 | Ga0496114_0002900 | 3300048917 | Bacteria | 13140 |
| 551 | Ga0496115_0008715 | 3300048918 | Bacteria | 7517 |
| 552 | Ga0496117_0079713 | 3300048920 | Bacteria | 2156 |
| 553 | Ga0496117_0141621 | 3300048920 | Bacteria | 1439 |
| 554 | Ga0496118_0011606 | 3300048921 | Bacteria | 8578 |
| 555 | Ga0496119_0144159 | 3300048922 | Bacteria | 1283 |
| 556 | Ga0496121_0007736 | 3300048924 | Bacteria | 12882 |
| 557 | Ga0496121_0011689 | 3300048924 | Bacteria | 9696 |
| 558 | Ga0496123_0230930 | 3300048926 | Bacteria | 926 |
| 559 | Ga0496124_0285354 | 3300048927 | Bacteria | 1201 |
| 560 | Ga0496126_0076508 | 3300048929 | Bacteria | 2969 |
| 561 | Ga0501031_0007697 | 3300049568 | Bacteria | 7013 |
| 562 | Ga0501031_0037798 | 3300049568 | Bacteria | 3151 |
| 563 | Ga0501031_0287584 | 3300049568 | Bacteria | 1066 |
| 564 | Ga0501032_0012676 | 3300049569 | Bacteria | 6011 |
| 565 | Ga0501032_0047591 | 3300049569 | Bacteria | 2895 |
| 566 | Ga0501032_0114788 | 3300049569 | Bacteria | 1781 |
| 567 | Ga0501033_0000969 | 3300049570 | Bacteria | 26048 |
| 568 | Ga0501033_0010744 | 3300049570 | Bacteria | 7018 |
| 569 | Ga0501033_0014803 | 3300049570 | Bacteria | 5922 |
| 570 | Ga0501034_0069583 | 3300049571 | Bacteria | 3530 |
| 571 | Ga0501034_0079371 | 3300049571 | Bacteria | 3285 |
| 572 | Ga0501034_0255970 | 3300049571 | Bacteria | 1694 |
| 573 | Ga0501034_0265707 | 3300049571 | Bacteria | 1658 |
| 574 | Ga0501034_0371285 | 3300049571 | Bacteria | 1357 |
| 575 | Ga0501036_0000528 | 3300049572 | Bacteria | 27463 |
| 576 | Ga0501036_0001896 | 3300049572 | Bacteria | 16262 |
| 577 | Ga0501036_0014938 | 3300049572 | Bacteria | 6477 |
| 578 | Ga0501036_0073557 | 3300049572 | Bacteria | 2889 |
| 579 | Ga0501036_0147985 | 3300049572 | Bacteria | 1981 |
| 580 | Ga0501036_0234215 | 3300049572 | Bacteria | 1540 |
| 581 | Ga0501036_0433156 | 3300049572 | Bacteria | 1096 |
| 582 | Ga0501037_0013364 | 3300049573 | Bacteria | 6048 |
| 583 | Ga0501037_0034705 | 3300049573 | Bacteria | 3721 |
| 584 | Ga0501037_0102365 | 3300049573 | Bacteria | 2066 |
| 585 | Ga0501037_0385701 | 3300049573 | Bacteria | 962 |
| 586 | Ga0501038_0004135 | 3300049574 | Bacteria | 13511 |
| 587 | Ga0501038_0011296 | 3300049574 | Bacteria | 8152 |
| 588 | Ga0501038_0077934 | 3300049574 | Bacteria | 2797 |
| 589 | Ga0501038_0104400 | 3300049574 | Bacteria | 2355 |
| 590 | Ga0501038_0118204 | 3300049574 | Bacteria | 2189 |
| 591 | Ga0501039_0000053 | 3300049575 | Bacteria | 94861 |
| 592 | Ga0501039_0004579 | 3300049575 | Bacteria | 10449 |
| 593 | Ga0501039_0028342 | 3300049575 | Bacteria | 4311 |
| 594 | Ga0501039_0034849 | 3300049575 | Bacteria | 3884 |
| 595 | Ga0501039_0066303 | 3300049575 | Bacteria | 2802 |
| 596 | Ga0501039_0105979 | 3300049575 | Bacteria | 2195 |
| 597 | Ga0501039_0155028 | 3300049575 | Bacteria | 1799 |
| 598 | Ga0501040_0000761 | 3300049576 | Bacteria | 19995 |
| 599 | Ga0501040_0002928 | 3300049576 | Bacteria | 11043 |
| 600 | Ga0501040_0010125 | 3300049576 | Bacteria | 6163 |
| 601 | Ga0501040_0012485 | 3300049576 | Bacteria | 5567 |
| 602 | Ga0501040_0063836 | 3300049576 | Bacteria | 2535 |
| 603 | Ga0501040_0067346 | 3300049576 | Bacteria | 2467 |
| 604 | Ga0501041_0000066 | 3300049577 | Bacteria | 39606 |
| 605 | Ga0501041_0005396 | 3300049577 | Bacteria | 7491 |
| 606 | Ga0501042_0003840 | 3300049578 | Bacteria | 9501 |
| 607 | Ga0501042_0007088 | 3300049578 | Bacteria | 7324 |
| 608 | Ga0501042_0080111 | 3300049578 | Bacteria | 2340 |
| 609 | Ga0501042_0118479 | 3300049578 | Bacteria | 1906 |
| 610 | Ga0501042_0196660 | 3300049578 | Bacteria | 1454 |
| 611 | Ga0501043_0013794 | 3300049579 | Bacteria | 6324 |
| 612 | Ga0501043_0018617 | 3300049579 | Bacteria | 5450 |
| 613 | Ga0501043_0097328 | 3300049579 | Bacteria | 2313 |
| 614 | Ga0501043_0142012 | 3300049579 | Bacteria | 1880 |
| 615 | Ga0501043_0240218 | 3300049579 | Bacteria | 1397 |
| 616 | Ga0501046_0000927 | 3300049580 | Bacteria | 28785 |
| 617 | Ga0501046_0002981 | 3300049580 | Bacteria | 15644 |
| 618 | Ga0501046_0004708 | 3300049580 | Bacteria | 12308 |
| 619 | Ga0501046_0042639 | 3300049580 | Bacteria | 3617 |
| 620 | Ga0501046_0082367 | 3300049580 | Bacteria | 2485 |
| 621 | Ga0501046_0082633 | 3300049580 | Bacteria | 2480 |
| 622 | Ga0501046_0103981 | 3300049580 | Bacteria | 2177 |
| 623 | Ga0501047_0002326 | 3300049581 | Bacteria | 18154 |
| 624 | Ga0501047_0046651 | 3300049581 | Bacteria | 4187 |
| 625 | Ga0501047_0057336 | 3300049581 | Bacteria | 3767 |
| 626 | Ga0501048_0000221 | 3300049582 | Bacteria | 37331 |
| 627 | Ga0501048_0003011 | 3300049582 | Bacteria | 12860 |
| 628 | Ga0501048_0011184 | 3300049582 | Bacteria | 6690 |
| 629 | Ga0501048_0016864 | 3300049582 | Bacteria | 5384 |
| 630 | Ga0501048_0046995 | 3300049582 | Bacteria | 3081 |
| 631 | Ga0501048_0130282 | 3300049582 | Bacteria | 1778 |
| 632 | Ga0501067_0039738 | 3300049583 | Bacteria | 2612 |
| 633 | Ga0501068_0057648 | 3300049584 | Bacteria | 2355 |
| 634 | Ga0501069_0058755 | 3300049585 | Bacteria | 2145 |
| 635 | Ga0501069_0213966 | 3300049585 | Bacteria | 1119 |
| 636 | Ga0501069_0361334 | 3300049585 | Bacteria | 857 |
| 637 | Ga0501070_0001477 | 3300049586 | Bacteria | 21037 |
| 638 | Ga0501070_0020457 | 3300049586 | Bacteria | 5551 |
| 639 | Ga0501070_0054411 | 3300049586 | Bacteria | 3319 |
| 640 | Ga0501070_0055424 | 3300049586 | Bacteria | 3285 |
| 641 | Ga0501070_0104869 | 3300049586 | Bacteria | 2337 |
| 642 | Ga0501070_0127135 | 3300049586 | Bacteria | 2106 |
| 643 | Ga0501070_0210497 | 3300049586 | Bacteria | 1596 |
| 644 | Ga0501070_0516541 | 3300049586 | Bacteria | 958 |
| 645 | Ga0501071_0000078 | 3300049587 | Bacteria | 34978 |
| 646 | Ga0501071_0001262 | 3300049587 | Bacteria | 14342 |
| 647 | Ga0501071_0037408 | 3300049587 | Bacteria | 3466 |
| 648 | Ga0501071_0042700 | 3300049587 | Bacteria | 3250 |
| 649 | Ga0501071_0110723 | 3300049587 | Bacteria | 2029 |
| 650 | Ga0501072_0000105 | 3300049588 | Bacteria | 62421 |
| 651 | Ga0501072_0006341 | 3300049588 | Bacteria | 9009 |
| 652 | Ga0501072_0013652 | 3300049588 | Bacteria | 6219 |
| 653 | Ga0501072_0579758 | 3300049588 | Bacteria | 885 |
| 654 | Ga0501073_0024329 | 3300049589 | Bacteria | 4348 |
| 655 | Ga0501074_0014441 | 3300049590 | Bacteria | 5747 |
| 656 | Ga0501074_0032389 | 3300049590 | Bacteria | 3787 |
| 657 | Ga0501074_0056359 | 3300049590 | Bacteria | 2832 |
| 658 | Ga0501074_0147545 | 3300049590 | Bacteria | 1682 |
| 659 | Ga0501074_0278443 | 3300049590 | Bacteria | 1189 |
| 660 | Ga0501074_0285056 | 3300049590 | Bacteria | 1174 |
| 661 | Ga0501075_0001570 | 3300049591 | Bacteria | 14931 |
| 662 | Ga0501075_0002758 | 3300049591 | Bacteria | 11765 |
| 663 | Ga0501075_0004043 | 3300049591 | Bacteria | 9896 |
| 664 | Ga0501075_0086510 | 3300049591 | Bacteria | 2375 |
| 665 | Ga0501075_0222948 | 3300049591 | Bacteria | 1438 |
| 666 | Ga0501076_0002055 | 3300049592 | Bacteria | 13788 |
| 667 | Ga0501076_0002404 | 3300049592 | Bacteria | 12827 |
| 668 | Ga0501076_0010217 | 3300049592 | Bacteria | 6957 |
| 669 | Ga0501076_0107569 | 3300049592 | Bacteria | 2252 |
| 670 | Ga0501076_0186019 | 3300049592 | Bacteria | 1694 |
| 671 | Ga0501076_0220064 | 3300049592 | Bacteria | 1552 |
| 672 | Ga0501077_0000154 | 3300049593 | Bacteria | 38428 |
| 673 | Ga0501077_0002379 | 3300049593 | Bacteria | 11287 |
| 674 | Ga0501077_0028213 | 3300049593 | Bacteria | 3567 |
| 675 | Ga0501077_0053871 | 3300049593 | Bacteria | 2554 |
| 676 | Ga0501079_0000213 | 3300049741 | Bacteria | 34053 |
| 677 | Ga0501079_0001492 | 3300049741 | Bacteria | 16563 |
| 678 | Ga0501079_0030304 | 3300049741 | Bacteria | 4157 |
| 679 | Ga0501079_0055081 | 3300049741 | Bacteria | 3069 |
| 680 | Ga0501079_0087547 | 3300049741 | Bacteria | 2411 |
| 681 | Ga0501079_0203296 | 3300049741 | Bacteria | 1547 |
| 682 | Ga0501079_0232075 | 3300049741 | Bacteria | 1441 |
| 683 | Ga0501080_0001183 | 3300049742 | Bacteria | 21629 |
| 684 | Ga0501080_0013912 | 3300049742 | Bacteria | 7407 |
| 685 | Ga0501080_0057466 | 3300049742 | Bacteria | 3622 |
| 686 | Ga0501080_0110919 | 3300049742 | Bacteria | 2542 |
| 687 | Ga0501080_0193397 | 3300049742 | Bacteria | 1869 |
| 688 | Ga0501080_0281998 | 3300049742 | Bacteria | 1510 |
| 689 | Ga0501081_0000630 | 3300049743 | Bacteria | 20114 |
| 690 | Ga0501081_0006277 | 3300049743 | Bacteria | 7705 |
| 691 | Ga0501081_0009585 | 3300049743 | Bacteria | 6314 |
| 692 | Ga0501081_0025497 | 3300049743 | Bacteria | 3977 |
| 693 | Ga0501081_0055686 | 3300049743 | Bacteria | 2732 |
| 694 | Ga0501081_0074580 | 3300049743 | Bacteria | 2367 |
| 695 | Ga0501081_0134530 | 3300049743 | Bacteria | 1769 |
| 696 | Ga0501083_0005838 | 3300049744 | Bacteria | 8717 |
| 697 | Ga0501083_0005926 | 3300049744 | Bacteria | 8653 |
| 698 | Ga0501083_0150088 | 3300049744 | Bacteria | 1526 |
| 699 | Ga0501035_0001020 | 3300049822 | Bacteria | 29508 |
| 700 | Ga0501035_0005945 | 3300049822 | Bacteria | 11490 |
| 701 | Ga0501035_0016613 | 3300049822 | Bacteria | 6785 |
| 702 | Ga0501035_0058220 | 3300049822 | Bacteria | 3444 |
| 703 | Ga0501035_0186422 | 3300049822 | Bacteria | 1785 |
| 704 | Ga0501035_0215362 | 3300049822 | Bacteria | 1642 |
| 705 | Ga0501044_0079833 | 3300049823 | Bacteria | 3314 |
| 706 | Ga0501044_0379439 | 3300049823 | Bacteria | 1329 |
| 707 | Ga0501045_0000451 | 3300049824 | Bacteria | 25372 |
| 708 | Ga0501045_0001082 | 3300049824 | Bacteria | 18002 |
| 709 | Ga0501045_0018252 | 3300049824 | Bacteria | 4989 |
| 710 | Ga0501045_0053252 | 3300049824 | Bacteria | 2957 |
| 711 | Ga0501045_0211635 | 3300049824 | Bacteria | 1444 |
| 712 | Ga0501045_0238422 | 3300049824 | Bacteria | 1354 |
| 713 | nmdc:mga0yw44_237659_c1 | 3300050492 | Bacteria | 1210 |
| 714 | nmdc:mga0k408_21210_c1 | 3300050493 | Bacteria | 3648 |
| 715 | nmdc:mga05p37_122041_c1 | 3300050507 | Bacteria | 3200 |
| 716 | nmdc:mga05p37_1543_c1 | 3300050507 | Bacteria | 26771 |
| 717 | nmdc:mga05p37_20486_c1 | 3300050507 | Bacteria | 8000 |
| 718 | nmdc:mga05p37_370618_c1 | 3300050507 | Bacteria | 1680 |
| 719 | nmdc:mga05p37_91717_c1 | 3300050507 | Bacteria | 3743 |
| 720 | nmdc:mga09592_175084_c1 | 3300050508 | Bacteria | 1856 |
| 721 | nmdc:mga09592_218931_c1 | 3300050508 | Bacteria | 1650 |
| 722 | nmdc:mga09592_32945_c1 | 3300050508 | Bacteria | 4322 |
| 723 | nmdc:mga09592_444636_c1 | 3300050508 | Bacteria | 1119 |
| 724 | nmdc:mga09592_801_c1 | 3300050508 | Bacteria | 24351 |
| 725 | nmdc:mga0qj67_114522_c1 | 3300050509 | Bacteria | 2178 |
| 726 | nmdc:mga0qj67_136848_c1 | 3300050509 | Bacteria | 1985 |
| 727 | nmdc:mga0qj67_258065_c1 | 3300050509 | Bacteria | 1414 |
| 728 | nmdc:mga0qj67_30034_c1 | 3300050509 | Bacteria | 4226 |
| 729 | nmdc:mga06r32_293_c1 | 3300050510 | Bacteria | 41537 |
| 730 | nmdc:mga06r32_30198_c1 | 3300050510 | Bacteria | 5085 |
| 731 | nmdc:mga06r32_322185_c1 | 3300050510 | Bacteria | 1531 |
| 732 | nmdc:mga08y16_11098_c1 | 3300050511 | Bacteria | 9459 |
| 733 | nmdc:mga08y16_233962_c1 | 3300050511 | Bacteria | 1900 |
| 734 | nmdc:mga08y16_313918_c1 | 3300050511 | Bacteria | 1614 |
| 735 | nmdc:mga08y16_4235_c1 | 3300050511 | Bacteria | 14970 |
| 736 | nmdc:mga0n895_100752_c1 | 3300050512 | Bacteria | 2898 |
| 737 | nmdc:mga0n895_18001_c1 | 3300050512 | Bacteria | 6530 |
| 738 | nmdc:mga0n895_182053_c1 | 3300050512 | Bacteria | 2133 |
| 739 | nmdc:mga0n895_363381_c1 | 3300050512 | Bacteria | 1466 |
| 740 | nmdc:mga0n895_6296_c1 | 3300050512 | Bacteria | 10064 |
| 741 | nmdc:mga0rr50_10311_c1 | 3300050513 | Bacteria | 5923 |
| 742 | nmdc:mga0rr50_103133_c1 | 3300050513 | Bacteria | 2245 |
| 743 | nmdc:mga0rr50_162042_c1 | 3300050513 | Bacteria | 1816 |
| 744 | nmdc:mga0rr50_35947_c1 | 3300050513 | Bacteria | 3563 |
| 745 | nmdc:mga08x19_2410_c1 | 3300050514 | Bacteria | 11344 |
| 746 | nmdc:mga08x19_58983_c1 | 3300050514 | Bacteria | 2484 |
| 747 | nmdc:mga08x19_70941_c1 | 3300050514 | Bacteria | 2271 |
| 748 | nmdc:mga0a205_111119_c1 | 3300050515 | Bacteria | 2639 |
| 749 | nmdc:mga0a205_323769_c1 | 3300050515 | Bacteria | 1412 |
| 750 | nmdc:mga0a205_3271_c1 | 3300050515 | Bacteria | 14414 |
| 751 | nmdc:mga0a205_441823_c1 | 3300050515 | Bacteria | 1161 |
| 752 | nmdc:mga0a205_58114_c2 | 3300050515 | Bacteria | 3429 |
| 753 | Ga0495601_0000210 | 3300053077 | Bacteria | 31274 |
| 754 | Ga0495601_0019507 | 3300053077 | Bacteria | 4135 |
| 755 | Ga0495601_0054653 | 3300053077 | Bacteria | 2526 |
| 756 | Ga0495612_0000251 | 3300053078 | Bacteria | 22251 |
| 757 | Ga0495612_0000283 | 3300053078 | Bacteria | 20869 |
| 758 | Ga0495612_0015276 | 3300053078 | Bacteria | 3078 |
| 759 | Ga0495612_0077816 | 3300053078 | Bacteria | 1390 |
| 760 | Ga0495595_0002747 | 3300053084 | Bacteria | 6910 |
| 761 | Ga0495595_0008339 | 3300053084 | Bacteria | 4253 |
| 762 | Ga0495595_0029673 | 3300053084 | Bacteria | 2449 |
| 763 | Ga0495595_0141081 | 3300053084 | Bacteria | 1182 |
| 764 | Ga0495619_0000384 | 3300053085 | Bacteria | 30338 |
| 765 | Ga0495619_0002085 | 3300053085 | Bacteria | 13284 |
| 766 | Ga0495619_0012701 | 3300053085 | Bacteria | 5301 |
| 767 | Ga0495619_0047152 | 3300053085 | Bacteria | 2836 |
| 768 | Ga0495619_0163759 | 3300053085 | Bacteria | 1536 |
| 769 | Ga0495619_0177259 | 3300053085 | Bacteria | 1474 |
| 770 | Ga0495619_0236001 | 3300053085 | Bacteria | 1267 |
| 771 | Ga0500651_0015632 | 3300053093 | Bacteria | 4661 |
| 772 | Ga0500641_0020806 | 3300053096 | Bacteria | 2493 |
| 773 | Ga0500594_0022650 | 3300053118 | Bacteria | 1586 |
| 774 | Ga0500595_005025 | 3300053119 | Bacteria | 5821 |
| 775 | Ga0500642_0001575 | 3300053130 | Bacteria | 6575 |
| 776 | Ga0500604_0040369 | 3300053151 | Bacteria | 1407 |
| 777 | Ga0501084_0000457 | 3300054114 | Bacteria | 31427 |
| 778 | Ga0501084_0000671 | 3300054114 | Bacteria | 26137 |
| 779 | Ga0501084_0032049 | 3300054114 | Bacteria | 4396 |
| 780 | Ga0501084_0091849 | 3300054114 | Bacteria | 2549 |
| 781 | Ga0501082_0008513 | 3300060353 | Bacteria | 8846 |
| 782 | Ga0501082_0012045 | 3300060353 | Bacteria | 7431 |
| 783 | Ga0501082_0055854 | 3300060353 | Bacteria | 3401 |
| 784 | Ga0501082_0082032 | 3300060353 | Bacteria | 2782 |
| 785 | Ga0501082_0231448 | 3300060353 | Bacteria | 1608 |
| 786 | Ga0501082_0283949 | 3300060353 | Bacteria | 1441 |
| 787 | Ga0501082_0344045 | 3300060353 | Bacteria | 1300 |
| 788 | Ga0530510_0000714 | 3300061734 | Bacteria | 21552 |
| 789 | Ga0530510_0001614 | 3300061734 | Bacteria | 15223 |
| 790 | Ga0530510_0011122 | 3300061734 | Bacteria | 6312 |
| 791 | Ga0530510_0024870 | 3300061734 | Bacteria | 4279 |
| 792 | Ga0530510_0069821 | 3300061734 | Bacteria | 2549 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0026431 | Ga0466958_0026431_2674_3405 | 225 |
| 2 | 3300035171 | Ga0373946_0207669 | Ga0373946_0207669_16_747 | 243 |
| 3 | 3300035695 | Ga0373927_0325287 | Ga0373927_0325287_17_748 | 243 |
| 4 | 3300046501 | Ga0495607_0120896 | Ga0495607_0120896_20_751 | 243 |
| 5 | 3300046526 | Ga0495666_0277904 | Ga0495666_0277904_16_747 | 243 |
| 6 | 3300048905 | Ga0496102_0075742 | Ga0496102_0075742_28_759 | 243 |
| 7 | 3300049743 | Ga0501081_0134530 | Ga0501081_0134530_10_741 | 243 |
| 8 | 3300050507 | nmdc:mga05p37_122041_c1 | nmdc:mga05p37_122041_c1_26_757 | 243 |
| 9 | 3300050508 | nmdc:mga09592_218931_c1 | nmdc:mga09592_218931_c1_18_749 | 243 |
| 10 | 3300050514 | nmdc:mga08x19_2410_c1 | nmdc:mga08x19_2410_c1_514_1377 | 243 |
| 11 | 3300006844 | Ga0075428_100158465 | Ga0075428_1001584652 | 244 |
| 12 | 3300035692 | Ga0373935_0604516 | Ga0373935_0604516_20_787 | 248 |
| 13 | 3300042009 | Ga0439451_018321 | Ga0439451_018321_569_1384 | 250 |
| 14 | 3300060353 | Ga0501082_0008513 | Ga0501082_0008513_7492_8307 | 250 |
| 15 | 3300050508 | nmdc:mga09592_444636_c1 | nmdc:mga09592_444636_c1_15_830 | 251 |
| 16 | 3300050511 | nmdc:mga08y16_233962_c1 | nmdc:mga08y16_233962_c1_683_1546 | 251 |
| 17 | 3300035083 | Ga0373926_0003388 | Ga0373926_0003388_1469_2332 | 252 |
| 18 | 3300035089 | Ga0373944_0007923 | Ga0373944_0007923_868_1731 | 252 |
| 19 | 3300035113 | Ga0373936_0015393 | Ga0373936_0015393_776_1639 | 252 |
| 20 | 3300035116 | Ga0373945_0006857 | Ga0373945_0006857_1760_2623 | 252 |
| 21 | 3300035170 | Ga0373943_0015283 | Ga0373943_0015283_42_905 | 252 |
| 22 | 3300035171 | Ga0373946_0007087 | Ga0373946_0007087_631_1494 | 252 |
| 23 | 3300037068 | Ga0373925_0054172 | Ga0373925_0054172_1200_2063 | 252 |
| 24 | 3300046472 | Ga0495580_0008507 | Ga0495580_0008507_5825_6688 | 252 |
| 25 | 3300046475 | Ga0495639_0012276 | Ga0495639_0012276_1379_2242 | 252 |
| 26 | 3300046535 | Ga0495586_0004411 | Ga0495586_0004411_3852_4715 | 252 |
| 27 | 3300046674 | Ga0495588_0118332 | Ga0495588_0118332_331_1194 | 252 |
| 28 | 3300046681 | Ga0495647_0000575 | Ga0495647_0000575_3015_3878 | 252 |
| 29 | 3300046683 | Ga0495658_0057238 | Ga0495658_0057238_642_1505 | 252 |
| 30 | 3300006844 | Ga0075428_100619032 | Ga0075428_1006190321 | 254 |
| 31 | 3300006847 | Ga0075431_100000372 | Ga0075431_10000037233 | 254 |
| 32 | 3300050508 | nmdc:mga09592_175084_c1 | nmdc:mga09592_175084_c1_515_1366 | 254 |
| 33 | 3300050509 | nmdc:mga0qj67_30034_c1 | nmdc:mga0qj67_30034_c1_3008_3859 | 254 |
| 34 | 3300050510 | nmdc:mga06r32_293_c1 | nmdc:mga06r32_293_c1_3898_4749 | 254 |
| 35 | 3300046522 | Ga0495643_0035193 | Ga0495643_0035193_1493_2356 | 255 |
| 36 | 3300048903 | Ga0496100_0207180 | Ga0496100_0207180_15_782 | 255 |
| 37 | 3300048926 | Ga0496123_0230930 | Ga0496123_0230930_36_806 | 255 |
| 38 | 3300049585 | Ga0501069_0361334 | Ga0501069_0361334_76_843 | 255 |
| 39 | 3300005842 | Ga0068858_100072953 | Ga0068858_1000729532 | 256 |
| 40 | 3300006852 | Ga0075433_10001929 | Ga0075433_100019298 | 256 |
| 41 | 3300006871 | Ga0075434_100000818 | Ga0075434_10000081824 | 256 |
| 42 | 3300006914 | Ga0075436_100000149 | Ga0075436_10000014916 | 256 |
| 43 | 3300007076 | Ga0075435_100001280 | Ga0075435_10000128014 | 256 |
| 44 | 3300009094 | Ga0111539_10008534 | Ga0111539_100085346 | 256 |
| 45 | 3300026035 | Ga0207703_10056292 | Ga0207703_100562922 | 256 |
| 46 | 3300027907 | Ga0207428_10030877 | Ga0207428_100308772 | 256 |
| 47 | 3300050511 | nmdc:mga08y16_11098_c1 | nmdc:mga08y16_11098_c1_5237_6100 | 256 |
| 48 | 3300050512 | nmdc:mga0n895_6296_c1 | nmdc:mga0n895_6296_c1_5028_5891 | 256 |
| 49 | 3300050513 | nmdc:mga0rr50_35947_c1 | nmdc:mga0rr50_35947_c1_1711_2574 | 256 |
| 50 | 3300050514 | nmdc:mga08x19_70941_c1 | nmdc:mga08x19_70941_c1_281_1144 | 256 |
| 51 | 3300050515 | nmdc:mga0a205_3271_c1 | nmdc:mga0a205_3271_c1_4174_5037 | 256 |
| 52 | 3300050515 | nmdc:mga0a205_58114_c2 | nmdc:mga0a205_58114_c2_2602_3417 | 256 |
| 53 | 3300020070 | Ga0206356_10750345 | Ga0206356_107503451 | 257 |
| 54 | 3300042993 | Ga0439440_0069976 | Ga0439440_0069976_12_851 | 258 |
| 55 | 3300005518 | Ga0070699_100004915 | Ga0070699_1000049152 | 259 |
| 56 | 3300046529 | Ga0495652_0077672 | Ga0495652_0077672_1959_2738 | 259 |
| 57 | 3300049744 | Ga0501083_0150088 | Ga0501083_0150088_13_855 | 259 |
| 58 | 3300046501 | Ga0495607_0037500 | Ga0495607_0037500_15_797 | 260 |
| 59 | 3300047318 | Ga0495636_0114058 | Ga0495636_0114058_10_792 | 260 |
| 60 | 3300005985 | Ga0081539_10039242 | Ga0081539_100392422 | 261 |
| 61 | 3300005440 | Ga0070705_100001759 | Ga0070705_1000017591 | 262 |
| 62 | 3300031241 | Ga0265325_10008594 | Ga0265325_100085942 | 262 |
| 63 | 3300031595 | Ga0265313_10000229 | Ga0265313_1000022949 | 262 |
| 64 | 3300049571 | Ga0501034_0371285 | Ga0501034_0371285_14_802 | 262 |
| 65 | 3300005439 | Ga0070711_100104818 | Ga0070711_1001048182 | 263 |
| 66 | 3300006175 | Ga0070712_100003223 | Ga0070712_1000032238 | 263 |
| 67 | 3300025915 | Ga0207693_10001925 | Ga0207693_100019259 | 263 |
| 68 | 3300046473 | Ga0495582_0086278 | Ga0495582_0086278_592_1443 | 263 |
| 69 | 3300005436 | Ga0070713_100037168 | Ga0070713_1000371683 | 264 |
| 70 | 3300005536 | Ga0070697_100060873 | Ga0070697_1000608734 | 264 |
| 71 | 3300048913 | Ga0496110_0028356 | Ga0496110_0028356_1313_2176 | 264 |
| 72 | 3300048915 | Ga0496112_0174051 | Ga0496112_0174051_1227_2090 | 264 |
| 73 | 3300049742 | Ga0501080_0281998 | Ga0501080_0281998_627_1487 | 264 |
| 74 | 3300050512 | nmdc:mga0n895_363381_c1 | nmdc:mga0n895_363381_c1_480_1343 | 264 |
| 75 | 3300005985 | Ga0081539_10004540 | Ga0081539_1000454020 | 265 |
| 76 | 3300006846 | Ga0075430_100303128 | Ga0075430_1003031282 | 265 |
| 77 | 3300032005 | Ga0307411_10073075 | Ga0307411_100730752 | 265 |
| 78 | 3300049568 | Ga0501031_0037798 | Ga0501031_0037798_2016_2876 | 265 |
| 79 | 3300049570 | Ga0501033_0000969 | Ga0501033_0000969_17031_17891 | 265 |
| 80 | 3300049572 | Ga0501036_0000528 | Ga0501036_0000528_4217_5077 | 265 |
| 81 | 3300049573 | Ga0501037_0385701 | Ga0501037_0385701_61_921 | 265 |
| 82 | 3300049574 | Ga0501038_0004135 | Ga0501038_0004135_5105_5965 | 265 |
| 83 | 3300049575 | Ga0501039_0000053 | Ga0501039_0000053_10589_11449 | 265 |
| 84 | 3300049576 | Ga0501040_0002928 | Ga0501040_0002928_2160_3020 | 265 |
| 85 | 3300049577 | Ga0501041_0000066 | Ga0501041_0000066_19578_20438 | 265 |
| 86 | 3300049578 | Ga0501042_0007088 | Ga0501042_0007088_2844_3704 | 265 |
| 87 | 3300049579 | Ga0501043_0018617 | Ga0501043_0018617_1164_2024 | 265 |
| 88 | 3300049580 | Ga0501046_0000927 | Ga0501046_0000927_22764_23624 | 265 |
| 89 | 3300049581 | Ga0501047_0057336 | Ga0501047_0057336_744_1604 | 265 |
| 90 | 3300049582 | Ga0501048_0000221 | Ga0501048_0000221_28121_28981 | 265 |
| 91 | 3300049587 | Ga0501071_0001262 | Ga0501071_0001262_7339_8199 | 265 |
| 92 | 3300049588 | Ga0501072_0000105 | Ga0501072_0000105_21552_22412 | 265 |
| 93 | 3300049590 | Ga0501074_0056359 | Ga0501074_0056359_1153_2013 | 265 |
| 94 | 3300049591 | Ga0501075_0004043 | Ga0501075_0004043_6877_7737 | 265 |
| 95 | 3300049592 | Ga0501076_0186019 | Ga0501076_0186019_379_1242 | 265 |
| 96 | 3300049593 | Ga0501077_0000154 | Ga0501077_0000154_14855_15715 | 265 |
| 97 | 3300049741 | Ga0501079_0001492 | Ga0501079_0001492_8158_9018 | 265 |
| 98 | 3300049743 | Ga0501081_0000630 | Ga0501081_0000630_6996_7856 | 265 |
| 99 | 3300049822 | Ga0501035_0005945 | Ga0501035_0005945_2140_3000 | 265 |
| 100 | 3300049824 | Ga0501045_0000451 | Ga0501045_0000451_12259_13119 | 265 |
| 101 | 3300050509 | nmdc:mga0qj67_258065_c1 | nmdc:mga0qj67_258065_c1_379_1242 | 265 |
| 102 | 3300054114 | Ga0501084_0000671 | Ga0501084_0000671_21586_22446 | 265 |
| 103 | 3300061734 | Ga0530510_0000714 | Ga0530510_0000714_17713_18573 | 265 |
| 104 | 3300005546 | Ga0070696_100003737 | Ga0070696_1000037374 | 266 |
| 105 | 3300025928 | Ga0207700_10566160 | Ga0207700_105661601 | 266 |
| 106 | 3300042436 | Ga0439435_0014037 | Ga0439435_0014037_1067_1930 | 266 |
| 107 | 3300042437 | Ga0439444_0007512 | Ga0439444_0007512_285_1148 | 266 |
| 108 | 3300049572 | Ga0501036_0147985 | Ga0501036_0147985_861_1724 | 266 |
| 109 | 3300049574 | Ga0501038_0077934 | Ga0501038_0077934_1039_1902 | 266 |
| 110 | 3300049575 | Ga0501039_0034849 | Ga0501039_0034849_1776_2639 | 266 |
| 111 | 3300049575 | Ga0501039_0105979 | Ga0501039_0105979_168_1031 | 266 |
| 112 | 3300049576 | Ga0501040_0012485 | Ga0501040_0012485_1483_2346 | 266 |
| 113 | 3300049576 | Ga0501040_0067346 | Ga0501040_0067346_713_1576 | 266 |
| 114 | 3300049578 | Ga0501042_0080111 | Ga0501042_0080111_22_885 | 266 |
| 115 | 3300049579 | Ga0501043_0142012 | Ga0501043_0142012_946_1809 | 266 |
| 116 | 3300049580 | Ga0501046_0082367 | Ga0501046_0082367_1059_1922 | 266 |
| 117 | 3300049582 | Ga0501048_0046995 | Ga0501048_0046995_1730_2593 | 266 |
| 118 | 3300049591 | Ga0501075_0001570 | Ga0501075_0001570_7996_8859 | 266 |
| 119 | 3300049592 | Ga0501076_0002055 | Ga0501076_0002055_35_898 | 266 |
| 120 | 3300049593 | Ga0501077_0053871 | Ga0501077_0053871_403_1266 | 266 |
| 121 | 3300049741 | Ga0501079_0055081 | Ga0501079_0055081_1022_1885 | 266 |
| 122 | 3300049742 | Ga0501080_0057466 | Ga0501080_0057466_2277_3140 | 266 |
| 123 | 3300049743 | Ga0501081_0009585 | Ga0501081_0009585_4195_5058 | 266 |
| 124 | 3300049824 | Ga0501045_0053252 | Ga0501045_0053252_1119_1982 | 266 |
| 125 | 3300049824 | Ga0501045_0211635 | Ga0501045_0211635_231_1094 | 266 |
| 126 | 3300060353 | Ga0501082_0231448 | Ga0501082_0231448_708_1571 | 266 |
| 127 | 3300061734 | Ga0530510_0001614 | Ga0530510_0001614_9850_10713 | 266 |
| 128 | 3300005436 | Ga0070713_100065604 | Ga0070713_1000656042 | 267 |
| 129 | 3300009147 | Ga0114129_10666523 | Ga0114129_106665231 | 267 |
| 130 | 3300009147 | Ga0114129_10828921 | Ga0114129_108289211 | 267 |
| 131 | 3300025936 | Ga0207670_10240190 | Ga0207670_102401902 | 267 |
| 132 | 3300027614 | Ga0209970_1010326 | Ga0209970_10103262 | 267 |
| 133 | 3300027682 | Ga0209971_1032607 | Ga0209971_10326071 | 267 |
| 134 | 3300027876 | Ga0209974_10078808 | Ga0209974_100788082 | 267 |
| 135 | 3300036401 | Ga0373937_0023313 | Ga0373937_0023313_4137_5000 | 267 |
| 136 | 3300036401 | Ga0373937_0327393 | Ga0373937_0327393_285_1148 | 267 |
| 137 | 3300041486 | Ga0451807_0795980 | Ga0451807_0795980_457_1317 | 267 |
| 138 | 3300042435 | Ga0439434_0012626 | Ga0439434_0012626_1257_2120 | 267 |
| 139 | 3300042437 | Ga0439444_0001452 | Ga0439444_0001452_632_1495 | 267 |
| 140 | 3300046454 | Ga0495592_0010606 | Ga0495592_0010606_2465_3328 | 267 |
| 141 | 3300046462 | Ga0495651_0192046 | Ga0495651_0192046_333_1196 | 267 |
| 142 | 3300046511 | Ga0495608_0004898 | Ga0495608_0004898_3731_4594 | 267 |
| 143 | 3300046516 | Ga0495628_0000915 | Ga0495628_0000915_23748_24611 | 267 |
| 144 | 3300046517 | Ga0495630_0007486 | Ga0495630_0007486_5394_6257 | 267 |
| 145 | 3300046529 | Ga0495652_0061068 | Ga0495652_0061068_1765_2628 | 267 |
| 146 | 3300046533 | Ga0495640_0007049 | Ga0495640_0007049_6829_7692 | 267 |
| 147 | 3300046535 | Ga0495586_0000698 | Ga0495586_0000698_6037_6900 | 267 |
| 148 | 3300046536 | Ga0495587_0017984 | Ga0495587_0017984_645_1508 | 267 |
| 149 | 3300046543 | Ga0495645_0123799 | Ga0495645_0123799_334_1197 | 267 |
| 150 | 3300046559 | Ga0495667_0004720 | Ga0495667_0004720_787_1650 | 267 |
| 151 | 3300046642 | Ga0495634_0003402 | Ga0495634_0003402_8064_8927 | 267 |
| 152 | 3300046678 | Ga0495599_0026248 | Ga0495599_0026248_703_1566 | 267 |
| 153 | 3300046683 | Ga0495658_0043562 | Ga0495658_0043562_796_1659 | 267 |
| 154 | 3300046689 | Ga0495613_0043171 | Ga0495613_0043171_1155_2018 | 267 |
| 155 | 3300046809 | Ga0495600_0009440 | Ga0495600_0009440_3573_4436 | 267 |
| 156 | 3300047317 | Ga0495604_0005164 | Ga0495604_0005164_7216_8079 | 267 |
| 157 | 3300047319 | Ga0495674_0062097 | Ga0495674_0062097_343_1206 | 267 |
| 158 | 3300047322 | Ga0495680_0004292 | Ga0495680_0004292_10721_11584 | 267 |
| 159 | 3300049568 | Ga0501031_0287584 | Ga0501031_0287584_104_967 | 267 |
| 160 | 3300049580 | Ga0501046_0042639 | Ga0501046_0042639_666_1529 | 267 |
| 161 | 3300049582 | Ga0501048_0011184 | Ga0501048_0011184_3064_3927 | 267 |
| 162 | 3300049587 | Ga0501071_0042700 | Ga0501071_0042700_1725_2588 | 267 |
| 163 | 3300049590 | Ga0501074_0147545 | Ga0501074_0147545_211_1074 | 267 |
| 164 | 3300049591 | Ga0501075_0086510 | Ga0501075_0086510_161_1024 | 267 |
| 165 | 3300049822 | Ga0501035_0215362 | Ga0501035_0215362_591_1454 | 267 |
| 166 | 3300049824 | Ga0501045_0018252 | Ga0501045_0018252_2637_3500 | 267 |
| 167 | 3300050510 | nmdc:mga06r32_322185_c1 | nmdc:mga06r32_322185_c1_32_895 | 267 |
| 168 | 3300060353 | Ga0501082_0055854 | Ga0501082_0055854_2321_3184 | 267 |
| 169 | 3300044842 | Ga0466957_0022422 | Ga0466957_0022422_2540_3403 | 268 |
| 170 | 3300005347 | Ga0070668_100053800 | Ga0070668_1000538002 | 269 |
| 171 | 3300005356 | Ga0070674_100016960 | Ga0070674_1000169603 | 269 |
| 172 | 3300005444 | Ga0070694_100029729 | Ga0070694_1000297292 | 269 |
| 173 | 3300005518 | Ga0070699_100184413 | Ga0070699_1001844132 | 269 |
| 174 | 3300005536 | Ga0070697_100002757 | Ga0070697_10000275717 | 269 |
| 175 | 3300005545 | Ga0070695_100007356 | Ga0070695_1000073566 | 269 |
| 176 | 3300005981 | Ga0081538_10054414 | Ga0081538_100544142 | 269 |
| 177 | 3300006038 | Ga0075365_10296642 | Ga0075365_102966422 | 269 |
| 178 | 3300006178 | Ga0075367_10105395 | Ga0075367_101053952 | 269 |
| 179 | 3300006195 | Ga0075366_10029929 | Ga0075366_100299293 | 269 |
| 180 | 3300006237 | Ga0097621_100121255 | Ga0097621_1001212552 | 269 |
| 181 | 3300006846 | Ga0075430_100001460 | Ga0075430_1000014606 | 269 |
| 182 | 3300006846 | Ga0075430_100014857 | Ga0075430_1000148577 | 269 |
| 183 | 3300009147 | Ga0114129_11114562 | Ga0114129_111145621 | 269 |
| 184 | 3300014325 | Ga0163163_10240354 | Ga0163163_102403542 | 269 |
| 185 | 3300025315 | Ga0207697_10086495 | Ga0207697_100864952 | 269 |
| 186 | 3300025921 | Ga0207652_10098403 | Ga0207652_100984033 | 269 |
| 187 | 3300025940 | Ga0207691_10127753 | Ga0207691_101277532 | 269 |
| 188 | 3300027395 | Ga0209996_1004795 | Ga0209996_10047952 | 269 |
| 189 | 3300035170 | Ga0373943_0264762 | Ga0373943_0264762_42_905 | 269 |
| 190 | 3300035691 | Ga0373931_0044097 | Ga0373931_0044097_919_1782 | 269 |
| 191 | 3300035725 | Ga0373947_0039274 | Ga0373947_0039274_869_1732 | 269 |
| 192 | 3300036401 | Ga0373937_0456355 | Ga0373937_0456355_83_946 | 269 |
| 193 | 3300044842 | Ga0466957_0003978 | Ga0466957_0003978_1849_2712 | 269 |
| 194 | 3300046615 | Ga0495656_0007639 | Ga0495656_0007639_34_897 | 269 |
| 195 | 3300046664 | Ga0495659_0038500 | Ga0495659_0038500_20_883 | 269 |
| 196 | 3300049741 | Ga0501079_0232075 | Ga0501079_0232075_569_1429 | 269 |
| 197 | 3300050492 | nmdc:mga0yw44_237659_c1 | nmdc:mga0yw44_237659_c1_134_994 | 269 |
| 198 | 3300050493 | nmdc:mga0k408_21210_c1 | nmdc:mga0k408_21210_c1_1974_2840 | 269 |
| 199 | 3300050508 | nmdc:mga09592_32945_c1 | nmdc:mga09592_32945_c1_3166_4029 | 269 |
| 200 | 3300050509 | nmdc:mga0qj67_114522_c1 | nmdc:mga0qj67_114522_c1_689_1555 | 269 |
| 201 | 3300050509 | nmdc:mga0qj67_136848_c1 | nmdc:mga0qj67_136848_c1_975_1838 | 269 |
| 202 | 3300050510 | nmdc:mga06r32_30198_c1 | nmdc:mga06r32_30198_c1_340_1206 | 269 |
| 203 | 3300053119 | Ga0500595_005025 | Ga0500595_005025_2150_3013 | 269 |
| 204 | 3300005334 | Ga0068869_100212924 | Ga0068869_1002129242 | 270 |
| 205 | 3300005354 | Ga0070675_100091375 | Ga0070675_1000913752 | 270 |
| 206 | 3300005365 | Ga0070688_100049817 | Ga0070688_1000498172 | 270 |
| 207 | 3300005536 | Ga0070697_100040045 | Ga0070697_1000400454 | 270 |
| 208 | 3300005543 | Ga0070672_100202710 | Ga0070672_1002027102 | 270 |
| 209 | 3300006175 | Ga0070712_100213252 | Ga0070712_1002132522 | 270 |
| 210 | 3300006914 | Ga0075436_100029252 | Ga0075436_1000292522 | 270 |
| 211 | 3300007076 | Ga0075435_100224598 | Ga0075435_1002245982 | 270 |
| 212 | 3300025939 | Ga0207665_10086192 | Ga0207665_100861922 | 270 |
| 213 | 3300025940 | Ga0207691_10042975 | Ga0207691_100429751 | 270 |
| 214 | 3300025942 | Ga0207689_10119851 | Ga0207689_101198512 | 270 |
| 215 | 3300035119 | Ga0373956_0031963 | Ga0373956_0031963_213_1076 | 270 |
| 216 | 3300035724 | Ga0373933_0062670 | Ga0373933_0062670_310_1173 | 270 |
| 217 | 3300036401 | Ga0373937_0000884 | Ga0373937_0000884_6426_7289 | 270 |
| 218 | 3300046475 | Ga0495639_0140261 | Ga0495639_0140261_190_1053 | 270 |
| 219 | 3300049569 | Ga0501032_0047591 | Ga0501032_0047591_1954_2820 | 270 |
| 220 | 3300049570 | Ga0501033_0010744 | Ga0501033_0010744_2090_2956 | 270 |
| 221 | 3300049571 | Ga0501034_0069583 | Ga0501034_0069583_2090_2956 | 270 |
| 222 | 3300049572 | Ga0501036_0001896 | Ga0501036_0001896_14137_15003 | 270 |
| 223 | 3300049573 | Ga0501037_0034705 | Ga0501037_0034705_1482_2348 | 270 |
| 224 | 3300049575 | Ga0501039_0155028 | Ga0501039_0155028_152_1018 | 270 |
| 225 | 3300049579 | Ga0501043_0097328 | Ga0501043_0097328_155_1021 | 270 |
| 226 | 3300049580 | Ga0501046_0004708 | Ga0501046_0004708_578_1444 | 270 |
| 227 | 3300049582 | Ga0501048_0016864 | Ga0501048_0016864_4012_4878 | 270 |
| 228 | 3300049583 | Ga0501067_0039738 | Ga0501067_0039738_203_1069 | 270 |
| 229 | 3300049584 | Ga0501068_0057648 | Ga0501068_0057648_1473_2339 | 270 |
| 230 | 3300049589 | Ga0501073_0024329 | Ga0501073_0024329_1529_2395 | 270 |
| 231 | 3300049590 | Ga0501074_0014441 | Ga0501074_0014441_979_1845 | 270 |
| 232 | 3300049592 | Ga0501076_0220064 | Ga0501076_0220064_625_1488 | 270 |
| 233 | 3300049742 | Ga0501080_0110919 | Ga0501080_0110919_1238_2104 | 270 |
| 234 | 3300049742 | Ga0501080_0193397 | Ga0501080_0193397_866_1729 | 270 |
| 235 | 3300049744 | Ga0501083_0005838 | Ga0501083_0005838_5478_6344 | 270 |
| 236 | 3300049822 | Ga0501035_0186422 | Ga0501035_0186422_137_1003 | 270 |
| 237 | 3300049824 | Ga0501045_0238422 | Ga0501045_0238422_167_1030 | 270 |
| 238 | 3300050507 | nmdc:mga05p37_370618_c1 | nmdc:mga05p37_370618_c1_743_1606 | 270 |
| 239 | 3300054114 | Ga0501084_0091849 | Ga0501084_0091849_276_1139 | 270 |
| 240 | 3300005455 | Ga0070663_100028209 | Ga0070663_1000282092 | 271 |
| 241 | 3300007265 | Ga0099794_10161173 | Ga0099794_101611732 | 271 |
| 242 | 3300026067 | Ga0207678_10036398 | Ga0207678_100363984 | 271 |
| 243 | 3300027671 | Ga0209588_1053410 | Ga0209588_10534102 | 271 |
| 244 | 3300035091 | Ga0373951_0001484 | Ga0373951_0001484_2518_3381 | 271 |
| 245 | 3300035691 | Ga0373931_0130941 | Ga0373931_0130941_10_876 | 271 |
| 246 | 3300048922 | Ga0496119_0144159 | Ga0496119_0144159_49_867 | 271 |
| 247 | 3300048927 | Ga0496124_0285354 | Ga0496124_0285354_348_1166 | 271 |
| 248 | 3300049586 | Ga0501070_0516541 | Ga0501070_0516541_123_938 | 271 |
| 249 | 3300050511 | nmdc:mga08y16_313918_c1 | nmdc:mga08y16_313918_c1_784_1599 | 271 |
| 250 | 3300060353 | Ga0501082_0344045 | Ga0501082_0344045_56_922 | 271 |
| 251 | 3300006871 | Ga0075434_100000254 | Ga0075434_10000025437 | 272 |
| 252 | 3300007076 | Ga0075435_100051906 | Ga0075435_1000519063 | 272 |
| 253 | 3300013306 | Ga0163162_10482444 | Ga0163162_104824442 | 272 |
| 254 | 3300025929 | Ga0207664_10144368 | Ga0207664_101443682 | 272 |
| 255 | 3300030878 | Ga0265770_1006487 | Ga0265770_10064872 | 272 |
| 256 | 3300050512 | nmdc:mga0n895_18001_c1 | nmdc:mga0n895_18001_c1_1727_2590 | 272 |
| 257 | 3300050513 | nmdc:mga0rr50_10311_c1 | nmdc:mga0rr50_10311_c1_3313_4176 | 272 |
| 258 | 3300050514 | nmdc:mga08x19_58983_c1 | nmdc:mga08x19_58983_c1_679_1542 | 272 |
| 259 | 3300005343 | Ga0070687_100185409 | Ga0070687_1001854092 | 273 |
| 260 | 3300005544 | Ga0070686_100026439 | Ga0070686_1000264393 | 273 |
| 261 | 3300006237 | Ga0097621_100002538 | Ga0097621_1000025387 | 273 |
| 262 | 3300009147 | Ga0114129_10116952 | Ga0114129_101169521 | 273 |
| 263 | 3300009553 | Ga0105249_10293342 | Ga0105249_102933422 | 273 |
| 264 | 3300025927 | Ga0207687_10219206 | Ga0207687_102192062 | 273 |
| 265 | 3300025961 | Ga0207712_10450730 | Ga0207712_104507301 | 273 |
| 266 | 3300026118 | Ga0207675_100180327 | Ga0207675_1001803272 | 273 |
| 267 | 3300035116 | Ga0373945_0005777 | Ga0373945_0005777_2872_3732 | 273 |
| 268 | 3300035170 | Ga0373943_0003448 | Ga0373943_0003448_858_1718 | 273 |
| 269 | 3300035691 | Ga0373931_0081558 | Ga0373931_0081558_139_1002 | 273 |
| 270 | 3300035692 | Ga0373935_0026646 | Ga0373935_0026646_1905_2765 | 273 |
| 271 | 3300035695 | Ga0373927_0040276 | Ga0373927_0040276_1133_1993 | 273 |
| 272 | 3300037068 | Ga0373925_0091387 | Ga0373925_0091387_686_1546 | 273 |
| 273 | 3300037068 | Ga0373925_0337621 | Ga0373925_0337621_293_1159 | 273 |
| 274 | 3300046476 | Ga0495662_0026957 | Ga0495662_0026957_1096_1956 | 273 |
| 275 | 3300046514 | Ga0495618_0039395 | Ga0495618_0039395_1333_2193 | 273 |
| 276 | 3300046516 | Ga0495628_0252424 | Ga0495628_0252424_142_1002 | 273 |
| 277 | 3300046517 | Ga0495630_0023615 | Ga0495630_0023615_2528_3388 | 273 |
| 278 | 3300046526 | Ga0495666_0072658 | Ga0495666_0072658_698_1558 | 273 |
| 279 | 3300046531 | Ga0495665_0086018 | Ga0495665_0086018_19_879 | 273 |
| 280 | 3300046533 | Ga0495640_0000714 | Ga0495640_0000714_19545_20405 | 273 |
| 281 | 3300046535 | Ga0495586_0009052 | Ga0495586_0009052_470_1330 | 273 |
| 282 | 3300046543 | Ga0495645_0001324 | Ga0495645_0001324_11568_12428 | 273 |
| 283 | 3300046642 | Ga0495634_0081653 | Ga0495634_0081653_49_909 | 273 |
| 284 | 3300046663 | Ga0495635_0002459 | Ga0495635_0002459_906_1766 | 273 |
| 285 | 3300047319 | Ga0495674_0010265 | Ga0495674_0010265_6676_7536 | 273 |
| 286 | 3300047471 | Ga0495684_0012213 | Ga0495684_0012213_810_1670 | 273 |
| 287 | 3300048911 | Ga0496108_0105136 | Ga0496108_0105136_985_1851 | 273 |
| 288 | 3300048914 | Ga0496111_0117118 | Ga0496111_0117118_204_1070 | 273 |
| 289 | 3300049572 | Ga0501036_0433156 | Ga0501036_0433156_99_962 | 273 |
| 290 | 3300049575 | Ga0501039_0028342 | Ga0501039_0028342_2130_2993 | 273 |
| 291 | 3300049576 | Ga0501040_0010125 | Ga0501040_0010125_3692_4555 | 273 |
| 292 | 3300049578 | Ga0501042_0196660 | Ga0501042_0196660_551_1414 | 273 |
| 293 | 3300049580 | Ga0501046_0082633 | Ga0501046_0082633_1339_2202 | 273 |
| 294 | 3300049582 | Ga0501048_0130282 | Ga0501048_0130282_134_997 | 273 |
| 295 | 3300049585 | Ga0501069_0213966 | Ga0501069_0213966_23_886 | 273 |
| 296 | 3300049587 | Ga0501071_0110723 | Ga0501071_0110723_133_996 | 273 |
| 297 | 3300049588 | Ga0501072_0006341 | Ga0501072_0006341_1928_2791 | 273 |
| 298 | 3300049590 | Ga0501074_0278443 | Ga0501074_0278443_13_876 | 273 |
| 299 | 3300049591 | Ga0501075_0222948 | Ga0501075_0222948_76_939 | 273 |
| 300 | 3300049741 | Ga0501079_0203296 | Ga0501079_0203296_638_1501 | 273 |
| 301 | 3300049743 | Ga0501081_0074580 | Ga0501081_0074580_221_1084 | 273 |
| 302 | 3300050507 | nmdc:mga05p37_20486_c1 | nmdc:mga05p37_20486_c1_2648_3511 | 273 |
| 303 | 3300053078 | Ga0495612_0000251 | Ga0495612_0000251_16456_17316 | 273 |
| 304 | 3300053085 | Ga0495619_0002085 | Ga0495619_0002085_5064_5924 | 273 |
| 305 | 3300054114 | Ga0501084_0032049 | Ga0501084_0032049_681_1544 | 273 |
| 306 | 3300060353 | Ga0501082_0082032 | Ga0501082_0082032_711_1574 | 273 |
| 307 | 3300025923 | Ga0207681_10346654 | Ga0207681_103466541 | 274 |
| 308 | 3300049572 | Ga0501036_0073557 | Ga0501036_0073557_352_1215 | 274 |
| 309 | 3300049575 | Ga0501039_0004579 | Ga0501039_0004579_7644_8507 | 274 |
| 310 | 3300049576 | Ga0501040_0000761 | Ga0501040_0000761_5199_6062 | 274 |
| 311 | 3300049577 | Ga0501041_0005396 | Ga0501041_0005396_1109_1972 | 274 |
| 312 | 3300049578 | Ga0501042_0003840 | Ga0501042_0003840_131_994 | 274 |
| 313 | 3300049579 | Ga0501043_0240218 | Ga0501043_0240218_199_1062 | 274 |
| 314 | 3300049580 | Ga0501046_0002981 | Ga0501046_0002981_13483_14346 | 274 |
| 315 | 3300049582 | Ga0501048_0003011 | Ga0501048_0003011_11542_12405 | 274 |
| 316 | 3300049586 | Ga0501070_0127135 | Ga0501070_0127135_345_1208 | 274 |
| 317 | 3300049587 | Ga0501071_0000078 | Ga0501071_0000078_5397_6260 | 274 |
| 318 | 3300049588 | Ga0501072_0013652 | Ga0501072_0013652_1110_1973 | 274 |
| 319 | 3300049590 | Ga0501074_0032389 | Ga0501074_0032389_1388_2251 | 274 |
| 320 | 3300049591 | Ga0501075_0002758 | Ga0501075_0002758_1684_2547 | 274 |
| 321 | 3300049592 | Ga0501076_0002404 | Ga0501076_0002404_10462_11325 | 274 |
| 322 | 3300049593 | Ga0501077_0002379 | Ga0501077_0002379_4690_5553 | 274 |
| 323 | 3300049741 | Ga0501079_0000213 | Ga0501079_0000213_4247_5110 | 274 |
| 324 | 3300049742 | Ga0501080_0001183 | Ga0501080_0001183_9214_10077 | 274 |
| 325 | 3300049743 | Ga0501081_0006277 | Ga0501081_0006277_5050_5913 | 274 |
| 326 | 3300049744 | Ga0501083_0005926 | Ga0501083_0005926_6518_7381 | 274 |
| 327 | 3300049824 | Ga0501045_0001082 | Ga0501045_0001082_5722_6585 | 274 |
| 328 | 3300054114 | Ga0501084_0000457 | Ga0501084_0000457_24814_25677 | 274 |
| 329 | 3300061734 | Ga0530510_0011122 | Ga0530510_0011122_2891_3754 | 274 |
| 330 | 3300025915 | Ga0207693_10026368 | Ga0207693_100263685 | 275 |
| 331 | 3300025915 | Ga0207693_10129451 | Ga0207693_101294512 | 275 |
| 332 | 3300035083 | Ga0373926_0013376 | Ga0373926_0013376_270_1130 | 275 |
| 333 | 3300035089 | Ga0373944_0002120 | Ga0373944_0002120_1767_2627 | 275 |
| 334 | 3300035116 | Ga0373945_0012873 | Ga0373945_0012873_1492_2352 | 275 |
| 335 | 3300035170 | Ga0373943_0000243 | Ga0373943_0000243_7299_8159 | 275 |
| 336 | 3300035171 | Ga0373946_0002288 | Ga0373946_0002288_737_1597 | 275 |
| 337 | 3300035692 | Ga0373935_0000598 | Ga0373935_0000598_9640_10500 | 275 |
| 338 | 3300035695 | Ga0373927_0000839 | Ga0373927_0000839_14358_15218 | 275 |
| 339 | 3300035725 | Ga0373947_0000796 | Ga0373947_0000796_13534_14394 | 275 |
| 340 | 3300037068 | Ga0373925_0004142 | Ga0373925_0004142_1541_2401 | 275 |
| 341 | 3300046459 | Ga0495629_0093268 | Ga0495629_0093268_64_924 | 275 |
| 342 | 3300046460 | Ga0495638_0126630 | Ga0495638_0126630_191_1054 | 275 |
| 343 | 3300046531 | Ga0495665_0015991 | Ga0495665_0015991_2882_3742 | 275 |
| 344 | 3300046642 | Ga0495634_0004925 | Ga0495634_0004925_5565_6425 | 275 |
| 345 | 3300046689 | Ga0495613_0056141 | Ga0495613_0056141_937_1797 | 275 |
| 346 | 3300046690 | Ga0495624_0002424 | Ga0495624_0002424_10392_11252 | 275 |
| 347 | 3300047315 | Ga0495581_0006982 | Ga0495581_0006982_4891_5751 | 275 |
| 348 | 3300047319 | Ga0495674_0308238 | Ga0495674_0308238_382_1242 | 275 |
| 349 | 3300047321 | Ga0495676_0017588 | Ga0495676_0017588_1841_2701 | 275 |
| 350 | 3300047471 | Ga0495684_0007919 | Ga0495684_0007919_6352_7212 | 275 |
| 351 | 3300047673 | Ga0495593_0024515 | Ga0495593_0024515_886_1746 | 275 |
| 352 | 3300050515 | nmdc:mga0a205_111119_c1 | nmdc:mga0a205_111119_c1_1582_2445 | 275 |
| 353 | 3300060353 | Ga0501082_0012045 | Ga0501082_0012045_367_1230 | 275 |
| 354 | 3300005530 | Ga0070679_100030351 | Ga0070679_1000303512 | 276 |
| 355 | 3300005983 | Ga0081540_1000280 | Ga0081540_100028055 | 277 |
| 356 | 3300006844 | Ga0075428_100174930 | Ga0075428_1001749302 | 277 |
| 357 | 3300050507 | nmdc:mga05p37_91717_c1 | nmdc:mga05p37_91717_c1_791_1654 | 277 |
| 358 | 3300035172 | Ga0373955_0017584 | Ga0373955_0017584_1520_2383 | 278 |
| 359 | 3300035410 | Ga0373924_0061456 | Ga0373924_0061456_236_1114 | 278 |
| 360 | 3300036401 | Ga0373937_0023033 | Ga0373937_0023033_2803_3666 | 278 |
| 361 | 3300046511 | Ga0495608_0094367 | Ga0495608_0094367_322_1185 | 278 |
| 362 | 3300046536 | Ga0495587_0025045 | Ga0495587_0025045_2755_3618 | 278 |
| 363 | 3300046675 | Ga0495657_0032788 | Ga0495657_0032788_734_1597 | 278 |
| 364 | 3300048088 | Ga0495602_0043428 | Ga0495602_0043428_1415_2278 | 278 |
| 365 | 3300053077 | Ga0495601_0019507 | Ga0495601_0019507_245_1123 | 278 |
| 366 | 3300053078 | Ga0495612_0077816 | Ga0495612_0077816_245_1123 | 278 |
| 367 | 3300053084 | Ga0495595_0008339 | Ga0495595_0008339_1830_2693 | 278 |
| 368 | 3300049585 | Ga0501069_0058755 | Ga0501069_0058755_503_1366 | 279 |
| 369 | 3300049586 | Ga0501070_0001477 | Ga0501070_0001477_267_1130 | 279 |
| 370 | 3300049586 | Ga0501070_0055424 | Ga0501070_0055424_645_1508 | 279 |
| 371 | 3300049592 | Ga0501076_0107569 | Ga0501076_0107569_352_1215 | 279 |
| 372 | 3300049741 | Ga0501079_0030304 | Ga0501079_0030304_197_1060 | 279 |
| 373 | 3300049743 | Ga0501081_0055686 | Ga0501081_0055686_481_1344 | 279 |
| 374 | 3300049822 | Ga0501035_0001020 | Ga0501035_0001020_14272_15135 | 279 |
| 375 | iso_pu_bacteria | 2917699015 | 2917703562 | 279 |
| 376 | 3300005444 | Ga0070694_100019538 | Ga0070694_1000195383 | 280 |
| 377 | 3300028800 | Ga0265338_10263521 | Ga0265338_102635211 | 281 |
| 378 | 3300031241 | Ga0265325_10043802 | Ga0265325_100438022 | 281 |
| 379 | 3300031249 | Ga0265339_10002186 | Ga0265339_100021867 | 281 |
| 380 | 3300031595 | Ga0265313_10000756 | Ga0265313_1000075620 | 281 |
| 381 | 3300031712 | Ga0265342_10019040 | Ga0265342_100190402 | 281 |
| 382 | 3300035695 | Ga0373927_0162911 | Ga0373927_0162911_396_1256 | 281 |
| 383 | 3300036401 | Ga0373937_0008752 | Ga0373937_0008752_400_1260 | 281 |
| 384 | 3300046477 | Ga0495664_0153859 | Ga0495664_0153859_340_1200 | 281 |
| 385 | 3300046514 | Ga0495618_0204663 | Ga0495618_0204663_294_1154 | 281 |
| 386 | 3300046517 | Ga0495630_0144516 | Ga0495630_0144516_15_875 | 281 |
| 387 | 3300046529 | Ga0495652_0234771 | Ga0495652_0234771_78_938 | 281 |
| 388 | 3300046642 | Ga0495634_0293741 | Ga0495634_0293741_98_958 | 281 |
| 389 | 3300046678 | Ga0495599_0174668 | Ga0495599_0174668_355_1215 | 281 |
| 390 | 3300047319 | Ga0495674_0298598 | Ga0495674_0298598_276_1136 | 281 |
| 391 | 3300049590 | Ga0501074_0285056 | Ga0501074_0285056_235_1098 | 281 |
| 392 | 3300049576 | Ga0501040_0063836 | Ga0501040_0063836_1425_2288 | 282 |
| 393 | iso_pu_bacteria | 2932828146 | 2932837044 | 282 |
| 394 | iso_pu_bacteria | 2935616580 | 2935616985 | 282 |
| 395 | iso_pu_bacteria | 2935703347 | 2935711737 | 282 |
| 396 | iso_pu_bacteria | 2935801545 | 2935810203 | 282 |
| 397 | iso_pu_bacteria | 2935837841 | 2935846852 | 282 |
| 398 | iso_pu_bacteria | 2935855204 | 2935855610 | 282 |
| 399 | iso_pu_bacteria | 2935864058 | 2935870248 | 282 |
| 400 | iso_pu_bacteria | 2935873716 | 2935876035 | 282 |
| 401 | iso_pu_bacteria | 2936002035 | 2936010670 | 282 |
| 402 | iso_pu_bacteria | 2941538514 | 2941547299 | 282 |
| 403 | iso_pu_bacteria | 8016511872 | 8016521586 | 282 |
| 404 | iso_pu_bacteria | 8017057580 | 8017064051 | 282 |
| 405 | iso_pu_bacteria | 8019576017 | 8019583376 | 282 |
| 406 | iso_pu_bacteria | 8019586578 | 8019591188 | 282 |
| 407 | 3300005366 | Ga0070659_100190699 | Ga0070659_1001906992 | 283 |
| 408 | 3300005458 | Ga0070681_10445370 | Ga0070681_104453702 | 283 |
| 409 | 3300025912 | Ga0207707_10412329 | Ga0207707_104123292 | 283 |
| 410 | 3300049588 | Ga0501072_0579758 | Ga0501072_0579758_22_873 | 283 |
| 411 | iso_pu_bacteria | 2643221547 | 2643758415 | 283 |
| 412 | 3300005435 | Ga0070714_100184637 | Ga0070714_1001846372 | 286 |
| 413 | 3300005455 | Ga0070663_100117414 | Ga0070663_1001174142 | 286 |
| 414 | 3300024227 | Ga0228598_1007242 | Ga0228598_10072422 | 286 |
| 415 | 3300025906 | Ga0207699_10239344 | Ga0207699_102393441 | 286 |
| 416 | 3300025916 | Ga0207663_10279510 | Ga0207663_102795101 | 286 |
| 417 | 3300025928 | Ga0207700_10087336 | Ga0207700_100873362 | 286 |
| 418 | 3300026067 | Ga0207678_10162545 | Ga0207678_101625452 | 286 |
| 419 | 3300035171 | Ga0373946_0221667 | Ga0373946_0221667_13_873 | 286 |
| 420 | 3300035172 | Ga0373955_0031074 | Ga0373955_0031074_1172_2032 | 286 |
| 421 | 3300035410 | Ga0373924_0017667 | Ga0373924_0017667_386_1246 | 286 |
| 422 | 3300035692 | Ga0373935_0043904 | Ga0373935_0043904_162_1022 | 286 |
| 423 | 3300035725 | Ga0373947_0011402 | Ga0373947_0011402_1952_2812 | 286 |
| 424 | 3300036401 | Ga0373937_0001791 | Ga0373937_0001791_6978_7838 | 286 |
| 425 | 3300037068 | Ga0373925_0030758 | Ga0373925_0030758_798_1658 | 286 |
| 426 | 3300044694 | Ga0466963_0008739 | Ga0466963_0008739_3818_4678 | 286 |
| 427 | 3300044735 | Ga0466968_0118290 | Ga0466968_0118290_23_883 | 286 |
| 428 | 3300044842 | Ga0466957_0099377 | Ga0466957_0099377_480_1340 | 286 |
| 429 | 3300045049 | Ga0466959_0094922 | Ga0466959_0094922_64_924 | 286 |
| 430 | 3300045836 | Ga0466958_0054032 | Ga0466958_0054032_1199_2059 | 286 |
| 431 | 3300046462 | Ga0495651_0063109 | Ga0495651_0063109_999_1859 | 286 |
| 432 | 3300046514 | Ga0495618_0305726 | Ga0495618_0305726_28_888 | 286 |
| 433 | 3300046524 | Ga0495648_0042339 | Ga0495648_0042339_415_1278 | 286 |
| 434 | 3300046536 | Ga0495587_0037674 | Ga0495587_0037674_700_1560 | 286 |
| 435 | 3300046543 | Ga0495645_0002355 | Ga0495645_0002355_2659_3519 | 286 |
| 436 | 3300046559 | Ga0495667_0004023 | Ga0495667_0004023_4128_4988 | 286 |
| 437 | 3300046675 | Ga0495657_0141207 | Ga0495657_0141207_502_1362 | 286 |
| 438 | 3300046678 | Ga0495599_0008419 | Ga0495599_0008419_2242_3102 | 286 |
| 439 | 3300046678 | Ga0495599_0026682 | Ga0495599_0026682_2303_3163 | 286 |
| 440 | 3300046678 | Ga0495599_0214759 | Ga0495599_0214759_104_964 | 286 |
| 441 | 3300046679 | Ga0495623_0032008 | Ga0495623_0032008_62_922 | 286 |
| 442 | 3300046680 | Ga0495646_0048746 | Ga0495646_0048746_24_884 | 286 |
| 443 | 3300046809 | Ga0495600_0092534 | Ga0495600_0092534_746_1606 | 286 |
| 444 | 3300047317 | Ga0495604_0135662 | Ga0495604_0135662_675_1535 | 286 |
| 445 | 3300047322 | Ga0495680_0100610 | Ga0495680_0100610_863_1723 | 286 |
| 446 | 3300047444 | Ga0495675_0222609 | Ga0495675_0222609_188_1048 | 286 |
| 447 | 3300047471 | Ga0495684_0026729 | Ga0495684_0026729_2313_3173 | 286 |
| 448 | 3300048088 | Ga0495602_0007001 | Ga0495602_0007001_9325_10185 | 286 |
| 449 | 3300048905 | Ga0496102_0097159 | Ga0496102_0097159_1762_2625 | 286 |
| 450 | 3300048913 | Ga0496110_0189216 | Ga0496110_0189216_421_1284 | 286 |
| 451 | 3300048915 | Ga0496112_0044146 | Ga0496112_0044146_115_978 | 286 |
| 452 | 3300048920 | Ga0496117_0079713 | Ga0496117_0079713_593_1456 | 286 |
| 453 | 3300048920 | Ga0496117_0141621 | Ga0496117_0141621_246_1109 | 286 |
| 454 | 3300048921 | Ga0496118_0011606 | Ga0496118_0011606_3799_4662 | 286 |
| 455 | 3300048924 | Ga0496121_0007736 | Ga0496121_0007736_5208_6071 | 286 |
| 456 | 3300048924 | Ga0496121_0011689 | Ga0496121_0011689_4930_5793 | 286 |
| 457 | 3300048929 | Ga0496126_0076508 | Ga0496126_0076508_1298_2161 | 286 |
| 458 | 3300049571 | Ga0501034_0265707 | Ga0501034_0265707_762_1622 | 286 |
| 459 | 3300049573 | Ga0501037_0102365 | Ga0501037_0102365_495_1355 | 286 |
| 460 | 3300049574 | Ga0501038_0104400 | Ga0501038_0104400_1198_2058 | 286 |
| 461 | 3300049578 | Ga0501042_0118479 | Ga0501042_0118479_847_1707 | 286 |
| 462 | 3300049579 | Ga0501043_0013794 | Ga0501043_0013794_4066_4926 | 286 |
| 463 | 3300049580 | Ga0501046_0103981 | Ga0501046_0103981_199_1059 | 286 |
| 464 | 3300049581 | Ga0501047_0002326 | Ga0501047_0002326_5204_6064 | 286 |
| 465 | 3300049586 | Ga0501070_0054411 | Ga0501070_0054411_439_1299 | 286 |
| 466 | 3300049586 | Ga0501070_0210497 | Ga0501070_0210497_480_1340 | 286 |
| 467 | 3300049592 | Ga0501076_0010217 | Ga0501076_0010217_2742_3602 | 286 |
| 468 | 3300049741 | Ga0501079_0087547 | Ga0501079_0087547_141_1001 | 286 |
| 469 | 3300049742 | Ga0501080_0013912 | Ga0501080_0013912_5256_6116 | 286 |
| 470 | 3300049743 | Ga0501081_0025497 | Ga0501081_0025497_2797_3657 | 286 |
| 471 | 3300049822 | Ga0501035_0058220 | Ga0501035_0058220_291_1151 | 286 |
| 472 | 3300049823 | Ga0501044_0079833 | Ga0501044_0079833_2049_2909 | 286 |
| 473 | 3300053077 | Ga0495601_0000210 | Ga0495601_0000210_21091_21951 | 286 |
| 474 | 3300053078 | Ga0495612_0000283 | Ga0495612_0000283_9342_10202 | 286 |
| 475 | 3300053084 | Ga0495595_0002747 | Ga0495595_0002747_5535_6395 | 286 |
| 476 | 3300053085 | Ga0495619_0236001 | Ga0495619_0236001_128_988 | 286 |
| 477 | 3300053093 | Ga0500651_0015632 | Ga0500651_0015632_2798_3661 | 286 |
| 478 | 3300053118 | Ga0500594_0022650 | Ga0500594_0022650_383_1246 | 286 |
| 479 | 3300053130 | Ga0500642_0001575 | Ga0500642_0001575_5275_6138 | 286 |
| 480 | 3300053151 | Ga0500604_0040369 | Ga0500604_0040369_404_1267 | 286 |
| 481 | 3300060353 | Ga0501082_0283949 | Ga0501082_0283949_149_1009 | 286 |
| 482 | 3300061734 | Ga0530510_0024870 | Ga0530510_0024870_448_1308 | 286 |
| 483 | 3300005330 | Ga0070690_100002043 | Ga0070690_1000020432 | 287 |
| 484 | 3300005334 | Ga0068869_100005688 | Ga0068869_1000056884 | 287 |
| 485 | 3300005336 | Ga0070680_100002937 | Ga0070680_1000029372 | 287 |
| 486 | 3300005336 | Ga0070680_100324697 | Ga0070680_1003246972 | 287 |
| 487 | 3300005337 | Ga0070682_100035802 | Ga0070682_1000358023 | 287 |
| 488 | 3300005337 | Ga0070682_100072846 | Ga0070682_1000728461 | 287 |
| 489 | 3300005338 | Ga0068868_100007949 | Ga0068868_1000079492 | 287 |
| 490 | 3300005340 | Ga0070689_100009220 | Ga0070689_1000092208 | 287 |
| 491 | 3300005340 | Ga0070689_100400807 | Ga0070689_1004008071 | 287 |
| 492 | 3300005341 | Ga0070691_10014151 | Ga0070691_100141514 | 287 |
| 493 | 3300005343 | Ga0070687_100000041 | Ga0070687_1000000414 | 287 |
| 494 | 3300005344 | Ga0070661_100057287 | Ga0070661_1000572873 | 287 |
| 495 | 3300005347 | Ga0070668_100100663 | Ga0070668_1001006632 | 287 |
| 496 | 3300005354 | Ga0070675_100151977 | Ga0070675_1001519772 | 287 |
| 497 | 3300005364 | Ga0070673_100125925 | Ga0070673_1001259252 | 287 |
| 498 | 3300005367 | Ga0070667_100009580 | Ga0070667_1000095809 | 287 |
| 499 | 3300005438 | Ga0070701_10001599 | Ga0070701_100015993 | 287 |
| 500 | 3300005439 | Ga0070711_100030608 | Ga0070711_1000306082 | 287 |
| 501 | 3300005440 | Ga0070705_100001261 | Ga0070705_1000012616 | 287 |
| 502 | 3300005441 | Ga0070700_100002086 | Ga0070700_10000208613 | 287 |
| 503 | 3300005444 | Ga0070694_100001810 | Ga0070694_10000181017 | 287 |
| 504 | 3300005455 | Ga0070663_100012485 | Ga0070663_1000124854 | 287 |
| 505 | 3300005456 | Ga0070678_100011585 | Ga0070678_1000115857 | 287 |
| 506 | 3300005456 | Ga0070678_100113416 | Ga0070678_1001134162 | 287 |
| 507 | 3300005457 | Ga0070662_100007259 | Ga0070662_1000072595 | 287 |
| 508 | 3300005458 | Ga0070681_10034265 | Ga0070681_100342655 | 287 |
| 509 | 3300005459 | Ga0068867_100001132 | Ga0068867_1000011326 | 287 |
| 510 | 3300005530 | Ga0070679_100057154 | Ga0070679_1000571541 | 287 |
| 511 | 3300005544 | Ga0070686_100004960 | Ga0070686_1000049602 | 287 |
| 512 | 3300005545 | Ga0070695_100003802 | Ga0070695_1000038024 | 287 |
| 513 | 3300005546 | Ga0070696_100005213 | Ga0070696_1000052136 | 287 |
| 514 | 3300005546 | Ga0070696_100368441 | Ga0070696_1003684411 | 287 |
| 515 | 3300005547 | Ga0070693_100000774 | Ga0070693_1000007744 | 287 |
| 516 | 3300005547 | Ga0070693_100052502 | Ga0070693_1000525022 | 287 |
| 517 | 3300005549 | Ga0070704_100000019 | Ga0070704_10000001917 | 287 |
| 518 | 3300005549 | Ga0070704_100340236 | Ga0070704_1003402362 | 287 |
| 519 | 3300005563 | Ga0068855_100006910 | Ga0068855_10000691010 | 287 |
| 520 | 3300005564 | Ga0070664_100056704 | Ga0070664_1000567042 | 287 |
| 521 | 3300005577 | Ga0068857_100183653 | Ga0068857_1001836531 | 287 |
| 522 | 3300005577 | Ga0068857_100198190 | Ga0068857_1001981902 | 287 |
| 523 | 3300005615 | Ga0070702_100001829 | Ga0070702_1000018292 | 287 |
| 524 | 3300005617 | Ga0068859_100024246 | Ga0068859_1000242464 | 287 |
| 525 | 3300005718 | Ga0068866_10000614 | Ga0068866_1000061414 | 287 |
| 526 | 3300005719 | Ga0068861_100004375 | Ga0068861_1000043754 | 287 |
| 527 | 3300005841 | Ga0068863_100078074 | Ga0068863_1000780744 | 287 |
| 528 | 3300005842 | Ga0068858_100007256 | Ga0068858_1000072568 | 287 |
| 529 | 3300005842 | Ga0068858_100055331 | Ga0068858_1000553313 | 287 |
| 530 | 3300005843 | Ga0068860_100023532 | Ga0068860_1000235325 | 287 |
| 531 | 3300005844 | Ga0068862_100003934 | Ga0068862_1000039346 | 287 |
| 532 | 3300005937 | Ga0081455_10000209 | Ga0081455_1000020959 | 287 |
| 533 | 3300006175 | Ga0070712_100026284 | Ga0070712_1000262843 | 287 |
| 534 | 3300006175 | Ga0070712_100159048 | Ga0070712_1001590482 | 287 |
| 535 | 3300006237 | Ga0097621_100000406 | Ga0097621_10000040630 | 287 |
| 536 | 3300006237 | Ga0097621_100030764 | Ga0097621_1000307642 | 287 |
| 537 | 3300006358 | Ga0068871_100007351 | Ga0068871_1000073517 | 287 |
| 538 | 3300006358 | Ga0068871_100014697 | Ga0068871_1000146973 | 287 |
| 539 | 3300006844 | Ga0075428_100003052 | Ga0075428_10000305219 | 287 |
| 540 | 3300006871 | Ga0075434_100057100 | Ga0075434_1000571005 | 287 |
| 541 | 3300006880 | Ga0075429_100006480 | Ga0075429_10000648011 | 287 |
| 542 | 3300006881 | Ga0068865_100003715 | Ga0068865_1000037154 | 287 |
| 543 | 3300006931 | Ga0097620_100024244 | Ga0097620_1000242444 | 287 |
| 544 | 3300007076 | Ga0075435_100141868 | Ga0075435_1001418682 | 287 |
| 545 | 3300007076 | Ga0075435_100223327 | Ga0075435_1002233272 | 287 |
| 546 | 3300009093 | Ga0105240_10297805 | Ga0105240_102978052 | 287 |
| 547 | 3300009094 | Ga0111539_10012842 | Ga0111539_1001284212 | 287 |
| 548 | 3300009094 | Ga0111539_10033868 | Ga0111539_100338682 | 287 |
| 549 | 3300009098 | Ga0105245_10001530 | Ga0105245_1000153025 | 287 |
| 550 | 3300009147 | Ga0114129_10003508 | Ga0114129_1000350819 | 287 |
| 551 | 3300009148 | Ga0105243_10000478 | Ga0105243_100004785 | 287 |
| 552 | 3300009148 | Ga0105243_10693075 | Ga0105243_106930751 | 287 |
| 553 | 3300009174 | Ga0105241_10023468 | Ga0105241_100234682 | 287 |
| 554 | 3300009174 | Ga0105241_10071529 | Ga0105241_100715292 | 287 |
| 555 | 3300009176 | Ga0105242_10003114 | Ga0105242_1000311412 | 287 |
| 556 | 3300009177 | Ga0105248_10020983 | Ga0105248_100209832 | 287 |
| 557 | 3300009177 | Ga0105248_10192363 | Ga0105248_101923632 | 287 |
| 558 | 3300009551 | Ga0105238_10155226 | Ga0105238_101552262 | 287 |
| 559 | 3300009553 | Ga0105249_10002781 | Ga0105249_100027815 | 287 |
| 560 | 3300009553 | Ga0105249_10401105 | Ga0105249_104011052 | 287 |
| 561 | 3300010375 | Ga0105239_10044249 | Ga0105239_100442492 | 287 |
| 562 | 3300010375 | Ga0105239_10143444 | Ga0105239_101434442 | 287 |
| 563 | 3300011119 | Ga0105246_10037918 | Ga0105246_100379182 | 287 |
| 564 | 3300012494 | Ga0157341_1000955 | Ga0157341_10009552 | 287 |
| 565 | 3300013102 | Ga0157371_10061087 | Ga0157371_100610873 | 287 |
| 566 | 3300013297 | Ga0157378_10000362 | Ga0157378_1000036210 | 287 |
| 567 | 3300013297 | Ga0157378_10054745 | Ga0157378_100547451 | 287 |
| 568 | 3300013306 | Ga0163162_10065114 | Ga0163162_100651145 | 287 |
| 569 | 3300013307 | Ga0157372_10178558 | Ga0157372_101785582 | 287 |
| 570 | 3300013307 | Ga0157372_10216318 | Ga0157372_102163182 | 287 |
| 571 | 3300013308 | Ga0157375_10002488 | Ga0157375_1000248816 | 287 |
| 572 | 3300014326 | Ga0157380_10056450 | Ga0157380_100564504 | 287 |
| 573 | 3300014968 | Ga0157379_10138951 | Ga0157379_101389513 | 287 |
| 574 | 3300014969 | Ga0157376_10008924 | Ga0157376_100089242 | 287 |
| 575 | 3300014969 | Ga0157376_10098144 | Ga0157376_100981442 | 287 |
| 576 | 3300021384 | Ga0213876_10008996 | Ga0213876_100089963 | 287 |
| 577 | 3300021384 | Ga0213876_10029221 | Ga0213876_100292213 | 287 |
| 578 | 3300024227 | Ga0228598_1018395 | Ga0228598_10183952 | 287 |
| 579 | 3300025315 | Ga0207697_10130625 | Ga0207697_101306251 | 287 |
| 580 | 3300025885 | Ga0207653_10026706 | Ga0207653_100267062 | 287 |
| 581 | 3300025899 | Ga0207642_10000493 | Ga0207642_100004935 | 287 |
| 582 | 3300025900 | Ga0207710_10047969 | Ga0207710_100479692 | 287 |
| 583 | 3300025903 | Ga0207680_10114418 | Ga0207680_101144182 | 287 |
| 584 | 3300025906 | Ga0207699_10310568 | Ga0207699_103105681 | 287 |
| 585 | 3300025908 | Ga0207643_10024187 | Ga0207643_100241873 | 287 |
| 586 | 3300025912 | Ga0207707_10031302 | Ga0207707_100313022 | 287 |
| 587 | 3300025913 | Ga0207695_10082424 | Ga0207695_100824242 | 287 |
| 588 | 3300025915 | Ga0207693_10055864 | Ga0207693_100558642 | 287 |
| 589 | 3300025916 | Ga0207663_10175697 | Ga0207663_101756972 | 287 |
| 590 | 3300025916 | Ga0207663_10251311 | Ga0207663_102513111 | 287 |
| 591 | 3300025917 | Ga0207660_10022448 | Ga0207660_100224483 | 287 |
| 592 | 3300025917 | Ga0207660_10304099 | Ga0207660_103040992 | 287 |
| 593 | 3300025918 | Ga0207662_10001121 | Ga0207662_100011212 | 287 |
| 594 | 3300025918 | Ga0207662_10120427 | Ga0207662_101204271 | 287 |
| 595 | 3300025921 | Ga0207652_10257404 | Ga0207652_102574041 | 287 |
| 596 | 3300025926 | Ga0207659_10102681 | Ga0207659_101026812 | 287 |
| 597 | 3300025927 | Ga0207687_10005565 | Ga0207687_100055654 | 287 |
| 598 | 3300025928 | Ga0207700_10045328 | Ga0207700_100453283 | 287 |
| 599 | 3300025929 | Ga0207664_10049839 | Ga0207664_100498394 | 287 |
| 600 | 3300025931 | Ga0207644_10019902 | Ga0207644_100199024 | 287 |
| 601 | 3300025933 | Ga0207706_10085297 | Ga0207706_100852972 | 287 |
| 602 | 3300025934 | Ga0207686_10003159 | Ga0207686_100031597 | 287 |
| 603 | 3300025935 | Ga0207709_10001899 | Ga0207709_1000189910 | 287 |
| 604 | 3300025936 | Ga0207670_10002655 | Ga0207670_1000265510 | 287 |
| 605 | 3300025938 | Ga0207704_10020103 | Ga0207704_100201034 | 287 |
| 606 | 3300025941 | Ga0207711_10224284 | Ga0207711_102242842 | 287 |
| 607 | 3300025942 | Ga0207689_10000566 | Ga0207689_1000056617 | 287 |
| 608 | 3300025942 | Ga0207689_10045532 | Ga0207689_100455323 | 287 |
| 609 | 3300025949 | Ga0207667_10021448 | Ga0207667_100214483 | 287 |
| 610 | 3300025961 | Ga0207712_10026005 | Ga0207712_100260055 | 287 |
| 611 | 3300025972 | Ga0207668_10113720 | Ga0207668_101137202 | 287 |
| 612 | 3300025981 | Ga0207640_10005119 | Ga0207640_100051194 | 287 |
| 613 | 3300026023 | Ga0207677_10005638 | Ga0207677_100056384 | 287 |
| 614 | 3300026035 | Ga0207703_10079135 | Ga0207703_100791353 | 287 |
| 615 | 3300026067 | Ga0207678_10009048 | Ga0207678_100090486 | 287 |
| 616 | 3300026075 | Ga0207708_10003184 | Ga0207708_1000318417 | 287 |
| 617 | 3300026088 | Ga0207641_10403468 | Ga0207641_104034681 | 287 |
| 618 | 3300026089 | Ga0207648_10000281 | Ga0207648_1000028117 | 287 |
| 619 | 3300026116 | Ga0207674_10183215 | Ga0207674_101832152 | 287 |
| 620 | 3300026116 | Ga0207674_10204265 | Ga0207674_102042652 | 287 |
| 621 | 3300026118 | Ga0207675_100005102 | Ga0207675_1000051022 | 287 |
| 622 | 3300026121 | Ga0207683_10117842 | Ga0207683_101178422 | 287 |
| 623 | 3300026142 | Ga0207698_10421623 | Ga0207698_104216232 | 287 |
| 624 | 3300027907 | Ga0207428_10001277 | Ga0207428_1000127719 | 287 |
| 625 | 3300028380 | Ga0268265_10011524 | Ga0268265_100115244 | 287 |
| 626 | 3300028381 | Ga0268264_10052329 | Ga0268264_100523293 | 287 |
| 627 | 3300031241 | Ga0265325_10003857 | Ga0265325_1000385711 | 287 |
| 628 | 3300031249 | Ga0265339_10002967 | Ga0265339_100029676 | 287 |
| 629 | 3300031344 | Ga0265316_10022270 | Ga0265316_100222702 | 287 |
| 630 | 3300031344 | Ga0265316_10211881 | Ga0265316_102118811 | 287 |
| 631 | 3300031595 | Ga0265313_10024495 | Ga0265313_100244953 | 287 |
| 632 | 3300031595 | Ga0265313_10038423 | Ga0265313_100384233 | 287 |
| 633 | 3300031731 | Ga0307405_10306613 | Ga0307405_103066131 | 287 |
| 634 | 3300034817 | Ga0373948_0002832 | Ga0373948_0002832_711_1574 | 287 |
| 635 | 3300034818 | Ga0373950_0002685 | Ga0373950_0002685_177_1040 | 287 |
| 636 | 3300034820 | Ga0373959_0004548 | Ga0373959_0004548_1029_1892 | 287 |
| 637 | 3300035086 | Ga0373934_0032159 | Ga0373934_0032159_808_1671 | 287 |
| 638 | 3300035088 | Ga0373940_0009418 | Ga0373940_0009418_786_1649 | 287 |
| 639 | 3300035111 | Ga0373923_0013137 | Ga0373923_0013137_1313_2176 | 287 |
| 640 | 3300035118 | Ga0373954_0009184 | Ga0373954_0009184_1350_2213 | 287 |
| 641 | 3300035118 | Ga0373954_0066231 | Ga0373954_0066231_732_1595 | 287 |
| 642 | 3300035119 | Ga0373956_0005298 | Ga0373956_0005298_732_1595 | 287 |
| 643 | 3300035119 | Ga0373956_0025963 | Ga0373956_0025963_1219_2082 | 287 |
| 644 | 3300035120 | Ga0373957_0034491 | Ga0373957_0034491_847_1710 | 287 |
| 645 | 3300035121 | Ga0373960_0031574 | Ga0373960_0031574_218_1081 | 287 |
| 646 | 3300035170 | Ga0373943_0003515 | Ga0373943_0003515_1430_2293 | 287 |
| 647 | 3300035170 | Ga0373943_0011291 | Ga0373943_0011291_227_1090 | 287 |
| 648 | 3300035172 | Ga0373955_0010791 | Ga0373955_0010791_776_1639 | 287 |
| 649 | 3300035172 | Ga0373955_0012410 | Ga0373955_0012410_508_1371 | 287 |
| 650 | 3300035172 | Ga0373955_0077332 | Ga0373955_0077332_568_1431 | 287 |
| 651 | 3300035242 | Ga0373962_0053397 | Ga0373962_0053397_238_1101 | 287 |
| 652 | 3300035242 | Ga0373962_0071811 | Ga0373962_0071811_97_960 | 287 |
| 653 | 3300035691 | Ga0373931_0042066 | Ga0373931_0042066_641_1504 | 287 |
| 654 | 3300035691 | Ga0373931_0080579 | Ga0373931_0080579_205_1068 | 287 |
| 655 | 3300035691 | Ga0373931_0113785 | Ga0373931_0113785_534_1397 | 287 |
| 656 | 3300035691 | Ga0373931_0124955 | Ga0373931_0124955_593_1456 | 287 |
| 657 | 3300035692 | Ga0373935_0004817 | Ga0373935_0004817_5911_6774 | 287 |
| 658 | 3300035692 | Ga0373935_0086050 | Ga0373935_0086050_928_1791 | 287 |
| 659 | 3300035695 | Ga0373927_0196002 | Ga0373927_0196002_53_916 | 287 |
| 660 | 3300035724 | Ga0373933_0008478 | Ga0373933_0008478_996_1859 | 287 |
| 661 | 3300035725 | Ga0373947_0005443 | Ga0373947_0005443_1036_1899 | 287 |
| 662 | 3300035725 | Ga0373947_0072751 | Ga0373947_0072751_260_1123 | 287 |
| 663 | 3300037068 | Ga0373925_0005226 | Ga0373925_0005226_4889_5752 | 287 |
| 664 | 3300037068 | Ga0373925_0290104 | Ga0373925_0290104_216_1079 | 287 |
| 665 | 3300037312 | Ga0395899_0031176 | Ga0395899_0031176_575_1486 | 287 |
| 666 | 3300037418 | Ga0395900_0015232 | Ga0395900_0015232_4376_5287 | 287 |
| 667 | 3300037466 | Ga0395898_0080033 | Ga0395898_0080033_599_1462 | 287 |
| 668 | 3300037466 | Ga0395898_0488432 | Ga0395898_0488432_220_1131 | 287 |
| 669 | 3300038443 | Ga0395901_0081984 | Ga0395901_0081984_2311_3174 | 287 |
| 670 | 3300038443 | Ga0395901_0258676 | Ga0395901_0258676_866_1729 | 287 |
| 671 | 3300039437 | Ga0436365_0932459 | Ga0436365_0932459_2677_3540 | 287 |
| 672 | 3300041512 | Ga0451853_0997884 | Ga0451853_0997884_1082_1945 | 287 |
| 673 | 3300042156 | Ga0439446_0045767 | Ga0439446_0045767_61_924 | 287 |
| 674 | 3300045051 | Ga0451576_0015388 | Ga0451576_0015388_5777_6640 | 287 |
| 675 | 3300045051 | Ga0451576_0267165 | Ga0451576_0267165_797_1663 | 287 |
| 676 | 3300046454 | Ga0495592_0179612 | Ga0495592_0179612_19_882 | 287 |
| 677 | 3300046455 | Ga0495603_0000816 | Ga0495603_0000816_13033_13896 | 287 |
| 678 | 3300046455 | Ga0495603_0023995 | Ga0495603_0023995_684_1547 | 287 |
| 679 | 3300046459 | Ga0495629_0000140 | Ga0495629_0000140_6911_7774 | 287 |
| 680 | 3300046459 | Ga0495629_0080581 | Ga0495629_0080581_905_1768 | 287 |
| 681 | 3300046461 | Ga0495641_0010088 | Ga0495641_0010088_852_1715 | 287 |
| 682 | 3300046462 | Ga0495651_0005708 | Ga0495651_0005708_189_1052 | 287 |
| 683 | 3300046462 | Ga0495651_0053596 | Ga0495651_0053596_783_1646 | 287 |
| 684 | 3300046463 | Ga0495653_0009696 | Ga0495653_0009696_4597_5460 | 287 |
| 685 | 3300046463 | Ga0495653_0074245 | Ga0495653_0074245_988_1851 | 287 |
| 686 | 3300046472 | Ga0495580_0058773 | Ga0495580_0058773_232_1095 | 287 |
| 687 | 3300046472 | Ga0495580_0075751 | Ga0495580_0075751_1247_2110 | 287 |
| 688 | 3300046472 | Ga0495580_0078199 | Ga0495580_0078199_303_1166 | 287 |
| 689 | 3300046473 | Ga0495582_0005878 | Ga0495582_0005878_4584_5447 | 287 |
| 690 | 3300046473 | Ga0495582_0020830 | Ga0495582_0020830_2076_2939 | 287 |
| 691 | 3300046475 | Ga0495639_0001632 | Ga0495639_0001632_4319_5182 | 287 |
| 692 | 3300046476 | Ga0495662_0008367 | Ga0495662_0008367_92_958 | 287 |
| 693 | 3300046476 | Ga0495662_0062796 | Ga0495662_0062796_841_1704 | 287 |
| 694 | 3300046476 | Ga0495662_0214653 | Ga0495662_0214653_12_875 | 287 |
| 695 | 3300046477 | Ga0495664_0005918 | Ga0495664_0005918_4882_5745 | 287 |
| 696 | 3300046477 | Ga0495664_0038354 | Ga0495664_0038354_1115_1978 | 287 |
| 697 | 3300046491 | Ga0495584_0009796 | Ga0495584_0009796_825_1688 | 287 |
| 698 | 3300046492 | Ga0495585_0002257 | Ga0495585_0002257_3756_4619 | 287 |
| 699 | 3300046499 | Ga0495594_0099842 | Ga0495594_0099842_702_1565 | 287 |
| 700 | 3300046511 | Ga0495608_0023230 | Ga0495608_0023230_733_1596 | 287 |
| 701 | 3300046511 | Ga0495608_0238621 | Ga0495608_0238621_25_888 | 287 |
| 702 | 3300046517 | Ga0495630_0012741 | Ga0495630_0012741_3132_3995 | 287 |
| 703 | 3300046517 | Ga0495630_0056745 | Ga0495630_0056745_675_1538 | 287 |
| 704 | 3300046517 | Ga0495630_0058850 | Ga0495630_0058850_627_1490 | 287 |
| 705 | 3300046517 | Ga0495630_0333224 | Ga0495630_0333224_224_1087 | 287 |
| 706 | 3300046518 | Ga0495631_0023242 | Ga0495631_0023242_674_1537 | 287 |
| 707 | 3300046520 | Ga0495637_0091425 | Ga0495637_0091425_320_1183 | 287 |
| 708 | 3300046523 | Ga0495644_0001244 | Ga0495644_0001244_4686_5549 | 287 |
| 709 | 3300046525 | Ga0495663_0009554 | Ga0495663_0009554_1197_2060 | 287 |
| 710 | 3300046526 | Ga0495666_0007872 | Ga0495666_0007872_684_1547 | 287 |
| 711 | 3300046529 | Ga0495652_0032347 | Ga0495652_0032347_2273_3136 | 287 |
| 712 | 3300046529 | Ga0495652_0072535 | Ga0495652_0072535_1010_1873 | 287 |
| 713 | 3300046531 | Ga0495665_0004725 | Ga0495665_0004725_1141_2004 | 287 |
| 714 | 3300046533 | Ga0495640_0045460 | Ga0495640_0045460_1254_2117 | 287 |
| 715 | 3300046533 | Ga0495640_0190085 | Ga0495640_0190085_143_1009 | 287 |
| 716 | 3300046536 | Ga0495587_0007895 | Ga0495587_0007895_5755_6618 | 287 |
| 717 | 3300046536 | Ga0495587_0017665 | Ga0495587_0017665_419_1282 | 287 |
| 718 | 3300046557 | Ga0495622_0011854 | Ga0495622_0011854_70_933 | 287 |
| 719 | 3300046558 | Ga0495633_0006563 | Ga0495633_0006563_4473_5336 | 287 |
| 720 | 3300046559 | Ga0495667_0005868 | Ga0495667_0005868_4702_5565 | 287 |
| 721 | 3300046559 | Ga0495667_0187173 | Ga0495667_0187173_317_1180 | 287 |
| 722 | 3300046615 | Ga0495656_0003395 | Ga0495656_0003395_3663_4526 | 287 |
| 723 | 3300046663 | Ga0495635_0018448 | Ga0495635_0018448_579_1445 | 287 |
| 724 | 3300046663 | Ga0495635_0066698 | Ga0495635_0066698_759_1622 | 287 |
| 725 | 3300046664 | Ga0495659_0002292 | Ga0495659_0002292_1308_2171 | 287 |
| 726 | 3300046665 | Ga0495661_0039401 | Ga0495661_0039401_149_1012 | 287 |
| 727 | 3300046675 | Ga0495657_0035218 | Ga0495657_0035218_617_1480 | 287 |
| 728 | 3300046678 | Ga0495599_0005271 | Ga0495599_0005271_3298_4161 | 287 |
| 729 | 3300046679 | Ga0495623_0271517 | Ga0495623_0271517_37_900 | 287 |
| 730 | 3300046680 | Ga0495646_0078337 | Ga0495646_0078337_244_1107 | 287 |
| 731 | 3300046680 | Ga0495646_0110191 | Ga0495646_0110191_334_1197 | 287 |
| 732 | 3300046681 | Ga0495647_0003703 | Ga0495647_0003703_1081_1944 | 287 |
| 733 | 3300046683 | Ga0495658_0009443 | Ga0495658_0009443_1386_2249 | 287 |
| 734 | 3300046683 | Ga0495658_0155185 | Ga0495658_0155185_61_927 | 287 |
| 735 | 3300046683 | Ga0495658_0320832 | Ga0495658_0320832_20_883 | 287 |
| 736 | 3300046684 | Ga0495669_0001950 | Ga0495669_0001950_4908_5771 | 287 |
| 737 | 3300046689 | Ga0495613_0040585 | Ga0495613_0040585_525_1388 | 287 |
| 738 | 3300046689 | Ga0495613_0100555 | Ga0495613_0100555_335_1198 | 287 |
| 739 | 3300046690 | Ga0495624_0010799 | Ga0495624_0010799_935_1798 | 287 |
| 740 | 3300046691 | Ga0495670_0006450 | Ga0495670_0006450_3348_4211 | 287 |
| 741 | 3300046809 | Ga0495600_0001615 | Ga0495600_0001615_9262_10125 | 287 |
| 742 | 3300046809 | Ga0495600_0073084 | Ga0495600_0073084_300_1163 | 287 |
| 743 | 3300046809 | Ga0495600_0132919 | Ga0495600_0132919_197_1060 | 287 |
| 744 | 3300047315 | Ga0495581_0020190 | Ga0495581_0020190_416_1279 | 287 |
| 745 | 3300047317 | Ga0495604_0023059 | Ga0495604_0023059_2026_2889 | 287 |
| 746 | 3300047317 | Ga0495604_0049732 | Ga0495604_0049732_1673_2536 | 287 |
| 747 | 3300047319 | Ga0495674_0178681 | Ga0495674_0178681_306_1169 | 287 |
| 748 | 3300047321 | Ga0495676_0012611 | Ga0495676_0012611_1396_2259 | 287 |
| 749 | 3300047321 | Ga0495676_0179219 | Ga0495676_0179219_256_1119 | 287 |
| 750 | 3300047321 | Ga0495676_0245002 | Ga0495676_0245002_103_966 | 287 |
| 751 | 3300047322 | Ga0495680_0005608 | Ga0495680_0005608_4091_4954 | 287 |
| 752 | 3300047444 | Ga0495675_0003024 | Ga0495675_0003024_7129_7992 | 287 |
| 753 | 3300047673 | Ga0495593_0015602 | Ga0495593_0015602_3177_4040 | 287 |
| 754 | 3300047673 | Ga0495593_0085877 | Ga0495593_0085877_699_1562 | 287 |
| 755 | 3300048089 | Ga0495614_0003972 | Ga0495614_0003972_3958_4821 | 287 |
| 756 | 3300048903 | Ga0496100_0021779 | Ga0496100_0021779_667_1530 | 287 |
| 757 | 3300048904 | Ga0496101_0026703 | Ga0496101_0026703_3013_3876 | 287 |
| 758 | 3300048905 | Ga0496102_0083219 | Ga0496102_0083219_558_1421 | 287 |
| 759 | 3300048907 | Ga0496104_0023005 | Ga0496104_0023005_4664_5527 | 287 |
| 760 | 3300048908 | Ga0496105_0001448 | Ga0496105_0001448_10216_11079 | 287 |
| 761 | 3300048909 | Ga0496106_0041307 | Ga0496106_0041307_599_1462 | 287 |
| 762 | 3300048910 | Ga0496107_0015114 | Ga0496107_0015114_2649_3512 | 287 |
| 763 | 3300048910 | Ga0496107_0055899 | Ga0496107_0055899_1432_2295 | 287 |
| 764 | 3300048911 | Ga0496108_0074080 | Ga0496108_0074080_1645_2508 | 287 |
| 765 | 3300048912 | Ga0496109_0562487 | Ga0496109_0562487_37_900 | 287 |
| 766 | 3300048913 | Ga0496110_0058864 | Ga0496110_0058864_2486_3349 | 287 |
| 767 | 3300048914 | Ga0496111_0105571 | Ga0496111_0105571_295_1158 | 287 |
| 768 | 3300048917 | Ga0496114_0002900 | Ga0496114_0002900_2652_3515 | 287 |
| 769 | 3300048918 | Ga0496115_0008715 | Ga0496115_0008715_4339_5202 | 287 |
| 770 | 3300049568 | Ga0501031_0007697 | Ga0501031_0007697_2216_3079 | 287 |
| 771 | 3300049569 | Ga0501032_0012676 | Ga0501032_0012676_1798_2661 | 287 |
| 772 | 3300049569 | Ga0501032_0114788 | Ga0501032_0114788_856_1719 | 287 |
| 773 | 3300049570 | Ga0501033_0014803 | Ga0501033_0014803_2859_3722 | 287 |
| 774 | 3300049571 | Ga0501034_0079371 | Ga0501034_0079371_1267_2130 | 287 |
| 775 | 3300049571 | Ga0501034_0255970 | Ga0501034_0255970_259_1122 | 287 |
| 776 | 3300049572 | Ga0501036_0014938 | Ga0501036_0014938_542_1405 | 287 |
| 777 | 3300049572 | Ga0501036_0234215 | Ga0501036_0234215_52_915 | 287 |
| 778 | 3300049573 | Ga0501037_0013364 | Ga0501037_0013364_3877_4740 | 287 |
| 779 | 3300049574 | Ga0501038_0011296 | Ga0501038_0011296_5124_5987 | 287 |
| 780 | 3300049574 | Ga0501038_0118204 | Ga0501038_0118204_663_1526 | 287 |
| 781 | 3300049575 | Ga0501039_0066303 | Ga0501039_0066303_1811_2674 | 287 |
| 782 | 3300049581 | Ga0501047_0046651 | Ga0501047_0046651_1966_2829 | 287 |
| 783 | 3300049586 | Ga0501070_0020457 | Ga0501070_0020457_1950_2813 | 287 |
| 784 | 3300049586 | Ga0501070_0104869 | Ga0501070_0104869_700_1563 | 287 |
| 785 | 3300049587 | Ga0501071_0037408 | Ga0501071_0037408_774_1637 | 287 |
| 786 | 3300049593 | Ga0501077_0028213 | Ga0501077_0028213_53_916 | 287 |
| 787 | 3300049822 | Ga0501035_0016613 | Ga0501035_0016613_4943_5806 | 287 |
| 788 | 3300049823 | Ga0501044_0379439 | Ga0501044_0379439_203_1066 | 287 |
| 789 | 3300050507 | nmdc:mga05p37_1543_c1 | nmdc:mga05p37_1543_c1_13306_14169 | 287 |
| 790 | 3300050508 | nmdc:mga09592_801_c1 | nmdc:mga09592_801_c1_10054_10917 | 287 |
| 791 | 3300050511 | nmdc:mga08y16_4235_c1 | nmdc:mga08y16_4235_c1_783_1646 | 287 |
| 792 | 3300050512 | nmdc:mga0n895_100752_c1 | nmdc:mga0n895_100752_c1_1385_2248 | 287 |
| 793 | 3300050512 | nmdc:mga0n895_182053_c1 | nmdc:mga0n895_182053_c1_355_1221 | 287 |
| 794 | 3300050513 | nmdc:mga0rr50_103133_c1 | nmdc:mga0rr50_103133_c1_996_1859 | 287 |
| 795 | 3300050513 | nmdc:mga0rr50_162042_c1 | nmdc:mga0rr50_162042_c1_386_1252 | 287 |
| 796 | 3300050515 | nmdc:mga0a205_323769_c1 | nmdc:mga0a205_323769_c1_140_1006 | 287 |
| 797 | 3300050515 | nmdc:mga0a205_441823_c1 | nmdc:mga0a205_441823_c1_56_922 | 287 |
| 798 | 3300053077 | Ga0495601_0054653 | Ga0495601_0054653_734_1597 | 287 |
| 799 | 3300053078 | Ga0495612_0015276 | Ga0495612_0015276_1454_2317 | 287 |
| 800 | 3300053084 | Ga0495595_0029673 | Ga0495595_0029673_552_1415 | 287 |
| 801 | 3300053084 | Ga0495595_0141081 | Ga0495595_0141081_110_973 | 287 |
| 802 | 3300053085 | Ga0495619_0000384 | Ga0495619_0000384_24820_25683 | 287 |
| 803 | 3300053085 | Ga0495619_0012701 | Ga0495619_0012701_3083_3946 | 287 |
| 804 | 3300053085 | Ga0495619_0047152 | Ga0495619_0047152_43_906 | 287 |
| 805 | 3300053085 | Ga0495619_0163759 | Ga0495619_0163759_560_1423 | 287 |
| 806 | 3300053085 | Ga0495619_0177259 | Ga0495619_0177259_263_1126 | 287 |
| 807 | 3300053096 | Ga0500641_0020806 | Ga0500641_0020806_1389_2252 | 287 |
| 808 | 3300061734 | Ga0530510_0069821 | Ga0530510_0069821_760_1623 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5776 | 7 | 279 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5657 | 9 | 274 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5433 | 7 | 279 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5292 | 9 | 274 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.5251 | 5 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8628 | 9 | 278 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8492 | 9 | 277 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8261 | 9 | 278 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8099 | 9 | 277 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7898 | 11 | 277 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3PWN8-F1-model_v4 | Branched-chain amino acid transport system permease protein | 0.9822 | 3 | 287 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A522GJA6-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9801 | 4 | 287 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A643FZD4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9791 | 1 | 287 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A060ICN4-F1-model_v4 | High-affinity branched-chain amino acid ABC transporter permease protein | 0.979 | 3 | 250 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A0H2MN97-F1-model_v4 | High-affinity branched-chain amino acid transport system permease protein LivH | 0.9787 | 6 | 287 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar