F481771

General Info

Members Datasets Scaffolds Average Seq Length
809 290 767 232

Family's Representative Sequence

Representative Sequence 3300041407|Ga0439447_004637|Ga0439447_004637_1682_2494
Length 254
Sequence VSDFATASQSNAAIGSCYGSEILAGPVYQGVTVMKKPSHPTWRHMLPVLLAATFIGQCAAFSFGATENAVLIPPPTLDETVKGDTETAIFAGGCFWGVQAGGAANTAQYEQVSDGNTGHAESVEVTFNPAQITYGTLLQIYFSVAHNPTELNRQGPDIGTQYRSALFPVNAEQQRVAQAYIAQLDATRSFNKPIVTRLETYNGFYRAEDYHQDFLTEHPNYPYIVINDLPKVAQLKQLYPERYQEKPVLVKAGR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231012 Pseudomonas sp. GM33 Isolate Nodule
4 2511231014 Pseudomonas sp. GM48 Isolate Nodule
5 2511231015 Pseudomonas sp. GM49 Isolate Nodule
6 2511231016 Pseudomonas sp. GM50 Isolate Nodule
7 2511231017 Pseudomonas sp. GM55 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231020 Pseudomonas sp. GM74 Isolate Nodule
11 2511231021 Pseudomonas sp. GM78 Isolate Nodule
12 2511231023 Pseudomonas sp. GM80 Isolate Nodule
13 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
14 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
15 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
16 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
17 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
18 2643221723 Ensifer sp. Root278 Isolate Unclassified
19 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
20 2738543013 Variovorax sp. BT01 Isolate Unclassified
21 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
22 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
23 2773857670 Pseudomonas sp. 478 Isolate Unclassified
24 2784132063 Pseudomonas sp. 424 Isolate Unclassified
25 2784132072 Pseudomonas sp. 460 Isolate Unclassified
26 2791355263 Rhizobium chutanense C5 Isolate Nodule
27 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
28 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
29 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
30 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
31 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
32 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
33 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
34 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
35 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
36 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
37 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
38 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
39 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
40 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
43 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
44 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
58 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
128 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
129 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
130 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
133 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
134 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
135 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
140 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
141 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
142 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
150 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
151 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
284 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
285 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
289 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
290 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0
Isolates 5.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.32
Nodule 1.73
Rhizoplane 1.24
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_742 2124908027 Bacteria 19242
2 MRS2a_Contig_99 2124908027 Bacteria 24211
3 JGI25162J39368_1000308 3300002737 Bacteria 43964
4 JGI25158J39367_1003302 3300002739 Bacteria 2504
5 JGI25163J39215_1000322 3300002771 Bacteria 15996
6 JGI25164J39214_1000226 3300002772 Bacteria 43964
7 JGI25159J45721_1000125 3300002987 Bacteria 36528
8 JGI25165J46597_1000421 3300003214 Bacteria 43964
9 rootL2_10219179 3300003322 Bacteria 2204
10 JGI25160J50197_1000020 3300003354 Bacteria 232739
11 JGI25161J50226_1000544 3300003374 Bacteria 16086
12 Ga0055536_1023606 3300003781 Bacteria 1804
13 Ga0055530_10046341 3300003791 Bacteria 1032
14 Ga0055531_10035772 3300003794 Bacteria 1547
15 Ga0055543_1000163 3300004625 Bacteria 55480
16 Ga0065165_1000013 3300005262 Bacteria 301887
17 Ga0065714_10006005 3300005288 Bacteria 3767
18 Ga0065714_10006190 3300005288 Bacteria 4876
19 Ga0065714_10067222 3300005288 Bacteria 5751
20 Ga0065714_10099573 3300005288 Bacteria 1683
21 Ga0065714_10219251 3300005288 Bacteria 845
22 Ga0065704_10303744 3300005289 Bacteria 880
23 Ga0065712_10005057 3300005290 Bacteria 3435
24 Ga0065715_10185710 3300005293 Bacteria 1439
25 Ga0065707_10082259 3300005295 Bacteria 18112
26 Ga0070658_10045702 3300005327 Bacteria 3541
27 Ga0068869_100304418 3300005334 Bacteria 1288
28 Ga0070663_100222336 3300005455 Bacteria 1483
29 Ga0070679_100583531 3300005530 Unclassified 1061
30 Ga0068853_100050532 3300005539 Bacteria 3577
31 Ga0068855_100047798 3300005563 Bacteria 5053
32 Ga0068855_100109690 3300005563 Bacteria 3168
33 Ga0068857_100129026 3300005577 Bacteria 2280
34 Ga0068863_100166241 3300005841 Bacteria 2115
35 Ga0081540_1092014 3300005983 Bacteria 1332
36 Ga0075364_10074166 3300006051 Bacteria 2243
37 Ga0075432_10037346 3300006058 Bacteria 1691
38 Ga0075432_10041460 3300006058 Bacteria 1608
39 Ga0075362_10018866 3300006177 Bacteria 2861
40 Ga0075362_10062005 3300006177 Bacteria 1693
41 Ga0075436_100221839 3300006914 Bacteria 1342
42 Ga0079104_1000155 3300006946 Bacteria 97065
43 Ga0105251_10007840 3300009011 Bacteria 6498
44 Ga0105251_10068170 3300009011 Bacteria 1660
45 Ga0105251_10106544 3300009011 Bacteria 1279
46 Ga0105251_10162947 3300009011 Bacteria 1005
47 Ga0105244_10000258 3300009036 Bacteria 53811
48 Ga0105244_10013519 3300009036 Bacteria 4767
49 Ga0105244_10044016 3300009036 Bacteria 2301
50 Ga0105250_10001453 3300009092 Bacteria 12789
51 Ga0105250_10039812 3300009092 Bacteria 1885
52 Ga0105247_10032282 3300009101 Bacteria 3181
53 Ga0105243_10000470 3300009148 Bacteria 41603
54 Ga0105239_10006060 3300010375 Bacteria 14075
55 Ga0105246_10000143 3300011119 Bacteria 33328
56 Ga0157373_10020490 3300013100 Bacteria 4806
57 Ga0157371_10002483 3300013102 Bacteria 17532
58 Ga0157371_10099648 3300013102 Bacteria 2060
59 Ga0157370_10007880 3300013104 Bacteria 11545
60 Ga0157370_10033186 3300013104 Bacteria 5032
61 Ga0157370_10034970 3300013104 Bacteria 4888
62 Ga0157370_10143059 3300013104 Bacteria 2228
63 Ga0157370_11046020 3300013104 Bacteria 738
64 Ga0157369_11078490 3300013105 Bacteria 821
65 Ga0163162_10008966 3300013306 Bacteria 9726
66 Ga0163162_10132712 3300013306 Bacteria 2600
67 Ga0163162_10722336 3300013306 Bacteria 1117
68 Ga0157372_10000835 3300013307 Bacteria 33420
69 Ga0182008_10001240 3300014497 Bacteria 17518
70 Ga0182008_10043373 3300014497 Bacteria 2239
71 Ga0182006_1008459 3300015261 Bacteria 4662
72 Ga0182006_1052067 3300015261 Bacteria 1574
73 Ga0182005_1003223 3300015265 Bacteria 5580
74 Ga0182005_1004938 3300015265 Bacteria 4228
75 Ga0182005_1012164 3300015265 Bacteria 2436
76 Ga0182005_1015887 3300015265 Bacteria 2097
77 Ga0182005_1082587 3300015265 Bacteria 888
78 Ga0163161_10003639 3300017792 Bacteria 10811
79 Ga0163161_10013049 3300017792 Bacteria 5774
80 Ga0163161_10017064 3300017792 Bacteria 5078
81 Ga0163161_10042638 3300017792 Bacteria 3265
82 Ga0163161_10067858 3300017792 Bacteria 2605
83 Ga0163161_10104523 3300017792 Bacteria 2111
84 Ga0213874_10043111 3300021377 Bacteria 1358
85 Ga0209760_100071 3300025207 Bacteria 82915
86 Ga0209436_100498 3300025208 Bacteria 17278
87 Ga0209563_101369 3300025230 Bacteria 6575
88 Ga0207427_100038 3300025231 Bacteria 292975
89 Ga0209437_100009 3300025233 Bacteria 915954
90 Ga0209233_1000074 3300025261 Bacteria 357367
91 Ga0209233_1000247 3300025261 Bacteria 87890
92 Ga0209130_1000034 3300025284 Bacteria 302439
93 Ga0209676_1002153 3300025292 Bacteria 14902
94 Ga0209676_1007862 3300025292 Bacteria 4899
95 Ga0209025_1000311 3300025294 Bacteria 108141
96 Ga0209564_1000013 3300025295 Bacteria 775755
97 Ga0209050_1000697 3300025298 Bacteria 49912
98 Ga0209050_1002550 3300025298 Bacteria 15227
99 Ga0209256_1001503 3300025299 Bacteria 23634
100 Ga0207426_1000006 3300025302 Bacteria 1025969
101 Ga0209051_1010619 3300025303 Bacteria 4624
102 Ga0209051_1024696 3300025303 Bacteria 2464
103 Ga0209257_1009839 3300025304 Bacteria 5002
104 Ga0207696_1000314 3300025711 Bacteria 53800
105 Ga0207696_1005947 3300025711 Bacteria 4987
106 Ga0207655_1000507 3300025728 Bacteria 49753
107 Ga0207655_1003216 3300025728 Bacteria 12276
108 Ga0207655_1005126 3300025728 Bacteria 9028
109 Ga0207655_1015559 3300025728 Bacteria 4219
110 Ga0207713_1008162 3300025735 Bacteria 6061
111 Ga0207713_1016342 3300025735 Bacteria 3769
112 Ga0207713_1023383 3300025735 Bacteria 2910
113 Ga0207713_1030176 3300025735 Bacteria 2417
114 Ga0207710_10244038 3300025900 Bacteria 897
115 Ga0207695_10157517 3300025913 Bacteria 2205
116 Ga0207695_10182065 3300025913 Bacteria 2022
117 Ga0207706_10002502 3300025933 Bacteria 17912
118 Ga0207706_10530633 3300025933 Bacteria 1014
119 Ga0207709_10000013 3300025935 Bacteria 531977
120 Ga0207709_10332646 3300025935 Bacteria 1140
121 Ga0207711_10365687 3300025941 Bacteria 1337
122 Ga0207667_10327376 3300025949 Bacteria 1564
123 Ga0207712_10081768 3300025961 Bacteria 2353
124 Ga0207678_10100576 3300026067 Bacteria 2470
125 Ga0207641_10094771 3300026088 Bacteria 2618
126 Ga0207674_10079798 3300026116 Bacteria 3276
127 Ga0209281_1000013 3300027111 Bacteria 653449
128 Ga0209998_10004424 3300027717 Bacteria 2987
129 Ga0207428_10021130 3300027907 Bacteria 5513
130 Ga0207428_10243260 3300027907 Bacteria 1344
131 Ga0207428_10313499 3300027907 Bacteria 1159
132 Ga0439438_001123 3300041405 Bacteria 11914
133 Ga0439438_008400 3300041405 Bacteria 3428
134 Ga0439438_008622 3300041405 Bacteria 3362
135 Ga0439438_008801 3300041405 Bacteria 3313
136 Ga0439438_015080 3300041405 Bacteria 2283
137 Ga0439438_023256 3300041405 Bacteria 1710
138 Ga0439438_045736 3300041405 Bacteria 1125
139 Ga0439447_001478 3300041407 Bacteria 8611
140 Ga0439447_001962 3300041407 Bacteria 7546
141 Ga0439447_004637 3300041407 Bacteria 4685
142 Ga0439447_006416 3300041407 Bacteria 3822
143 Ga0439447_022633 3300041407 Bacteria 1643
144 Ga0439466_0000673 3300041411 Bacteria 12894
145 Ga0439466_0001047 3300041411 Bacteria 10676
146 Ga0439466_0001294 3300041411 Bacteria 9737
147 Ga0439466_0012864 3300041411 Bacteria 3069
148 Ga0439466_0022871 3300041411 Bacteria 2202
149 Ga0439466_0033151 3300041411 Bacteria 1756
150 Ga0439466_0043671 3300041411 Bacteria 1488
151 Ga0439465_0000546 3300041413 Bacteria 11277
152 Ga0439432_000782 3300042006 Bacteria 11926
153 Ga0439432_003487 3300042006 Bacteria 5832
154 Ga0439432_007151 3300042006 Bacteria 3967
155 Ga0439432_014523 3300042006 Bacteria 2664
156 Ga0439432_024001 3300042006 Bacteria 2005
157 Ga0439451_001262 3300042009 Bacteria 5007
158 Ga0439451_001926 3300042009 Bacteria 4150
159 Ga0439451_002619 3300042009 Bacteria 3658
160 Ga0439451_002657 3300042009 Bacteria 3630
161 Ga0439451_026189 3300042009 Bacteria 1175
162 Ga0439452_000088 3300042010 Bacteria 79372
163 Ga0439452_000686 3300042010 Bacteria 16670
164 Ga0439452_001068 3300042010 Bacteria 12107
165 Ga0439452_001595 3300042010 Bacteria 8955
166 Ga0439452_014955 3300042010 Bacteria 2141
167 Ga0439456_000254 3300042013 Bacteria 13712
168 Ga0439456_000731 3300042013 Bacteria 6714
169 Ga0439456_001178 3300042013 Bacteria 5189
170 Ga0439456_051091 3300042013 Bacteria 903
171 Ga0439463_001566 3300042016 Bacteria 6032
172 Ga0439463_006138 3300042016 Bacteria 2982
173 Ga0439463_007416 3300042016 Bacteria 2709
174 Ga0450911_000105 3300042115 Bacteria 34554
175 Ga0450911_000702 3300042115 Bacteria 9809
176 Ga0450911_001026 3300042115 Bacteria 7116
177 Ga0450911_004037 3300042115 Bacteria 2466
178 Ga0450919_000029 3300042121 Bacteria 11963
179 Ga0450920_011627 3300042122 Bacteria 1642
180 Ga0450922_000053 3300042124 Bacteria 10165
181 Ga0450922_000501 3300042124 Bacteria 4155
182 Ga0450922_002651 3300042124 Bacteria 1667
183 Ga0450923_002533 3300042125 Bacteria 2635
184 Ga0450923_068842 3300042125 Bacteria 782
185 Ga0450902_000284 3300042137 Bacteria 6056
186 Ga0450902_000295 3300042137 Bacteria 5957
187 Ga0450903_000415 3300042138 Bacteria 9163
188 Ga0450903_003225 3300042138 Bacteria 2835
189 Ga0450903_003347 3300042138 Bacteria 2780
190 Ga0450903_005390 3300042138 Bacteria 2140
191 Ga0450903_011523 3300042138 Bacteria 1423
192 Ga0450903_012333 3300042138 Bacteria 1366
193 Ga0450905_006223 3300042142 Bacteria 1612
194 Ga0450905_009120 3300042142 Bacteria 1363
195 Ga0450906_000380 3300042145 Bacteria 9060
196 Ga0450906_032654 3300042145 Bacteria 920
197 Ga0450907_000237 3300042146 Bacteria 19049
198 Ga0450907_000706 3300042146 Bacteria 8592
199 Ga0450907_002919 3300042146 Bacteria 3149
200 Ga0450907_032861 3300042146 Bacteria 883
201 Ga0450910_000089 3300042147 Bacteria 9374
202 Ga0450910_000414 3300042147 Bacteria 5040
203 Ga0439446_0000263 3300042156 Bacteria 9780
204 Ga0439446_0002381 3300042156 Bacteria 4505
205 Ga0439446_0061434 3300042156 Bacteria 1137
206 Ga0450908_000191 3300042184 Bacteria 12563
207 Ga0450908_007552 3300042184 Bacteria 2048
208 Ga0450909_000212 3300042185 Bacteria 6777
209 Ga0450909_005425 3300042185 Bacteria 1835
210 Ga0450909_007653 3300042185 Bacteria 1564
211 Ga0439434_0000182 3300042435 Bacteria 17137
212 Ga0439434_0022230 3300042435 Bacteria 1906
213 Ga0439464_0008039 3300042439 Bacteria 2766
214 Ga0439460_0000352 3300042461 Bacteria 9676
215 Ga0439460_0055677 3300042461 Bacteria 1196
216 Ga0450918_018217 3300042531 Bacteria 1225
217 Ga0450893_0000458 3300042532 Bacteria 5780
218 Ga0450901_002846 3300042533 Bacteria 1835
219 Ga0439440_0000666 3300042993 Bacteria 5865
220 Ga0439440_0005737 3300042993 Bacteria 2471
221 Ga0495617_001117 3300046452 Bacteria 12169
222 Ga0495617_002212 3300046452 Bacteria 7919
223 Ga0495617_002384 3300046452 Bacteria 7494
224 Ga0495617_010022 3300046452 Bacteria 3248
225 Ga0495617_013074 3300046452 Bacteria 2828
226 Ga0495617_014849 3300046452 Bacteria 2645
227 Ga0495617_028546 3300046452 Bacteria 1875
228 Ga0495617_063308 3300046452 Bacteria 1221
229 Ga0495627_001539 3300046453 Bacteria 13197
230 Ga0495627_003660 3300046453 Bacteria 6670
231 Ga0495627_010729 3300046453 Bacteria 3318
232 Ga0495627_022384 3300046453 Bacteria 2081
233 Ga0495627_063708 3300046453 Bacteria 1086
234 Ga0495592_0007651 3300046454 Bacteria 8089
235 Ga0495603_0002816 3300046455 Bacteria 10274
236 Ga0495603_0047924 3300046455 Bacteria 2544
237 Ga0495603_0050271 3300046455 Bacteria 2479
238 Ga0495590_0001702 3300046457 Bacteria 9351
239 Ga0495590_0002248 3300046457 Bacteria 8057
240 Ga0495590_0002627 3300046457 Bacteria 7430
241 Ga0495590_0004532 3300046457 Bacteria 5597
242 Ga0495590_0004623 3300046457 Bacteria 5527
243 Ga0495590_0006073 3300046457 Bacteria 4738
244 Ga0495590_0007254 3300046457 Bacteria 4285
245 Ga0495591_000306 3300046458 Bacteria 44753
246 Ga0495591_001438 3300046458 Bacteria 14791
247 Ga0495591_002727 3300046458 Bacteria 9562
248 Ga0495591_003694 3300046458 Bacteria 7771
249 Ga0495591_016496 3300046458 Bacteria 2569
250 Ga0495591_017788 3300046458 Bacteria 2429
251 Ga0495591_019572 3300046458 Bacteria 2260
252 Ga0495638_0000582 3300046460 Bacteria 41296
253 Ga0495638_0000731 3300046460 Bacteria 35358
254 Ga0495638_0000878 3300046460 Bacteria 31022
255 Ga0495638_0004614 3300046460 Bacteria 10426
256 Ga0495638_0008531 3300046460 Bacteria 7256
257 Ga0495638_0009384 3300046460 Bacteria 6877
258 Ga0495638_0009876 3300046460 Bacteria 6662
259 Ga0495638_0016623 3300046460 Bacteria 4923
260 Ga0495638_0017066 3300046460 Bacteria 4850
261 Ga0495638_0026858 3300046460 Bacteria 3729
262 Ga0495638_0032853 3300046460 Bacteria 3321
263 Ga0495638_0038982 3300046460 Bacteria 3018
264 Ga0495653_0001949 3300046463 Bacteria 16243
265 Ga0495653_0016479 3300046463 Bacteria 6016
266 Ga0495653_0027719 3300046463 Bacteria 4533
267 Ga0495653_0129698 3300046463 Bacteria 1786
268 Ga0495650_0001038 3300046471 Bacteria 31103
269 Ga0495650_0004052 3300046471 Bacteria 10260
270 Ga0495650_0006486 3300046471 Bacteria 7275
271 Ga0495650_0010259 3300046471 Bacteria 5241
272 Ga0495580_0161830 3300046472 Bacteria 1549
273 Ga0495605_0000378 3300046474 Bacteria 41947
274 Ga0495605_0001616 3300046474 Bacteria 14598
275 Ga0495605_0002062 3300046474 Bacteria 12666
276 Ga0495605_0003051 3300046474 Bacteria 10107
277 Ga0495605_0011764 3300046474 Bacteria 4869
278 Ga0495605_0018649 3300046474 Bacteria 3714
279 Ga0495605_0021073 3300046474 Bacteria 3457
280 Ga0495605_0025409 3300046474 Bacteria 3086
281 Ga0495605_0027845 3300046474 Bacteria 2923
282 Ga0495605_0046686 3300046474 Bacteria 2127
283 Ga0495605_0046687 3300046474 Bacteria 2127
284 Ga0495605_0070379 3300046474 Bacteria 1654
285 Ga0495605_0083524 3300046474 Bacteria 1490
286 Ga0495639_0006268 3300046475 Bacteria 5108
287 Ga0495639_0032651 3300046475 Bacteria 2322
288 Ga0495639_0048639 3300046475 Bacteria 1923
289 Ga0495584_0001538 3300046491 Bacteria 13708
290 Ga0495584_0004453 3300046491 Bacteria 7537
291 Ga0495584_0006042 3300046491 Bacteria 6377
292 Ga0495584_0006917 3300046491 Bacteria 5928
293 Ga0495584_0010793 3300046491 Bacteria 4689
294 Ga0495584_0012556 3300046491 Bacteria 4324
295 Ga0495584_0012981 3300046491 Bacteria 4253
296 Ga0495584_0014482 3300046491 Bacteria 4017
297 Ga0495584_0023817 3300046491 Bacteria 3103
298 Ga0495584_0040890 3300046491 Bacteria 2341
299 Ga0495584_0126713 3300046491 Bacteria 1294
300 Ga0495585_0000109 3300046492 Bacteria 87891
301 Ga0495585_0000342 3300046492 Bacteria 45262
302 Ga0495585_0001798 3300046492 Bacteria 16298
303 Ga0495585_0004649 3300046492 Bacteria 8857
304 Ga0495585_0006294 3300046492 Bacteria 7375
305 Ga0495585_0014593 3300046492 Bacteria 4572
306 Ga0495585_0018636 3300046492 Bacteria 4002
307 Ga0495585_0222735 3300046492 Bacteria 951
308 Ga0495594_0019291 3300046499 Bacteria 3622
309 Ga0495596_0000357 3300046500 Bacteria 29592
310 Ga0495596_0011040 3300046500 Bacteria 3910
311 Ga0495607_0004257 3300046501 Bacteria 10597
312 Ga0495607_0012663 3300046501 Bacteria 5557
313 Ga0495607_0014448 3300046501 Bacteria 5136
314 Ga0495607_0016886 3300046501 Bacteria 4699
315 Ga0495607_0017159 3300046501 Bacteria 4656
316 Ga0495607_0026411 3300046501 Bacteria 3603
317 Ga0495607_0032694 3300046501 Bacteria 3172
318 Ga0495607_0043642 3300046501 Bacteria 2649
319 Ga0495607_0106986 3300046501 Bacteria 1488
320 Ga0495607_0148731 3300046501 Bacteria 1201
321 Ga0495607_0154522 3300046501 Bacteria 1171
322 Ga0495583_0000501 3300046506 Bacteria 56668
323 Ga0495583_0000743 3300046506 Bacteria 41425
324 Ga0495583_0011208 3300046506 Bacteria 5164
325 Ga0495583_0015064 3300046506 Bacteria 4226
326 Ga0495583_0181423 3300046506 Bacteria 861
327 Ga0495606_0001018 3300046507 Bacteria 40652
328 Ga0495606_0001346 3300046507 Bacteria 33405
329 Ga0495606_0003866 3300046507 Bacteria 15460
330 Ga0495606_0005712 3300046507 Bacteria 11771
331 Ga0495606_0046016 3300046507 Bacteria 2886
332 Ga0495610_0000643 3300046512 Bacteria 34248
333 Ga0495610_0006830 3300046512 Bacteria 7737
334 Ga0495610_0008006 3300046512 Bacteria 6926
335 Ga0495610_0017613 3300046512 Bacteria 4066
336 Ga0495610_0028569 3300046512 Bacteria 2947
337 Ga0495610_0083372 3300046512 Bacteria 1463
338 Ga0495616_0001338 3300046513 Bacteria 17212
339 Ga0495616_0001699 3300046513 Bacteria 15015
340 Ga0495616_0005091 3300046513 Bacteria 8174
341 Ga0495616_0013147 3300046513 Bacteria 4678
342 Ga0495616_0026787 3300046513 Bacteria 3063
343 Ga0495616_0072597 3300046513 Bacteria 1661
344 Ga0495616_0075517 3300046513 Bacteria 1621
345 Ga0495616_0085177 3300046513 Bacteria 1505
346 Ga0495616_0103960 3300046513 Bacteria 1328
347 Ga0495620_0001672 3300046515 Bacteria 13074
348 Ga0495620_0005376 3300046515 Bacteria 7156
349 Ga0495620_0006353 3300046515 Bacteria 6499
350 Ga0495620_0006550 3300046515 Bacteria 6388
351 Ga0495620_0018742 3300046515 Bacteria 3422
352 Ga0495620_0076661 3300046515 Bacteria 1358
353 Ga0495630_0002431 3300046517 Bacteria 12893
354 Ga0495630_0006499 3300046517 Bacteria 8323
355 Ga0495630_0032277 3300046517 Bacteria 3901
356 Ga0495630_0045849 3300046517 Bacteria 3267
357 Ga0495631_0000344 3300046518 Bacteria 32015
358 Ga0495631_0004058 3300046518 Bacteria 7870
359 Ga0495631_0013421 3300046518 Bacteria 3977
360 Ga0495631_0027390 3300046518 Bacteria 2608
361 Ga0495631_0171596 3300046518 Bacteria 930
362 Ga0495632_0000378 3300046519 Bacteria 42507
363 Ga0495632_0001650 3300046519 Bacteria 18281
364 Ga0495632_0009138 3300046519 Bacteria 5990
365 Ga0495632_0012333 3300046519 Bacteria 4933
366 Ga0495632_0016211 3300046519 Bacteria 4151
367 Ga0495632_0021305 3300046519 Bacteria 3494
368 Ga0495632_0041170 3300046519 Bacteria 2322
369 Ga0495632_0043470 3300046519 Bacteria 2245
370 Ga0495632_0163176 3300046519 Bacteria 1026
371 Ga0495632_0192041 3300046519 Bacteria 932
372 Ga0495637_0001010 3300046520 Bacteria 17701
373 Ga0495637_0002780 3300046520 Bacteria 9494
374 Ga0495637_0003055 3300046520 Bacteria 8947
375 Ga0495637_0004246 3300046520 Bacteria 7442
376 Ga0495637_0004576 3300046520 Bacteria 7150
377 Ga0495637_0006654 3300046520 Bacteria 5786
378 Ga0495637_0008973 3300046520 Bacteria 4892
379 Ga0495637_0018242 3300046520 Bacteria 3257
380 Ga0495637_0036145 3300046520 Bacteria 2153
381 Ga0495637_0048390 3300046520 Bacteria 1790
382 Ga0495637_0056203 3300046520 Bacteria 1629
383 Ga0495637_0058915 3300046520 Bacteria 1581
384 Ga0495637_0086044 3300046520 Bacteria 1247
385 Ga0495643_0002096 3300046522 Bacteria 16505
386 Ga0495643_0004681 3300046522 Bacteria 9503
387 Ga0495643_0052190 3300046522 Bacteria 2196
388 Ga0495643_0059056 3300046522 Bacteria 2039
389 Ga0495643_0064576 3300046522 Bacteria 1933
390 Ga0495644_0000056 3300046523 Bacteria 54427
391 Ga0495644_0000146 3300046523 Bacteria 33553
392 Ga0495644_0004511 3300046523 Bacteria 5471
393 Ga0495644_0009266 3300046523 Bacteria 3793
394 Ga0495644_0085570 3300046523 Bacteria 1188
395 Ga0495648_0000340 3300046524 Bacteria 51626
396 Ga0495648_0000657 3300046524 Bacteria 37000
397 Ga0495648_0001265 3300046524 Bacteria 25189
398 Ga0495648_0003637 3300046524 Bacteria 13476
399 Ga0495648_0006089 3300046524 Bacteria 9896
400 Ga0495648_0009137 3300046524 Bacteria 7728
401 Ga0495648_0028736 3300046524 Bacteria 3699
402 Ga0495648_0043658 3300046524 Bacteria 2807
403 Ga0495648_0087457 3300046524 Bacteria 1754
404 Ga0495648_0105253 3300046524 Bacteria 1547
405 Ga0495666_0003707 3300046526 Bacteria 7720
406 Ga0495666_0004747 3300046526 Bacteria 6872
407 Ga0495666_0017363 3300046526 Bacteria 3584
408 Ga0495642_0000140 3300046528 Bacteria 41854
409 Ga0495642_0000734 3300046528 Bacteria 16286
410 Ga0495654_0000760 3300046530 Bacteria 24933
411 Ga0495654_0000896 3300046530 Bacteria 22247
412 Ga0495654_0001523 3300046530 Bacteria 15808
413 Ga0495654_0001744 3300046530 Bacteria 14572
414 Ga0495654_0002105 3300046530 Bacteria 13018
415 Ga0495654_0004591 3300046530 Bacteria 8154
416 Ga0495654_0006254 3300046530 Bacteria 6781
417 Ga0495654_0011887 3300046530 Bacteria 4695
418 Ga0495654_0016898 3300046530 Bacteria 3842
419 Ga0495654_0021071 3300046530 Bacteria 3393
420 Ga0495654_0028259 3300046530 Bacteria 2868
421 Ga0495654_0032638 3300046530 Bacteria 2639
422 Ga0495654_0039340 3300046530 Bacteria 2361
423 Ga0495654_0122888 3300046530 Bacteria 1173
424 Ga0495587_0003220 3300046536 Bacteria 10913
425 Ga0495587_0010581 3300046536 Bacteria 5865
426 Ga0495587_0020659 3300046536 Bacteria 4062
427 Ga0495609_0000812 3300046538 Bacteria 23287
428 Ga0495609_0002148 3300046538 Bacteria 12406
429 Ga0495609_0003777 3300046538 Bacteria 8535
430 Ga0495609_0004881 3300046538 Bacteria 7212
431 Ga0495597_0002739 3300046542 Bacteria 10870
432 Ga0495597_0004551 3300046542 Bacteria 7581
433 Ga0495597_0009856 3300046542 Bacteria 4698
434 Ga0495597_0018671 3300046542 Bacteria 3252
435 Ga0495597_0028163 3300046542 Bacteria 2572
436 Ga0495597_0034004 3300046542 Bacteria 2304
437 Ga0495597_0080221 3300046542 Bacteria 1396
438 Ga0495597_0084099 3300046542 Bacteria 1357
439 Ga0495645_0014749 3300046543 Bacteria 5551
440 Ga0495645_0043634 3300046543 Bacteria 3271
441 Ga0495622_0004150 3300046557 Bacteria 6754
442 Ga0495622_0011613 3300046557 Bacteria 4069
443 Ga0495622_0011736 3300046557 Bacteria 4051
444 Ga0495622_0017425 3300046557 Bacteria 3343
445 Ga0495622_0046465 3300046557 Bacteria 2017
446 Ga0495622_0215248 3300046557 Bacteria 852
447 Ga0495633_0002761 3300046558 Bacteria 12137
448 Ga0495633_0075377 3300046558 Bacteria 1571
449 Ga0495633_0102832 3300046558 Bacteria 1326
450 Ga0495656_0001074 3300046615 Bacteria 8856
451 Ga0495656_0014629 3300046615 Bacteria 2945
452 Ga0495656_0047172 3300046615 Bacteria 1826
453 Ga0495668_0000697 3300046616 Bacteria 40410
454 Ga0495668_0002906 3300046616 Bacteria 13525
455 Ga0495668_0006334 3300046616 Bacteria 7769
456 Ga0495668_0014366 3300046616 Bacteria 4644
457 Ga0495634_0001936 3300046642 Bacteria 17711
458 Ga0495634_0004821 3300046642 Bacteria 10479
459 Ga0495634_0062604 3300046642 Bacteria 2470
460 Ga0495611_0002700 3300046648 Bacteria 7998
461 Ga0495611_0008172 3300046648 Bacteria 4439
462 Ga0495611_0024906 3300046648 Bacteria 2605
463 Ga0495625_0004485 3300046660 Bacteria 13181
464 Ga0495625_0005441 3300046660 Bacteria 11610
465 Ga0495625_0010905 3300046660 Bacteria 7465
466 Ga0495625_0012607 3300046660 Bacteria 6840
467 Ga0495625_0055442 3300046660 Bacteria 2826
468 Ga0495625_0094294 3300046660 Bacteria 2065
469 Ga0495625_0159065 3300046660 Bacteria 1514
470 Ga0495635_0000330 3300046663 Bacteria 30297
471 Ga0495635_0009906 3300046663 Bacteria 6663
472 Ga0495659_0001256 3300046664 Bacteria 8763
473 Ga0495659_0004730 3300046664 Bacteria 4287
474 Ga0495659_0060421 3300046664 Bacteria 1398
475 Ga0495661_0006809 3300046665 Bacteria 8005
476 Ga0495661_0009900 3300046665 Bacteria 6521
477 Ga0495661_0026207 3300046665 Bacteria 3756
478 Ga0495661_0030052 3300046665 Bacteria 3462
479 Ga0495661_0066825 3300046665 Bacteria 2114
480 Ga0495661_0130351 3300046665 Bacteria 1378
481 Ga0495661_0237113 3300046665 Bacteria 937
482 Ga0495661_0249856 3300046665 Bacteria 906
483 Ga0495588_0015480 3300046674 Bacteria 3672
484 Ga0495588_0064685 3300046674 Bacteria 1897
485 Ga0495588_0070068 3300046674 Bacteria 1822
486 Ga0495588_0079421 3300046674 Bacteria 1712
487 Ga0495588_0101860 3300046674 Bacteria 1509
488 Ga0495657_0027600 3300046675 Bacteria 4004
489 Ga0495599_0363484 3300046678 Bacteria 866
490 Ga0495623_0001659 3300046679 Bacteria 14980
491 Ga0495623_0003706 3300046679 Bacteria 10074
492 Ga0495646_0003487 3300046680 Bacteria 9790
493 Ga0495646_0008907 3300046680 Bacteria 6373
494 Ga0495646_0040740 3300046680 Bacteria 2858
495 Ga0495669_0000313 3300046684 Bacteria 26760
496 Ga0495669_0008941 3300046684 Bacteria 4219
497 Ga0495613_0004886 3300046689 Bacteria 10068
498 Ga0495613_0007882 3300046689 Bacteria 7919
499 Ga0495613_0047327 3300046689 Bacteria 3177
500 Ga0495624_0001015 3300046690 Bacteria 22230
501 Ga0495670_0001007 3300046691 Bacteria 13698
502 Ga0495670_0001013 3300046691 Bacteria 13648
503 Ga0495670_0001333 3300046691 Bacteria 12050
504 Ga0495670_0002023 3300046691 Bacteria 9987
505 Ga0495670_0008875 3300046691 Bacteria 4947
506 Ga0495670_0021134 3300046691 Bacteria 3210
507 Ga0495670_0047465 3300046691 Bacteria 2147
508 Ga0495670_0079547 3300046691 Bacteria 1668
509 Ga0495670_0113564 3300046691 Bacteria 1403
510 Ga0495670_0137640 3300046691 Bacteria 1275
511 Ga0495671_0000840 3300046692 Bacteria 21929
512 Ga0495671_0001134 3300046692 Bacteria 18348
513 Ga0495671_0001827 3300046692 Bacteria 13715
514 Ga0495671_0004353 3300046692 Bacteria 8496
515 Ga0495671_0006930 3300046692 Bacteria 6503
516 Ga0495671_0010138 3300046692 Bacteria 5237
517 Ga0495671_0010334 3300046692 Bacteria 5176
518 Ga0495671_0012325 3300046692 Bacteria 4673
519 Ga0495671_0019268 3300046692 Bacteria 3610
520 Ga0495671_0019624 3300046692 Bacteria 3570
521 Ga0495671_0027474 3300046692 Bacteria 2939
522 Ga0495671_0032537 3300046692 Bacteria 2662
523 Ga0495671_0151108 3300046692 Bacteria 1130
524 Ga0495649_0001999 3300046694 Bacteria 14793
525 Ga0495649_0002019 3300046694 Bacteria 14686
526 Ga0495649_0002908 3300046694 Bacteria 11854
527 Ga0495649_0003334 3300046694 Bacteria 10897
528 Ga0495649_0007116 3300046694 Bacteria 6876
529 Ga0495649_0009679 3300046694 Bacteria 5712
530 Ga0495649_0013405 3300046694 Bacteria 4728
531 Ga0495649_0015410 3300046694 Bacteria 4351
532 Ga0495649_0021234 3300046694 Bacteria 3638
533 Ga0495649_0027806 3300046694 Bacteria 3136
534 Ga0495649_0059371 3300046694 Bacteria 2059
535 Ga0495649_0072724 3300046694 Bacteria 1842
536 Ga0495589_0000174 3300046794 Bacteria 57675
537 Ga0495589_0001664 3300046794 Bacteria 12735
538 Ga0495589_0002033 3300046794 Bacteria 11448
539 Ga0495589_0004100 3300046794 Bacteria 7801
540 Ga0495589_0008116 3300046794 Bacteria 5489
541 Ga0495589_0018420 3300046794 Bacteria 3579
542 Ga0495589_0107238 3300046794 Bacteria 1349
543 Ga0495600_0026279 3300046809 Bacteria 3756
544 Ga0495600_0084335 3300046809 Bacteria 2073
545 Ga0495600_0397094 3300046809 Bacteria 858
546 Ga0495660_0003328 3300046810 Bacteria 9968
547 Ga0495660_0004332 3300046810 Bacteria 8595
548 Ga0495660_0004593 3300046810 Bacteria 8329
549 Ga0495660_0006396 3300046810 Bacteria 6969
550 Ga0495660_0008183 3300046810 Bacteria 6135
551 Ga0495660_0009878 3300046810 Bacteria 5553
552 Ga0495660_0014159 3300046810 Bacteria 4618
553 Ga0495660_0025992 3300046810 Bacteria 3321
554 Ga0495660_0038785 3300046810 Bacteria 2647
555 Ga0495660_0040140 3300046810 Bacteria 2595
556 Ga0495660_0041669 3300046810 Bacteria 2540
557 Ga0495660_0044312 3300046810 Bacteria 2448
558 Ga0495660_0093562 3300046810 Bacteria 1558
559 Ga0495581_0001346 3300047315 Bacteria 13577
560 Ga0495604_0001836 3300047317 Bacteria 17291
561 Ga0495604_0080113 3300047317 Bacteria 2447
562 Ga0495604_0336079 3300047317 Bacteria 1006
563 Ga0495636_0012176 3300047318 Bacteria 3406
564 Ga0495672_0001500 3300047320 Bacteria 22898
565 Ga0495672_0010720 3300047320 Bacteria 6506
566 Ga0495672_0013652 3300047320 Bacteria 5591
567 Ga0495672_0014576 3300047320 Bacteria 5375
568 Ga0495672_0019675 3300047320 Bacteria 4449
569 Ga0495672_0020058 3300047320 Bacteria 4390
570 Ga0495672_0027382 3300047320 Bacteria 3622
571 Ga0495672_0027509 3300047320 Bacteria 3612
572 Ga0495672_0044367 3300047320 Bacteria 2667
573 Ga0495672_0063542 3300047320 Bacteria 2118
574 Ga0495672_0143906 3300047320 Bacteria 1242
575 Ga0495676_0001538 3300047321 Bacteria 19964
576 Ga0495676_0002299 3300047321 Bacteria 16967
577 Ga0495680_0003229 3300047322 Bacteria 16190
578 Ga0495680_0013809 3300047322 Bacteria 7028
579 Ga0495680_0023665 3300047322 Bacteria 5104
580 Ga0495680_0036505 3300047322 Bacteria 3944
581 Ga0495680_0038684 3300047322 Bacteria 3810
582 Ga0495683_0000100 3300047323 Bacteria 88276
583 Ga0495683_0000613 3300047323 Bacteria 26668
584 Ga0495683_0003248 3300047323 Bacteria 9504
585 Ga0495683_0004114 3300047323 Bacteria 8329
586 Ga0495683_0008160 3300047323 Bacteria 5617
587 Ga0495683_0009643 3300047323 Bacteria 5140
588 Ga0495683_0021947 3300047323 Bacteria 3286
589 Ga0495683_0040688 3300047323 Bacteria 2347
590 Ga0495687_000944 3300047443 Bacteria 30012
591 Ga0495687_001467 3300047443 Bacteria 21617
592 Ga0495687_002349 3300047443 Bacteria 15358
593 Ga0495675_0007288 3300047444 Bacteria 6813
594 Ga0495675_0020381 3300047444 Bacteria 4216
595 Ga0495675_0139673 3300047444 Bacteria 1502
596 Ga0495677_0008612 3300047445 Bacteria 3786
597 Ga0495679_000687 3300047446 Bacteria 22134
598 Ga0495679_002214 3300047446 Bacteria 10126
599 Ga0495679_002497 3300047446 Bacteria 9334
600 Ga0495679_004734 3300047446 Bacteria 6178
601 Ga0495685_088978 3300047447 Bacteria 1024
602 Ga0495673_0000857 3300047469 Bacteria 28245
603 Ga0495673_0000860 3300047469 Bacteria 28187
604 Ga0495673_0000992 3300047469 Bacteria 25333
605 Ga0495673_0002570 3300047469 Bacteria 12628
606 Ga0495673_0003868 3300047469 Bacteria 9648
607 Ga0495673_0004073 3300047469 Bacteria 9297
608 Ga0495673_0004715 3300047469 Bacteria 8455
609 Ga0495673_0007752 3300047469 Bacteria 6129
610 Ga0495673_0008415 3300047469 Bacteria 5812
611 Ga0495673_0011808 3300047469 Bacteria 4669
612 Ga0495673_0013217 3300047469 Bacteria 4347
613 Ga0495673_0017866 3300047469 Bacteria 3588
614 Ga0495673_0059246 3300047469 Bacteria 1646
615 Ga0495681_0000298 3300047470 Bacteria 39731
616 Ga0495681_0000362 3300047470 Bacteria 35488
617 Ga0495681_0002536 3300047470 Bacteria 13004
618 Ga0495681_0002556 3300047470 Bacteria 12952
619 Ga0495681_0005304 3300047470 Bacteria 8652
620 Ga0495681_0006016 3300047470 Bacteria 8033
621 Ga0495681_0008159 3300047470 Bacteria 6592
622 Ga0495681_0009808 3300047470 Bacteria 5857
623 Ga0495681_0012766 3300047470 Bacteria 4916
624 Ga0495681_0021551 3300047470 Bacteria 3468
625 Ga0495684_0004420 3300047471 Bacteria 10996
626 Ga0495684_0078202 3300047471 Bacteria 2510
627 Ga0495686_0001742 3300047472 Bacteria 22327
628 Ga0495686_0005075 3300047472 Bacteria 10542
629 Ga0495686_0131044 3300047472 Bacteria 1486
630 Ga0495593_0000161 3300047673 Bacteria 33910
631 Ga0495593_0004472 3300047673 Bacteria 8308
632 Ga0495593_0037894 3300047673 Bacteria 2605
633 Ga0495602_0001390 3300048088 Bacteria 23892
634 Ga0495615_0063703 3300048090 Bacteria 979
635 Ga0495626_0000397 3300048091 Bacteria 44891
636 Ga0495626_0000639 3300048091 Bacteria 33882
637 Ga0495626_0000743 3300048091 Bacteria 30096
638 Ga0495626_0002051 3300048091 Bacteria 14740
639 Ga0495626_0004192 3300048091 Bacteria 8934
640 Ga0495626_0005070 3300048091 Bacteria 7856
641 Ga0495626_0010123 3300048091 Bacteria 5059
642 Ga0495626_0020288 3300048091 Bacteria 3314
643 Ga0495626_0084653 3300048091 Bacteria 1403
644 Ga0495626_0090423 3300048091 Bacteria 1346
645 Ga0495626_0094565 3300048091 Bacteria 1310
646 Ga0496102_0000517 3300048905 Bacteria 42023
647 Ga0496102_0008754 3300048905 Bacteria 8684
648 Ga0496103_0002027 3300048906 Bacteria 13016
649 Ga0496105_0367085 3300048908 Bacteria 1147
650 Ga0496110_0097391 3300048913 Bacteria 2636
651 Ga0496110_0339020 3300048913 Bacteria 1369
652 Ga0496111_0000148 3300048914 Bacteria 31473
653 Ga0496112_0339582 3300048915 Bacteria 1445
654 Ga0496115_0031228 3300048918 Bacteria 4195
655 Ga0496116_0000933 3300048919 Bacteria 35951
656 Ga0496116_0003065 3300048919 Bacteria 16863
657 Ga0496116_0008980 3300048919 Bacteria 8594
658 Ga0496116_0016342 3300048919 Bacteria 5809
659 Ga0496117_0000151 3300048920 Bacteria 148304
660 Ga0496117_0004594 3300048920 Bacteria 15086
661 Ga0496117_0006299 3300048920 Bacteria 12075
662 Ga0496117_0016927 3300048920 Bacteria 6113
663 Ga0496117_0034336 3300048920 Bacteria 3822
664 Ga0496118_0000016 3300048921 Bacteria 549586
665 Ga0496118_0003729 3300048921 Bacteria 18856
666 Ga0496118_0004460 3300048921 Bacteria 16597
667 Ga0496118_0011491 3300048921 Bacteria 8631
668 Ga0496118_0033675 3300048921 Bacteria 4198
669 Ga0496119_0028188 3300048922 Bacteria 3839
670 Ga0496119_0035991 3300048922 Bacteria 3236
671 Ga0496119_0100699 3300048922 Bacteria 1622
672 Ga0496120_0001266 3300048923 Bacteria 31684
673 Ga0496120_0070593 3300048923 Bacteria 1920
674 Ga0496120_0070661 3300048923 Bacteria 1919
675 Ga0496121_0014272 3300048924 Bacteria 8447
676 Ga0496121_0027304 3300048924 Bacteria 5343
677 Ga0496121_0028872 3300048924 Bacteria 5151
678 Ga0496121_0029884 3300048924 Bacteria 5020
679 Ga0496121_0153846 3300048924 Bacteria 1689
680 Ga0496122_0113380 3300048925 Bacteria 1771
681 Ga0496123_0053751 3300048926 Bacteria 2658
682 Ga0496123_0122548 3300048926 Bacteria 1458
683 Ga0496124_0002468 3300048927 Bacteria 24181
684 Ga0496124_0004893 3300048927 Bacteria 15409
685 Ga0496124_0044319 3300048927 Bacteria 3817
686 Ga0496124_0141907 3300048927 Bacteria 1894
687 Ga0496124_0185568 3300048927 Bacteria 1596
688 Ga0496124_0234670 3300048927 Bacteria 1368
689 Ga0496124_0261740 3300048927 Bacteria 1272
690 Ga0496124_0442015 3300048927 Bacteria 889
691 Ga0496125_0003643 3300048928 Bacteria 18447
692 Ga0496125_0005055 3300048928 Bacteria 14879
693 Ga0496125_0011226 3300048928 Bacteria 8979
694 Ga0496125_0120659 3300048928 Bacteria 1871
695 Ga0496126_0097366 3300048929 Bacteria 2578
696 Ga0495678_002019 3300049459 Bacteria 14561
697 Ga0495678_004637 3300049459 Bacteria 7884
698 Ga0495678_006096 3300049459 Bacteria 6485
699 Ga0495678_006595 3300049459 Bacteria 6152
700 Ga0495678_007631 3300049459 Bacteria 5582
701 Ga0495678_013405 3300049459 Bacteria 3851
702 Ga0495678_028289 3300049459 Bacteria 2367
703 Ga0495678_035086 3300049459 Bacteria 2059
704 Ga0495678_084087 3300049459 Bacteria 1136
705 Ga0495682_0000419 3300049460 Bacteria 29844
706 Ga0495682_0003117 3300049460 Bacteria 7509
707 Ga0495682_0004494 3300049460 Bacteria 5952
708 Ga0495682_0014704 3300049460 Bacteria 2967
709 Ga0495682_0015624 3300049460 Bacteria 2876
710 Ga0495682_0017269 3300049460 Bacteria 2726
711 Ga0495682_0058660 3300049460 Bacteria 1392
712 Ga0501031_0000226 3300049568 Bacteria 32275
713 Ga0501031_0040180 3300049568 Bacteria 3054
714 Ga0501032_0000008 3300049569 Bacteria 240313
715 Ga0501032_0002875 3300049569 Bacteria 13394
716 Ga0501033_0000012 3300049570 Bacteria 241599
717 Ga0501033_0015281 3300049570 Bacteria 5823
718 Ga0501034_0000035 3300049571 Bacteria 241623
719 Ga0501034_0006169 3300049571 Bacteria 12922
720 Ga0501036_0000006 3300049572 Bacteria 241623
721 Ga0501036_0001251 3300049572 Bacteria 19465
722 Ga0501037_0000115 3300049573 Bacteria 74932
723 Ga0501037_0003285 3300049573 Bacteria 11744
724 Ga0501038_0000652 3300049574 Bacteria 30853
725 Ga0501038_0041651 3300049574 Bacteria 4004
726 Ga0501039_0000012 3300049575 Bacteria 241623
727 Ga0501039_0005059 3300049575 Bacteria 9996
728 Ga0501040_0016331 3300049576 Bacteria 4912
729 Ga0501043_0001348 3300049579 Bacteria 21500
730 Ga0501043_0016287 3300049579 Bacteria 5830
731 Ga0501043_0016490 3300049579 Bacteria 5790
732 Ga0501046_0001206 3300049580 Bacteria 25105
733 Ga0501046_0036739 3300049580 Bacteria 3941
734 Ga0501047_0007678 3300049581 Bacteria 10159
735 Ga0501047_0018418 3300049581 Bacteria 6694
736 Ga0501048_0008779 3300049582 Bacteria 7616
737 Ga0501067_0000260 3300049583 Bacteria 28874
738 Ga0501068_0027758 3300049584 Bacteria 3344
739 Ga0501069_0002372 3300049585 Bacteria 9550
740 Ga0501069_0017056 3300049585 Bacteria 3904
741 Ga0501070_0017296 3300049586 Bacteria 6054
742 Ga0501070_0023379 3300049586 Bacteria 5178
743 Ga0501070_0033426 3300049586 Bacteria 4303
744 Ga0501070_0053430 3300049586 Bacteria 3351
745 Ga0501072_0050579 3300049588 Bacteria 3272
746 Ga0501073_0051554 3300049589 Bacteria 2882
747 Ga0501074_0003936 3300049590 Bacteria 10587
748 Ga0501079_0024088 3300049741 Bacteria 4670
749 Ga0501080_0009913 3300049742 Bacteria 8704
750 Ga0501083_0013389 3300049744 Bacteria 5734
751 Ga0501035_0000192 3300049822 Bacteria 74834
752 Ga0501035_0017828 3300049822 Bacteria 6548
753 Ga0501044_0000015 3300049823 Bacteria 241623
754 Ga0501044_0070308 3300049823 Bacteria 3560
755 Ga0501044_0119343 3300049823 Bacteria 2639
756 Ga0501045_0022761 3300049824 Bacteria 4488
757 nmdc:mga03683_8180_c1 3300050489 Bacteria 3666
758 nmdc:mga03683_91899_c1 3300050489 Bacteria 1324
759 nmdc:mga00v17_214197_c1 3300050491 Bacteria 1247
760 nmdc:mga08x19_51761_c1 3300050514 Bacteria 2639
761 nmdc:mga0sz30_2134_c1 3300050516 Bacteria 7063
762 nmdc:mga0sz30_43337_c1 3300050516 Bacteria 1894
763 Ga0500618_000160 3300053125 Bacteria 56064
764 Ga0500586_000451 3300053145 Bacteria 8189
765 Ga0500649_110500 3300053722 Bacteria 1068
766 Ga0501084_0009365 3300054114 Bacteria 8103
767 Ga0501082_0001610 3300060353 Bacteria 19885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0000643 Ga0495610_0000643_25623_26321 207
2 3300042006 Ga0439432_014523 Ga0439432_014523_1878_2558 210
3 3300049586 Ga0501070_0053430 Ga0501070_0053430_294_1055 212
4 3300046506 Ga0495583_0015064 Ga0495583_0015064_2521_3174 216
5 3300048913 Ga0496110_0097391 Ga0496110_0097391_262_915 216
6 3300048914 Ga0496111_0000148 Ga0496111_0000148_20163_20816 216
7 iso_pu_bacteria 2511231015 2511321714 217
8 3300003791 Ga0055530_10046341 Ga0055530_100463411 218
9 3300009011 Ga0105251_10068170 Ga0105251_100681702 218
10 3300009036 Ga0105244_10013519 Ga0105244_100135194 218
11 3300009036 Ga0105244_10044016 Ga0105244_100440161 218
12 3300013104 Ga0157370_10007880 Ga0157370_100078809 218
13 3300013306 Ga0163162_10008966 Ga0163162_100089664 218
14 3300025292 Ga0209676_1002153 Ga0209676_10021539 218
15 3300025298 Ga0209050_1000697 Ga0209050_100069734 218
16 3300025303 Ga0209051_1024696 Ga0209051_10246962 218
17 3300025728 Ga0207655_1003216 Ga0207655_100321613 218
18 3300025735 Ga0207713_1030176 Ga0207713_10301762 218
19 3300042138 Ga0450903_012333 Ga0450903_012333_77_781 218
20 3300046455 Ga0495603_0050271 Ga0495603_0050271_535_1239 218
21 3300046474 Ga0495605_0025409 Ga0495605_0025409_2115_2822 218
22 3300046475 Ga0495639_0032651 Ga0495639_0032651_573_1277 218
23 3300046491 Ga0495584_0012981 Ga0495584_0012981_1767_2474 218
24 3300046501 Ga0495607_0032694 Ga0495607_0032694_929_1636 218
25 3300046507 Ga0495606_0001018 Ga0495606_0001018_22378_23085 218
26 3300046512 Ga0495610_0028569 Ga0495610_0028569_907_1614 218
27 3300046513 Ga0495616_0103960 Ga0495616_0103960_458_1165 218
28 3300046515 Ga0495620_0005376 Ga0495620_0005376_5258_5965 218
29 3300046524 Ga0495648_0000340 Ga0495648_0000340_41962_42669 218
30 3300046530 Ga0495654_0001523 Ga0495654_0001523_13948_14655 218
31 3300046530 Ga0495654_0011887 Ga0495654_0011887_3589_4293 218
32 3300046538 Ga0495609_0004881 Ga0495609_0004881_3316_4020 218
33 3300046557 Ga0495622_0011613 Ga0495622_0011613_1262_1966 218
34 3300046558 Ga0495633_0075377 Ga0495633_0075377_817_1524 218
35 3300046660 Ga0495625_0010905 Ga0495625_0010905_4131_4838 218
36 3300046665 Ga0495661_0006809 Ga0495661_0006809_4948_5655 218
37 3300046674 Ga0495588_0015480 Ga0495588_0015480_741_1445 218
38 3300046691 Ga0495670_0001333 Ga0495670_0001333_3430_4134 218
39 3300046692 Ga0495671_0019268 Ga0495671_0019268_1884_2588 218
40 3300046692 Ga0495671_0019624 Ga0495671_0019624_1729_2436 218
41 3300046794 Ga0495589_0000174 Ga0495589_0000174_28598_29305 218
42 3300046809 Ga0495600_0397094 Ga0495600_0397094_174_848 218
43 3300046810 Ga0495660_0003328 Ga0495660_0003328_3082_3789 218
44 3300046810 Ga0495660_0008183 Ga0495660_0008183_2480_3184 218
45 3300047323 Ga0495683_0000100 Ga0495683_0000100_29782_30489 218
46 3300047323 Ga0495683_0009643 Ga0495683_0009643_4121_4825 218
47 3300047470 Ga0495681_0012766 Ga0495681_0012766_22_729 218
48 3300047472 Ga0495686_0005075 Ga0495686_0005075_8223_8930 218
49 3300048924 Ga0496121_0028872 Ga0496121_0028872_659_1363 218
50 3300048928 Ga0496125_0011226 Ga0496125_0011226_4925_5629 218
51 3300002739 JGI25158J39367_1003302 JGI25158J39367_10033024 219
52 3300002987 JGI25159J45721_1000125 JGI25159J45721_10001254 219
53 3300003354 JGI25160J50197_1000020 JGI25160J50197_1000020160 219
54 3300003374 JGI25161J50226_1000544 JGI25161J50226_10005444 219
55 3300003781 Ga0055536_1023606 Ga0055536_10236062 219
56 3300004625 Ga0055543_1000163 Ga0055543_100016317 219
57 3300005262 Ga0065165_1000013 Ga0065165_100001357 219
58 3300005288 Ga0065714_10067222 Ga0065714_100672223 219
59 3300017792 Ga0163161_10067858 Ga0163161_100678582 219
60 3300025208 Ga0209436_100498 Ga0209436_1004984 219
61 3300025284 Ga0209130_1000034 Ga0209130_100003456 219
62 3300025292 Ga0209676_1007862 Ga0209676_10078622 219
63 3300025295 Ga0209564_1000013 Ga0209564_100001357 219
64 3300025298 Ga0209050_1002550 Ga0209050_100255012 219
65 3300025299 Ga0209256_1001503 Ga0209256_10015035 219
66 3300025302 Ga0207426_1000006 Ga0207426_1000006430 219
67 3300025303 Ga0209051_1010619 Ga0209051_10106195 219
68 3300025304 Ga0209257_1009839 Ga0209257_10098392 219
69 3300027717 Ga0209998_10004424 Ga0209998_100044242 219
70 3300042009 Ga0439451_026189 Ga0439451_026189_319_1032 219
71 3300042137 Ga0450902_000284 Ga0450902_000284_2493_3200 219
72 3300042138 Ga0450903_003347 Ga0450903_003347_1705_2412 219
73 3300046460 Ga0495638_0026858 Ga0495638_0026858_2036_2743 219
74 3300046519 Ga0495632_0012333 Ga0495632_0012333_3737_4444 219
75 3300046519 Ga0495632_0192041 Ga0495632_0192041_262_921 219
76 3300047469 Ga0495673_0002570 Ga0495673_0002570_2021_2728 219
77 3300049568 Ga0501031_0000226 Ga0501031_0000226_3044_3781 219
78 3300049569 Ga0501032_0000008 Ga0501032_0000008_236572_237309 219
79 3300049570 Ga0501033_0000012 Ga0501033_0000012_4316_5053 219
80 3300049571 Ga0501034_0000035 Ga0501034_0000035_4315_5052 219
81 3300049572 Ga0501036_0000006 Ga0501036_0000006_4315_5052 219
82 3300049573 Ga0501037_0000115 Ga0501037_0000115_69886_70623 219
83 3300049574 Ga0501038_0000652 Ga0501038_0000652_4315_5052 219
84 3300049575 Ga0501039_0000012 Ga0501039_0000012_4315_5052 219
85 3300049576 Ga0501040_0016331 Ga0501040_0016331_1488_2225 219
86 3300049579 Ga0501043_0001348 Ga0501043_0001348_2967_3704 219
87 3300049580 Ga0501046_0036739 Ga0501046_0036739_311_1048 219
88 3300049581 Ga0501047_0018418 Ga0501047_0018418_3342_4079 219
89 3300049585 Ga0501069_0017056 Ga0501069_0017056_263_1021 219
90 3300049586 Ga0501070_0017296 Ga0501070_0017296_2389_3147 219
91 3300049586 Ga0501070_0023379 Ga0501070_0023379_1886_2623 219
92 3300049822 Ga0501035_0000192 Ga0501035_0000192_4315_5052 219
93 3300049823 Ga0501044_0000015 Ga0501044_0000015_236572_237309 219
94 3300003794 Ga0055531_10035772 Ga0055531_100357722 220
95 3300025294 Ga0209025_1000311 Ga0209025_100031182 220
96 3300005327 Ga0070658_10045702 Ga0070658_100457024 221
97 3300005530 Ga0070679_100583531 Ga0070679_1005835311 221
98 3300005563 Ga0068855_100109690 Ga0068855_1001096904 221
99 3300005577 Ga0068857_100129026 Ga0068857_1001290262 221
100 3300013104 Ga0157370_10033186 Ga0157370_100331862 221
101 3300025913 Ga0207695_10157517 Ga0207695_101575172 221
102 3300025949 Ga0207667_10327376 Ga0207667_103273762 221
103 3300026116 Ga0207674_10079798 Ga0207674_100797983 221
104 3300041405 Ga0439438_008400 Ga0439438_008400_2057_2764 221
105 3300041407 Ga0439447_006416 Ga0439447_006416_682_1389 221
106 3300041411 Ga0439466_0033151 Ga0439466_0033151_118_825 221
107 3300042125 Ga0450923_068842 Ga0450923_068842_26_703 221
108 3300042531 Ga0450918_018217 Ga0450918_018217_276_983 221
109 3300049568 Ga0501031_0040180 Ga0501031_0040180_1862_2536 221
110 3300049569 Ga0501032_0002875 Ga0501032_0002875_11135_11809 221
111 3300049570 Ga0501033_0015281 Ga0501033_0015281_4715_5389 221
112 3300049571 Ga0501034_0006169 Ga0501034_0006169_8665_9339 221
113 3300049572 Ga0501036_0001251 Ga0501036_0001251_11077_11751 221
114 3300049573 Ga0501037_0003285 Ga0501037_0003285_9825_10499 221
115 3300049574 Ga0501038_0041651 Ga0501038_0041651_1118_1792 221
116 3300049575 Ga0501039_0005059 Ga0501039_0005059_2230_2904 221
117 3300049579 Ga0501043_0016490 Ga0501043_0016490_3586_4260 221
118 3300049580 Ga0501046_0001206 Ga0501046_0001206_9086_9760 221
119 3300049581 Ga0501047_0007678 Ga0501047_0007678_435_1109 221
120 3300049582 Ga0501048_0008779 Ga0501048_0008779_2564_3238 221
121 3300049583 Ga0501067_0000260 Ga0501067_0000260_19015_19689 221
122 3300049584 Ga0501068_0027758 Ga0501068_0027758_144_818 221
123 3300049585 Ga0501069_0002372 Ga0501069_0002372_2724_3398 221
124 3300049586 Ga0501070_0033426 Ga0501070_0033426_1608_2282 221
125 3300049588 Ga0501072_0050579 Ga0501072_0050579_1005_1679 221
126 3300049589 Ga0501073_0051554 Ga0501073_0051554_1958_2632 221
127 3300049590 Ga0501074_0003936 Ga0501074_0003936_7843_8517 221
128 3300049741 Ga0501079_0024088 Ga0501079_0024088_238_912 221
129 3300049742 Ga0501080_0009913 Ga0501080_0009913_7468_8142 221
130 3300049744 Ga0501083_0013389 Ga0501083_0013389_3340_4014 221
131 3300049822 Ga0501035_0017828 Ga0501035_0017828_1646_2320 221
132 3300049823 Ga0501044_0119343 Ga0501044_0119343_1531_2205 221
133 3300049824 Ga0501045_0022761 Ga0501045_0022761_2212_2886 221
134 3300054114 Ga0501084_0009365 Ga0501084_0009365_4715_5389 221
135 3300060353 Ga0501082_0001610 Ga0501082_0001610_2650_3324 221
136 3300046458 Ga0495591_002727 Ga0495591_002727_4977_5648 223
137 3300046524 Ga0495648_0006089 Ga0495648_0006089_4232_4903 223
138 3300049459 Ga0495678_006595 Ga0495678_006595_4268_4939 223
139 3300053145 Ga0500586_000451 Ga0500586_000451_3374_4045 223
140 3300013104 Ga0157370_11046020 Ga0157370_110460201 224
141 3300046474 Ga0495605_0021073 Ga0495605_0021073_17_691 224
142 3300046506 Ga0495583_0000501 Ga0495583_0000501_16843_17550 224
143 3300046520 Ga0495637_0006654 Ga0495637_0006654_2343_3050 224
144 3300046530 Ga0495654_0000896 Ga0495654_0000896_3269_3976 224
145 3300046557 Ga0495622_0017425 Ga0495622_0017425_2125_2832 224
146 3300046615 Ga0495656_0014629 Ga0495656_0014629_11_685 224
147 3300046660 Ga0495625_0094294 Ga0495625_0094294_17_691 224
148 3300046665 Ga0495661_0237113 Ga0495661_0237113_10_684 224
149 3300046674 Ga0495588_0070068 Ga0495588_0070068_518_1225 224
150 3300046692 Ga0495671_0151108 Ga0495671_0151108_440_1114 224
151 3300046694 Ga0495649_0002908 Ga0495649_0002908_2825_3532 224
152 3300046694 Ga0495649_0009679 Ga0495649_0009679_3899_4606 224
153 3300047320 Ga0495672_0044367 Ga0495672_0044367_52_759 224
154 3300047323 Ga0495683_0008160 Ga0495683_0008160_22_696 224
155 3300047469 Ga0495673_0004715 Ga0495673_0004715_5070_5777 224
156 3300048091 Ga0495626_0000397 Ga0495626_0000397_31067_31774 224
157 3300049459 Ga0495678_013405 Ga0495678_013405_2582_3289 224
158 3300049579 Ga0501043_0016287 Ga0501043_0016287_2153_2836 224
159 3300049823 Ga0501044_0070308 Ga0501044_0070308_1724_2407 224
160 3300005455 Ga0070663_100222336 Ga0070663_1002223362 225
161 3300009092 Ga0105250_10039812 Ga0105250_100398122 225
162 3300026067 Ga0207678_10100576 Ga0207678_101005763 225
163 3300046458 Ga0495591_003694 Ga0495591_003694_4953_5630 225
164 3300046460 Ga0495638_0000878 Ga0495638_0000878_7286_7963 225
165 3300046474 Ga0495605_0083524 Ga0495605_0083524_568_1245 225
166 3300046492 Ga0495585_0000342 Ga0495585_0000342_7296_7973 225
167 3300046492 Ga0495585_0001798 Ga0495585_0001798_7228_7905 225
168 3300046518 Ga0495631_0171596 Ga0495631_0171596_115_792 225
169 3300046520 Ga0495637_0004576 Ga0495637_0004576_1482_2159 225
170 3300046542 Ga0495597_0028163 Ga0495597_0028163_1086_1790 225
171 3300046557 Ga0495622_0046465 Ga0495622_0046465_118_795 225
172 3300046648 Ga0495611_0024906 Ga0495611_0024906_695_1372 225
173 3300046692 Ga0495671_0006930 Ga0495671_0006930_199_876 225
174 3300047446 Ga0495679_002214 Ga0495679_002214_7216_7893 225
175 3300048091 Ga0495626_0004192 Ga0495626_0004192_4970_5647 225
176 3300049459 Ga0495678_035086 Ga0495678_035086_786_1463 225
177 3300049460 Ga0495682_0000419 Ga0495682_0000419_5280_5987 225
178 3300003322 rootL2_10219179 rootL2_102191792 226
179 3300005983 Ga0081540_1092014 Ga0081540_10920143 226
180 3300009101 Ga0105247_10032282 Ga0105247_100322823 226
181 3300013102 Ga0157371_10002483 Ga0157371_1000248311 226
182 3300015265 Ga0182005_1015887 Ga0182005_10158872 226
183 3300017792 Ga0163161_10042638 Ga0163161_100426382 226
184 3300025900 Ga0207710_10244038 Ga0207710_102440382 226
185 3300025941 Ga0207711_10365687 Ga0207711_103656872 226
186 3300027907 Ga0207428_10313499 Ga0207428_103134992 226
187 3300041405 Ga0439438_023256 Ga0439438_023256_173_880 226
188 3300046463 Ga0495653_0016479 Ga0495653_0016479_2209_2919 226
189 3300046474 Ga0495605_0001616 Ga0495605_0001616_4492_5202 226
190 3300046491 Ga0495584_0012556 Ga0495584_0012556_3442_4149 226
191 3300046522 Ga0495643_0059056 Ga0495643_0059056_931_1638 226
192 3300046530 Ga0495654_0016898 Ga0495654_0016898_3047_3754 226
193 3300047320 Ga0495672_0013652 Ga0495672_0013652_1815_2522 226
194 3300047320 Ga0495672_0019675 Ga0495672_0019675_1173_1880 226
195 3300047320 Ga0495672_0027382 Ga0495672_0027382_177_884 226
196 3300047446 Ga0495679_000687 Ga0495679_000687_9938_10642 226
197 3300048091 Ga0495626_0020288 Ga0495626_0020288_260_967 226
198 3300048905 Ga0496102_0008754 Ga0496102_0008754_5063_5764 226
199 3300048908 Ga0496105_0367085 Ga0496105_0367085_395_1096 226
200 3300048919 Ga0496116_0016342 Ga0496116_0016342_1879_2580 226
201 3300048920 Ga0496117_0000151 Ga0496117_0000151_119957_120658 226
202 3300048920 Ga0496117_0016927 Ga0496117_0016927_2187_2894 226
203 3300048921 Ga0496118_0000016 Ga0496118_0000016_45026_45727 226
204 3300048921 Ga0496118_0011491 Ga0496118_0011491_4947_5654 226
205 3300048922 Ga0496119_0028188 Ga0496119_0028188_1344_2045 226
206 3300048923 Ga0496120_0001266 Ga0496120_0001266_12860_13561 226
207 3300048924 Ga0496121_0027304 Ga0496121_0027304_1878_2579 226
208 3300048927 Ga0496124_0261740 Ga0496124_0261740_20_721 226
209 iso_pu_bacteria 2791355263 2793340317 226
210 3300006177 Ga0075362_10062005 Ga0075362_100620052 227
211 3300006946 Ga0079104_1000155 Ga0079104_100015530 227
212 3300013104 Ga0157370_10143059 Ga0157370_101430592 227
213 3300015261 Ga0182006_1052067 Ga0182006_10520672 227
214 3300027111 Ga0209281_1000013 Ga0209281_1000013147 227
215 3300027907 Ga0207428_10021130 Ga0207428_100211303 227
216 3300041405 Ga0439438_008622 Ga0439438_008622_100_807 227
217 3300041405 Ga0439438_015080 Ga0439438_015080_191_904 227
218 3300041407 Ga0439447_001962 Ga0439447_001962_2556_3263 227
219 3300041411 Ga0439466_0012864 Ga0439466_0012864_141_848 227
220 3300042006 Ga0439432_007151 Ga0439432_007151_2728_3435 227
221 3300042010 Ga0439452_014955 Ga0439452_014955_455_1162 227
222 3300042013 Ga0439456_000731 Ga0439456_000731_4223_4930 227
223 3300042115 Ga0450911_004037 Ga0450911_004037_1340_2047 227
224 3300042122 Ga0450920_011627 Ga0450920_011627_722_1429 227
225 3300042124 Ga0450922_000053 Ga0450922_000053_3758_4465 227
226 3300042125 Ga0450923_002533 Ga0450923_002533_988_1695 227
227 3300042138 Ga0450903_000415 Ga0450903_000415_4898_5605 227
228 3300042146 Ga0450907_002919 Ga0450907_002919_2343_3050 227
229 3300042146 Ga0450907_032861 Ga0450907_032861_77_784 227
230 3300042147 Ga0450910_000089 Ga0450910_000089_6318_7025 227
231 3300042156 Ga0439446_0061434 Ga0439446_0061434_128_835 227
232 3300042184 Ga0450908_007552 Ga0450908_007552_945_1652 227
233 3300042185 Ga0450909_007653 Ga0450909_007653_168_875 227
234 3300046452 Ga0495617_001117 Ga0495617_001117_8836_9543 227
235 3300046453 Ga0495627_063708 Ga0495627_063708_47_754 227
236 3300046455 Ga0495603_0047924 Ga0495603_0047924_991_1698 227
237 3300046457 Ga0495590_0002248 Ga0495590_0002248_6211_6918 227
238 3300046457 Ga0495590_0004623 Ga0495590_0004623_2312_3019 227
239 3300046460 Ga0495638_0008531 Ga0495638_0008531_1499_2206 227
240 3300046460 Ga0495638_0038982 Ga0495638_0038982_1683_2390 227
241 3300046474 Ga0495605_0000378 Ga0495605_0000378_25183_25890 227
242 3300046474 Ga0495605_0002062 Ga0495605_0002062_6988_7695 227
243 3300046491 Ga0495584_0004453 Ga0495584_0004453_705_1412 227
244 3300046492 Ga0495585_0014593 Ga0495585_0014593_2569_3276 227
245 3300046501 Ga0495607_0148731 Ga0495607_0148731_367_1074 227
246 3300046513 Ga0495616_0001699 Ga0495616_0001699_9208_9915 227
247 3300046517 Ga0495630_0002431 Ga0495630_0002431_3837_4544 227
248 3300046519 Ga0495632_0001650 Ga0495632_0001650_11334_12041 227
249 3300046519 Ga0495632_0163176 Ga0495632_0163176_154_861 227
250 3300046520 Ga0495637_0018242 Ga0495637_0018242_1712_2419 227
251 3300046522 Ga0495643_0004681 Ga0495643_0004681_5015_5722 227
252 3300046524 Ga0495648_0001265 Ga0495648_0001265_4195_4902 227
253 3300046524 Ga0495648_0009137 Ga0495648_0009137_885_1592 227
254 3300046524 Ga0495648_0028736 Ga0495648_0028736_135_842 227
255 3300046526 Ga0495666_0003707 Ga0495666_0003707_2474_3181 227
256 3300046528 Ga0495642_0000734 Ga0495642_0000734_11544_12251 227
257 3300046530 Ga0495654_0004591 Ga0495654_0004591_1096_1803 227
258 3300046530 Ga0495654_0039340 Ga0495654_0039340_1085_1792 227
259 3300046536 Ga0495587_0003220 Ga0495587_0003220_7640_8353 227
260 3300046538 Ga0495609_0003777 Ga0495609_0003777_4022_4729 227
261 3300046542 Ga0495597_0004551 Ga0495597_0004551_1929_2636 227
262 3300046642 Ga0495634_0001936 Ga0495634_0001936_4616_5329 227
263 3300046663 Ga0495635_0000330 Ga0495635_0000330_10036_10749 227
264 3300046674 Ga0495588_0064685 Ga0495588_0064685_808_1515 227
265 3300046675 Ga0495657_0027600 Ga0495657_0027600_303_1010 227
266 3300046679 Ga0495623_0003706 Ga0495623_0003706_7200_7907 227
267 3300046680 Ga0495646_0008907 Ga0495646_0008907_3936_4649 227
268 3300046684 Ga0495669_0008941 Ga0495669_0008941_470_1177 227
269 3300046691 Ga0495670_0001007 Ga0495670_0001007_4997_5704 227
270 3300046691 Ga0495670_0137640 Ga0495670_0137640_421_1128 227
271 3300046694 Ga0495649_0002019 Ga0495649_0002019_6154_6861 227
272 3300046694 Ga0495649_0072724 Ga0495649_0072724_357_1064 227
273 3300046794 Ga0495589_0002033 Ga0495589_0002033_5134_5841 227
274 3300046794 Ga0495589_0008116 Ga0495589_0008116_791_1498 227
275 3300046809 Ga0495600_0026279 Ga0495600_0026279_1849_2556 227
276 3300046810 Ga0495660_0040140 Ga0495660_0040140_899_1606 227
277 3300046810 Ga0495660_0044312 Ga0495660_0044312_1711_2418 227
278 3300047320 Ga0495672_0001500 Ga0495672_0001500_20821_21528 227
279 3300047320 Ga0495672_0020058 Ga0495672_0020058_990_1697 227
280 3300047320 Ga0495672_0063542 Ga0495672_0063542_309_1016 227
281 3300047322 Ga0495680_0036505 Ga0495680_0036505_949_1656 227
282 3300047443 Ga0495687_000944 Ga0495687_000944_8019_8726 227
283 3300047443 Ga0495687_001467 Ga0495687_001467_15931_16638 227
284 3300047469 Ga0495673_0003868 Ga0495673_0003868_3944_4651 227
285 3300047469 Ga0495673_0007752 Ga0495673_0007752_2071_2778 227
286 3300047471 Ga0495684_0078202 Ga0495684_0078202_1406_2113 227
287 3300047673 Ga0495593_0000161 Ga0495593_0000161_31014_31721 227
288 3300048091 Ga0495626_0002051 Ga0495626_0002051_7794_8501 227
289 3300048905 Ga0496102_0000517 Ga0496102_0000517_12367_13080 227
290 3300048906 Ga0496103_0002027 Ga0496103_0002027_2268_2981 227
291 3300048919 Ga0496116_0008980 Ga0496116_0008980_2089_2802 227
292 3300048920 Ga0496117_0004594 Ga0496117_0004594_4328_5041 227
293 3300048921 Ga0496118_0004460 Ga0496118_0004460_8612_9325 227
294 3300048924 Ga0496121_0153846 Ga0496121_0153846_760_1473 227
295 3300048929 Ga0496126_0097366 Ga0496126_0097366_1495_2208 227
296 3300049459 Ga0495678_002019 Ga0495678_002019_12260_12967 227
297 3300049459 Ga0495678_084087 Ga0495678_084087_375_1082 227
298 3300049460 Ga0495682_0015624 Ga0495682_0015624_1605_2312 227
299 3300050489 nmdc:mga03683_91899_c1 nmdc:mga03683_91899_c1_169_876 227
300 3300050516 nmdc:mga0sz30_2134_c1 nmdc:mga0sz30_2134_c1_5540_6247 227
301 3300050516 nmdc:mga0sz30_43337_c1 nmdc:mga0sz30_43337_c1_24_731 227
302 3300042115 Ga0450911_000105 Ga0450911_000105_31017_31724 228
303 3300046452 Ga0495617_010022 Ga0495617_010022_1481_2188 228
304 3300046453 Ga0495627_010729 Ga0495627_010729_2068_2775 228
305 3300046457 Ga0495590_0006073 Ga0495590_0006073_2687_3394 228
306 3300046458 Ga0495591_000306 Ga0495591_000306_18299_19006 228
307 3300046460 Ga0495638_0032853 Ga0495638_0032853_1651_2358 228
308 3300046471 Ga0495650_0004052 Ga0495650_0004052_639_1346 228
309 3300046474 Ga0495605_0018649 Ga0495605_0018649_1348_2055 228
310 3300046491 Ga0495584_0001538 Ga0495584_0001538_6363_7070 228
311 3300046491 Ga0495584_0023817 Ga0495584_0023817_314_1021 228
312 3300046500 Ga0495596_0000357 Ga0495596_0000357_18332_19039 228
313 3300046501 Ga0495607_0014448 Ga0495607_0014448_2752_3459 228
314 3300046507 Ga0495606_0005712 Ga0495606_0005712_1252_1959 228
315 3300046512 Ga0495610_0017613 Ga0495610_0017613_3219_3926 228
316 3300046513 Ga0495616_0075517 Ga0495616_0075517_404_1111 228
317 3300046515 Ga0495620_0076661 Ga0495620_0076661_141_848 228
318 3300046518 Ga0495631_0027390 Ga0495631_0027390_1398_2105 228
319 3300046519 Ga0495632_0016211 Ga0495632_0016211_1794_2501 228
320 3300046520 Ga0495637_0001010 Ga0495637_0001010_15983_16690 228
321 3300046522 Ga0495643_0064576 Ga0495643_0064576_777_1484 228
322 3300046523 Ga0495644_0009266 Ga0495644_0009266_2948_3655 228
323 3300046524 Ga0495648_0087457 Ga0495648_0087457_639_1346 228
324 3300046530 Ga0495654_0028259 Ga0495654_0028259_511_1218 228
325 3300046542 Ga0495597_0034004 Ga0495597_0034004_634_1341 228
326 3300046615 Ga0495656_0047172 Ga0495656_0047172_920_1627 228
327 3300046616 Ga0495668_0000697 Ga0495668_0000697_17926_18633 228
328 3300046660 Ga0495625_0012607 Ga0495625_0012607_3826_4533 228
329 3300046665 Ga0495661_0026207 Ga0495661_0026207_964_1671 228
330 3300046691 Ga0495670_0021134 Ga0495670_0021134_1736_2443 228
331 3300046692 Ga0495671_0001827 Ga0495671_0001827_6365_7072 228
332 3300046692 Ga0495671_0032537 Ga0495671_0032537_1649_2356 228
333 3300046694 Ga0495649_0015410 Ga0495649_0015410_652_1359 228
334 3300046794 Ga0495589_0004100 Ga0495589_0004100_4970_5677 228
335 3300046810 Ga0495660_0025992 Ga0495660_0025992_964_1671 228
336 3300047323 Ga0495683_0040688 Ga0495683_0040688_1327_2034 228
337 3300047469 Ga0495673_0011808 Ga0495673_0011808_2752_3459 228
338 3300047470 Ga0495681_0006016 Ga0495681_0006016_1651_2358 228
339 3300047472 Ga0495686_0131044 Ga0495686_0131044_269_976 228
340 3300048091 Ga0495626_0000743 Ga0495626_0000743_11092_11799 228
341 3300048091 Ga0495626_0010123 Ga0495626_0010123_1900_2607 228
342 3300049459 Ga0495678_028289 Ga0495678_028289_409_1116 228
343 3300049460 Ga0495682_0017269 Ga0495682_0017269_589_1296 228
344 iso_pu_bacteria 2511231023 2511370714 228
345 iso_pu_bacteria 2738543025 2739314533 228
346 3300041411 Ga0439466_0043671 Ga0439466_0043671_16_723 229
347 3300042009 Ga0439451_002657 Ga0439451_002657_2742_3449 229
348 3300042016 Ga0439463_006138 Ga0439463_006138_1000_1707 229
349 3300042142 Ga0450905_006223 Ga0450905_006223_451_1158 229
350 3300046460 Ga0495638_0009384 Ga0495638_0009384_1741_2448 229
351 3300046501 Ga0495607_0026411 Ga0495607_0026411_2441_3148 229
352 3300047322 Ga0495680_0023665 Ga0495680_0023665_1022_1729 229
353 3300053125 Ga0500618_000160 Ga0500618_000160_44576_45277 229
354 3300005295 Ga0065707_10082259 Ga0065707_100822598 230
355 3300013306 Ga0163162_10132712 Ga0163162_101327123 230
356 3300021377 Ga0213874_10043111 Ga0213874_100431112 230
357 iso_pu_bacteria 2511231011 2511294230 230
358 iso_pu_bacteria 2784132063 2784262629 230
359 iso_pu_bacteria 2818991456 2819654292 230
360 iso_pu_bacteria 2852657418 2852660654 230
361 iso_pu_bacteria 2860339153 2860344470 230
362 iso_pu_bacteria 2880230671 2880235182 230
363 iso_pu_bacteria 2919456309 2919459588 230
364 iso_pu_bacteria 2931396565 2931397241 230
365 iso_pu_bacteria 3007619802 3007624418 230
366 iso_pu_bacteria 3007718800 3007723631 230
367 iso_pu_bacteria 8056172158 8056172646 230
368 iso_pu_bacteria 8056569372 8056574466 230
369 3300010375 Ga0105239_10006060 Ga0105239_100060603 231
370 3300046542 Ga0495597_0018671 Ga0495597_0018671_878_1573 231
371 iso_pu_bacteria 2511231012 2511304129 231
372 iso_pu_bacteria 2511231014 2511311800 231
373 iso_pu_bacteria 2511231016 2511326866 231
374 iso_pu_bacteria 2511231017 2511332677 231
375 iso_pu_bacteria 2511231018 2511336512 231
376 iso_pu_bacteria 2511231019 2511342167 231
377 iso_pu_bacteria 2511231020 2511350442 231
378 iso_pu_bacteria 2511231021 2511355701 231
379 iso_pu_bacteria 2643221565 2643844166 231
380 iso_pu_bacteria 2643221589 2643957414 231
381 iso_pu_bacteria 2643221602 2644021007 231
382 iso_pu_bacteria 2643221633 2644187985 231
383 iso_pu_bacteria 2738543004 2739200384 231
384 iso_pu_bacteria 2773857670 2774120695 231
385 iso_pu_bacteria 2784132072 2784313468 231
386 iso_pu_bacteria 2808606377 2808930306 231
387 iso_pu_bacteria 2808606381 2808952428 231
388 iso_pu_bacteria 2808606382 2808956771 231
389 iso_pu_bacteria 2904550169 2904551029 231
390 iso_pu_bacteria 2939636861 2939638202 231
391 iso_pu_bacteria 3007511990 3007512347 231
392 iso_pu_bacteria 8056155041 8056161152 231
393 3300025913 Ga0207695_10182065 Ga0207695_101820652 232
394 3300046452 Ga0495617_014849 Ga0495617_014849_1286_1984 232
395 3300046457 Ga0495590_0001702 Ga0495590_0001702_3962_4660 232
396 3300046458 Ga0495591_001438 Ga0495591_001438_7471_8169 232
397 3300046463 Ga0495653_0129698 Ga0495653_0129698_942_1640 232
398 3300046491 Ga0495584_0040890 Ga0495584_0040890_822_1520 232
399 3300046500 Ga0495596_0011040 Ga0495596_0011040_1485_2183 232
400 3300046501 Ga0495607_0016886 Ga0495607_0016886_317_1015 232
401 3300046501 Ga0495607_0106986 Ga0495607_0106986_90_788 232
402 3300046507 Ga0495606_0003866 Ga0495606_0003866_7542_8240 232
403 3300046515 Ga0495620_0018742 Ga0495620_0018742_964_1662 232
404 3300046518 Ga0495631_0004058 Ga0495631_0004058_4940_5638 232
405 3300046520 Ga0495637_0003055 Ga0495637_0003055_7307_8005 232
406 3300046520 Ga0495637_0004246 Ga0495637_0004246_5020_5718 232
407 3300046522 Ga0495643_0002096 Ga0495643_0002096_6855_7553 232
408 3300046524 Ga0495648_0003637 Ga0495648_0003637_4980_5678 232
409 3300046530 Ga0495654_0006254 Ga0495654_0006254_1201_1899 232
410 3300046530 Ga0495654_0032638 Ga0495654_0032638_1712_2410 232
411 3300046538 Ga0495609_0002148 Ga0495609_0002148_4963_5661 232
412 3300046616 Ga0495668_0002906 Ga0495668_0002906_4984_5682 232
413 3300046616 Ga0495668_0014366 Ga0495668_0014366_1703_2401 232
414 3300046665 Ga0495661_0030052 Ga0495661_0030052_270_968 232
415 3300046691 Ga0495670_0047465 Ga0495670_0047465_1077_1775 232
416 3300046694 Ga0495649_0003334 Ga0495649_0003334_1386_2084 232
417 3300046694 Ga0495649_0007116 Ga0495649_0007116_4341_5039 232
418 3300046694 Ga0495649_0013405 Ga0495649_0013405_2274_2972 232
419 3300047321 Ga0495676_0002299 Ga0495676_0002299_9273_9971 232
420 3300047470 Ga0495681_0002536 Ga0495681_0002536_7318_8016 232
421 3300047472 Ga0495686_0001742 Ga0495686_0001742_8271_8969 232
422 3300048091 Ga0495626_0005070 Ga0495626_0005070_5108_5806 232
423 3300048091 Ga0495626_0084653 Ga0495626_0084653_146_844 232
424 3300048919 Ga0496116_0000933 Ga0496116_0000933_7184_7882 232
425 3300049460 Ga0495682_0003117 Ga0495682_0003117_4870_5568 232
426 3300053722 Ga0500649_110500 Ga0500649_110500_68_766 232
427 iso_pu_bacteria 2599185352 2600195418 232
428 iso_pu_bacteria 2643221723 2644675976 232
429 iso_pu_bacteria 2738543013 2739249099 232
430 3300025933 Ga0207706_10530633 Ga0207706_105306331 233
431 iso_pu_bacteria 2738543015 2739258180 233
432 3300005288 Ga0065714_10006005 Ga0065714_100060052 234
433 3300005288 Ga0065714_10006190 Ga0065714_100061904 234
434 3300005288 Ga0065714_10219251 Ga0065714_102192511 234
435 3300005334 Ga0068869_100304418 Ga0068869_1003044182 234
436 3300005539 Ga0068853_100050532 Ga0068853_1000505321 234
437 3300005563 Ga0068855_100047798 Ga0068855_1000477985 234
438 3300005841 Ga0068863_100166241 Ga0068863_1001662412 234
439 3300006058 Ga0075432_10037346 Ga0075432_100373462 234
440 3300009011 Ga0105251_10106544 Ga0105251_101065442 234
441 3300009011 Ga0105251_10162947 Ga0105251_101629472 234
442 3300009036 Ga0105244_10000258 Ga0105244_1000025830 234
443 3300009092 Ga0105250_10001453 Ga0105250_1000145311 234
444 3300009148 Ga0105243_10000470 Ga0105243_1000047016 234
445 3300011119 Ga0105246_10000143 Ga0105246_1000014328 234
446 3300013100 Ga0157373_10020490 Ga0157373_100204902 234
447 3300013102 Ga0157371_10099648 Ga0157371_100996482 234
448 3300013104 Ga0157370_10034970 Ga0157370_100349705 234
449 3300013105 Ga0157369_11078490 Ga0157369_110784902 234
450 3300013307 Ga0157372_10000835 Ga0157372_1000083530 234
451 3300014497 Ga0182008_10001240 Ga0182008_1000124014 234
452 3300014497 Ga0182008_10043373 Ga0182008_100433732 234
453 3300015261 Ga0182006_1008459 Ga0182006_10084592 234
454 3300015265 Ga0182005_1004938 Ga0182005_10049382 234
455 3300015265 Ga0182005_1012164 Ga0182005_10121642 234
456 3300017792 Ga0163161_10003639 Ga0163161_100036397 234
457 3300017792 Ga0163161_10013049 Ga0163161_100130492 234
458 3300017792 Ga0163161_10104523 Ga0163161_101045233 234
459 3300025230 Ga0209563_101369 Ga0209563_1013693 234
460 3300025261 Ga0209233_1000247 Ga0209233_100024763 234
461 3300025711 Ga0207696_1000314 Ga0207696_100031435 234
462 3300025728 Ga0207655_1000507 Ga0207655_100050728 234
463 3300025728 Ga0207655_1005126 Ga0207655_10051263 234
464 3300025735 Ga0207713_1008162 Ga0207713_10081626 234
465 3300025735 Ga0207713_1023383 Ga0207713_10233834 234
466 3300025933 Ga0207706_10002502 Ga0207706_1000250213 234
467 3300025935 Ga0207709_10000013 Ga0207709_10000013487 234
468 3300025935 Ga0207709_10332646 Ga0207709_103326462 234
469 3300025961 Ga0207712_10081768 Ga0207712_100817683 234
470 3300026088 Ga0207641_10094771 Ga0207641_100947712 234
471 3300041405 Ga0439438_008801 Ga0439438_008801_982_1686 234
472 3300041411 Ga0439466_0022871 Ga0439466_0022871_121_825 234
473 3300042010 Ga0439452_000088 Ga0439452_000088_27710_28414 234
474 3300042137 Ga0450902_000295 Ga0450902_000295_2814_3518 234
475 3300042142 Ga0450905_009120 Ga0450905_009120_145_849 234
476 3300046452 Ga0495617_002384 Ga0495617_002384_4930_5634 234
477 3300046452 Ga0495617_063308 Ga0495617_063308_389_1093 234
478 3300046453 Ga0495627_022384 Ga0495627_022384_164_868 234
479 3300046454 Ga0495592_0007651 Ga0495592_0007651_1068_1772 234
480 3300046455 Ga0495603_0002816 Ga0495603_0002816_6727_7431 234
481 3300046457 Ga0495590_0002627 Ga0495590_0002627_4935_5639 234
482 3300046458 Ga0495591_017788 Ga0495591_017788_1338_2042 234
483 3300046460 Ga0495638_0000731 Ga0495638_0000731_19671_20375 234
484 3300046460 Ga0495638_0004614 Ga0495638_0004614_4366_5070 234
485 3300046460 Ga0495638_0009876 Ga0495638_0009876_1603_2307 234
486 3300046460 Ga0495638_0017066 Ga0495638_0017066_2166_2870 234
487 3300046463 Ga0495653_0001949 Ga0495653_0001949_7269_7973 234
488 3300046471 Ga0495650_0006486 Ga0495650_0006486_865_1569 234
489 3300046471 Ga0495650_0010259 Ga0495650_0010259_4009_4713 234
490 3300046472 Ga0495580_0161830 Ga0495580_0161830_460_1164 234
491 3300046474 Ga0495605_0003051 Ga0495605_0003051_5802_6506 234
492 3300046474 Ga0495605_0011764 Ga0495605_0011764_240_944 234
493 3300046491 Ga0495584_0006042 Ga0495584_0006042_4282_4986 234
494 3300046491 Ga0495584_0006917 Ga0495584_0006917_2163_2867 234
495 3300046491 Ga0495584_0126713 Ga0495584_0126713_166_870 234
496 3300046492 Ga0495585_0000109 Ga0495585_0000109_53422_54126 234
497 3300046501 Ga0495607_0004257 Ga0495607_0004257_7764_8468 234
498 3300046501 Ga0495607_0012663 Ga0495607_0012663_2942_3646 234
499 3300046507 Ga0495606_0001346 Ga0495606_0001346_5494_6198 234
500 3300046507 Ga0495606_0046016 Ga0495606_0046016_2129_2833 234
501 3300046512 Ga0495610_0006830 Ga0495610_0006830_2024_2728 234
502 3300046512 Ga0495610_0008006 Ga0495610_0008006_5984_6688 234
503 3300046512 Ga0495610_0083372 Ga0495610_0083372_580_1284 234
504 3300046513 Ga0495616_0001338 Ga0495616_0001338_7713_8417 234
505 3300046513 Ga0495616_0005091 Ga0495616_0005091_7232_7936 234
506 3300046515 Ga0495620_0001672 Ga0495620_0001672_7757_8461 234
507 3300046515 Ga0495620_0006353 Ga0495620_0006353_5776_6480 234
508 3300046518 Ga0495631_0000344 Ga0495631_0000344_8075_8779 234
509 3300046518 Ga0495631_0013421 Ga0495631_0013421_2744_3448 234
510 3300046519 Ga0495632_0009138 Ga0495632_0009138_866_1570 234
511 3300046520 Ga0495637_0048390 Ga0495637_0048390_777_1481 234
512 3300046520 Ga0495637_0056203 Ga0495637_0056203_686_1390 234
513 3300046520 Ga0495637_0058915 Ga0495637_0058915_470_1174 234
514 3300046523 Ga0495644_0004511 Ga0495644_0004511_1897_2601 234
515 3300046526 Ga0495666_0004747 Ga0495666_0004747_1030_1734 234
516 3300046526 Ga0495666_0017363 Ga0495666_0017363_900_1604 234
517 3300046530 Ga0495654_0000760 Ga0495654_0000760_18470_19174 234
518 3300046530 Ga0495654_0002105 Ga0495654_0002105_4536_5240 234
519 3300046536 Ga0495587_0020659 Ga0495587_0020659_252_956 234
520 3300046543 Ga0495645_0014749 Ga0495645_0014749_3581_4285 234
521 3300046557 Ga0495622_0215248 Ga0495622_0215248_137_841 234
522 3300046558 Ga0495633_0002761 Ga0495633_0002761_6567_7271 234
523 3300046558 Ga0495633_0102832 Ga0495633_0102832_352_1056 234
524 3300046642 Ga0495634_0004821 Ga0495634_0004821_4941_5645 234
525 3300046660 Ga0495625_0004485 Ga0495625_0004485_7777_8481 234
526 3300046660 Ga0495625_0005441 Ga0495625_0005441_2499_3203 234
527 3300046660 Ga0495625_0055442 Ga0495625_0055442_2022_2726 234
528 3300046665 Ga0495661_0066825 Ga0495661_0066825_695_1399 234
529 3300046665 Ga0495661_0249856 Ga0495661_0249856_73_777 234
530 3300046674 Ga0495588_0101860 Ga0495588_0101860_613_1317 234
531 3300046680 Ga0495646_0040740 Ga0495646_0040740_1380_2084 234
532 3300046689 Ga0495613_0007882 Ga0495613_0007882_2292_2996 234
533 3300046689 Ga0495613_0047327 Ga0495613_0047327_1892_2596 234
534 3300046690 Ga0495624_0001015 Ga0495624_0001015_14258_14962 234
535 3300046691 Ga0495670_0113564 Ga0495670_0113564_682_1386 234
536 3300046692 Ga0495671_0000840 Ga0495671_0000840_19186_19890 234
537 3300046692 Ga0495671_0004353 Ga0495671_0004353_4291_5007 234
538 3300046692 Ga0495671_0027474 Ga0495671_0027474_716_1420 234
539 3300046694 Ga0495649_0021234 Ga0495649_0021234_1549_2253 234
540 3300046794 Ga0495589_0107238 Ga0495589_0107238_202_906 234
541 3300046810 Ga0495660_0004332 Ga0495660_0004332_3837_4541 234
542 3300046810 Ga0495660_0009878 Ga0495660_0009878_4263_4967 234
543 3300046810 Ga0495660_0014159 Ga0495660_0014159_2656_3360 234
544 3300046810 Ga0495660_0093562 Ga0495660_0093562_586_1290 234
545 3300047317 Ga0495604_0336079 Ga0495604_0336079_96_800 234
546 3300047321 Ga0495676_0001538 Ga0495676_0001538_4993_5697 234
547 3300047323 Ga0495683_0000613 Ga0495683_0000613_18190_18894 234
548 3300047444 Ga0495675_0007288 Ga0495675_0007288_5589_6293 234
549 3300047444 Ga0495675_0139673 Ga0495675_0139673_175_879 234
550 3300047446 Ga0495679_004734 Ga0495679_004734_3271_3975 234
551 3300047469 Ga0495673_0000860 Ga0495673_0000860_18649_19353 234
552 3300047469 Ga0495673_0000992 Ga0495673_0000992_21453_22157 234
553 3300047469 Ga0495673_0059246 Ga0495673_0059246_647_1351 234
554 3300047470 Ga0495681_0005304 Ga0495681_0005304_5760_6464 234
555 3300047470 Ga0495681_0008159 Ga0495681_0008159_2171_2875 234
556 3300047470 Ga0495681_0009808 Ga0495681_0009808_785_1489 234
557 3300047471 Ga0495684_0004420 Ga0495684_0004420_3050_3754 234
558 3300048088 Ga0495602_0001390 Ga0495602_0001390_7269_7973 234
559 3300048091 Ga0495626_0000639 Ga0495626_0000639_5760_6464 234
560 3300048919 Ga0496116_0003065 Ga0496116_0003065_8933_9637 234
561 3300048920 Ga0496117_0006299 Ga0496117_0006299_10877_11581 234
562 3300048920 Ga0496117_0034336 Ga0496117_0034336_2624_3328 234
563 3300048921 Ga0496118_0003729 Ga0496118_0003729_7254_7958 234
564 3300048921 Ga0496118_0033675 Ga0496118_0033675_2119_2823 234
565 3300048922 Ga0496119_0035991 Ga0496119_0035991_1912_2616 234
566 3300048922 Ga0496119_0100699 Ga0496119_0100699_595_1299 234
567 3300048923 Ga0496120_0070593 Ga0496120_0070593_596_1300 234
568 3300048923 Ga0496120_0070661 Ga0496120_0070661_621_1325 234
569 3300048924 Ga0496121_0014272 Ga0496121_0014272_6599_7303 234
570 3300048924 Ga0496121_0029884 Ga0496121_0029884_2001_2705 234
571 3300048925 Ga0496122_0113380 Ga0496122_0113380_299_1003 234
572 3300048926 Ga0496123_0053751 Ga0496123_0053751_1652_2356 234
573 3300048926 Ga0496123_0122548 Ga0496123_0122548_78_782 234
574 3300048927 Ga0496124_0002468 Ga0496124_0002468_23385_24089 234
575 3300048927 Ga0496124_0044319 Ga0496124_0044319_3078_3782 234
576 3300048927 Ga0496124_0141907 Ga0496124_0141907_98_802 234
577 3300048927 Ga0496124_0234670 Ga0496124_0234670_36_740 234
578 3300048928 Ga0496125_0005055 Ga0496125_0005055_9126_9830 234
579 3300048928 Ga0496125_0120659 Ga0496125_0120659_1136_1840 234
580 3300049459 Ga0495678_006096 Ga0495678_006096_5682_6386 234
581 3300002737 JGI25162J39368_1000308 JGI25162J39368_100030839 235
582 3300002771 JGI25163J39215_1000322 JGI25163J39215_100032210 235
583 3300002772 JGI25164J39214_1000226 JGI25164J39214_100022639 235
584 3300003214 JGI25165J46597_1000421 JGI25165J46597_10004217 235
585 3300005288 Ga0065714_10099573 Ga0065714_100995733 235
586 3300005289 Ga0065704_10303744 Ga0065704_103037441 235
587 3300005290 Ga0065712_10005057 Ga0065712_100050573 235
588 3300005293 Ga0065715_10185710 Ga0065715_101857102 235
589 3300006051 Ga0075364_10074166 Ga0075364_100741662 235
590 3300006058 Ga0075432_10041460 Ga0075432_100414602 235
591 3300006177 Ga0075362_10018866 Ga0075362_100188662 235
592 3300006914 Ga0075436_100221839 Ga0075436_1002218392 235
593 3300009011 Ga0105251_10007840 Ga0105251_100078404 235
594 3300015265 Ga0182005_1003223 Ga0182005_10032236 235
595 3300015265 Ga0182005_1082587 Ga0182005_10825872 235
596 3300017792 Ga0163161_10017064 Ga0163161_100170645 235
597 3300025207 Ga0209760_100071 Ga0209760_10007146 235
598 3300025231 Ga0207427_100038 Ga0207427_100038157 235
599 3300025233 Ga0209437_100009 Ga0209437_100009784 235
600 3300025261 Ga0209233_1000074 Ga0209233_1000074157 235
601 3300025711 Ga0207696_1005947 Ga0207696_10059472 235
602 3300025728 Ga0207655_1015559 Ga0207655_10155592 235
603 3300025735 Ga0207713_1016342 Ga0207713_10163424 235
604 3300027907 Ga0207428_10243260 Ga0207428_102432602 235
605 3300041405 Ga0439438_001123 Ga0439438_001123_6562_7269 235
606 3300041405 Ga0439438_045736 Ga0439438_045736_100_807 235
607 3300041407 Ga0439447_001478 Ga0439447_001478_4646_5353 235
608 3300041407 Ga0439447_022633 Ga0439447_022633_260_967 235
609 3300041411 Ga0439466_0001294 Ga0439466_0001294_4902_5609 235
610 3300041413 Ga0439465_0000546 Ga0439465_0000546_4774_5481 235
611 3300042006 Ga0439432_000782 Ga0439432_000782_4658_5365 235
612 3300042006 Ga0439432_003487 Ga0439432_003487_2289_2996 235
613 3300042009 Ga0439451_002619 Ga0439451_002619_634_1341 235
614 3300042010 Ga0439452_001595 Ga0439452_001595_4646_5353 235
615 3300042013 Ga0439456_000254 Ga0439456_000254_6437_7144 235
616 3300042016 Ga0439463_001566 Ga0439463_001566_4646_5353 235
617 3300042016 Ga0439463_007416 Ga0439463_007416_189_896 235
618 3300042115 Ga0450911_000702 Ga0450911_000702_2221_2928 235
619 3300042115 Ga0450911_001026 Ga0450911_001026_6090_6797 235
620 3300042121 Ga0450919_000029 Ga0450919_000029_6611_7318 235
621 3300042124 Ga0450922_000501 Ga0450922_000501_1487_2194 235
622 3300042138 Ga0450903_003225 Ga0450903_003225_842_1549 235
623 3300042138 Ga0450903_005390 Ga0450903_005390_673_1380 235
624 3300042138 Ga0450903_011523 Ga0450903_011523_91_798 235
625 3300042145 Ga0450906_000380 Ga0450906_000380_3194_3901 235
626 3300042145 Ga0450906_032654 Ga0450906_032654_43_750 235
627 3300042146 Ga0450907_000237 Ga0450907_000237_7754_8461 235
628 3300042146 Ga0450907_000706 Ga0450907_000706_4113_4820 235
629 3300042147 Ga0450910_000414 Ga0450910_000414_3364_4071 235
630 3300042156 Ga0439446_0000263 Ga0439446_0000263_5471_6178 235
631 3300042156 Ga0439446_0002381 Ga0439446_0002381_3777_4484 235
632 3300042184 Ga0450908_000191 Ga0450908_000191_5303_6010 235
633 3300042185 Ga0450909_000212 Ga0450909_000212_5535_6242 235
634 3300042435 Ga0439434_0000182 Ga0439434_0000182_6144_6851 235
635 3300042435 Ga0439434_0022230 Ga0439434_0022230_79_786 235
636 3300042439 Ga0439464_0008039 Ga0439464_0008039_1509_2216 235
637 3300042461 Ga0439460_0000352 Ga0439460_0000352_4882_5589 235
638 3300042532 Ga0450893_0000458 Ga0450893_0000458_3733_4440 235
639 3300042533 Ga0450901_002846 Ga0450901_002846_426_1133 235
640 3300042993 Ga0439440_0000666 Ga0439440_0000666_1206_1913 235
641 3300042993 Ga0439440_0005737 Ga0439440_0005737_182_889 235
642 3300046452 Ga0495617_013074 Ga0495617_013074_963_1670 235
643 3300046452 Ga0495617_028546 Ga0495617_028546_833_1540 235
644 3300046453 Ga0495627_001539 Ga0495627_001539_10971_11678 235
645 3300046453 Ga0495627_003660 Ga0495627_003660_2953_3660 235
646 3300046457 Ga0495590_0004532 Ga0495590_0004532_4342_5049 235
647 3300046457 Ga0495590_0007254 Ga0495590_0007254_1953_2660 235
648 3300046458 Ga0495591_016496 Ga0495591_016496_858_1565 235
649 3300046458 Ga0495591_019572 Ga0495591_019572_592_1299 235
650 3300046460 Ga0495638_0000582 Ga0495638_0000582_21526_22233 235
651 3300046460 Ga0495638_0016623 Ga0495638_0016623_3118_3825 235
652 3300046463 Ga0495653_0027719 Ga0495653_0027719_2419_3132 235
653 3300046471 Ga0495650_0001038 Ga0495650_0001038_17404_18111 235
654 3300046474 Ga0495605_0027845 Ga0495605_0027845_532_1239 235
655 3300046474 Ga0495605_0046686 Ga0495605_0046686_1373_2080 235
656 3300046474 Ga0495605_0046687 Ga0495605_0046687_48_755 235
657 3300046474 Ga0495605_0070379 Ga0495605_0070379_557_1264 235
658 3300046491 Ga0495584_0010793 Ga0495584_0010793_3736_4443 235
659 3300046491 Ga0495584_0014482 Ga0495584_0014482_916_1623 235
660 3300046492 Ga0495585_0018636 Ga0495585_0018636_477_1184 235
661 3300046492 Ga0495585_0222735 Ga0495585_0222735_95_802 235
662 3300046501 Ga0495607_0017159 Ga0495607_0017159_2059_2766 235
663 3300046501 Ga0495607_0043642 Ga0495607_0043642_376_1083 235
664 3300046501 Ga0495607_0154522 Ga0495607_0154522_150_857 235
665 3300046506 Ga0495583_0000743 Ga0495583_0000743_17965_18672 235
666 3300046506 Ga0495583_0181423 Ga0495583_0181423_107_814 235
667 3300046513 Ga0495616_0013147 Ga0495616_0013147_3367_4074 235
668 3300046513 Ga0495616_0026787 Ga0495616_0026787_1716_2423 235
669 3300046513 Ga0495616_0072597 Ga0495616_0072597_394_1101 235
670 3300046515 Ga0495620_0006550 Ga0495620_0006550_4973_5680 235
671 3300046517 Ga0495630_0032277 Ga0495630_0032277_2410_3123 235
672 3300046519 Ga0495632_0000378 Ga0495632_0000378_22284_22991 235
673 3300046519 Ga0495632_0021305 Ga0495632_0021305_2153_2860 235
674 3300046519 Ga0495632_0041170 Ga0495632_0041170_614_1321 235
675 3300046519 Ga0495632_0043470 Ga0495632_0043470_170_877 235
676 3300046520 Ga0495637_0002780 Ga0495637_0002780_4840_5547 235
677 3300046520 Ga0495637_0008973 Ga0495637_0008973_2603_3310 235
678 3300046520 Ga0495637_0036145 Ga0495637_0036145_858_1565 235
679 3300046520 Ga0495637_0086044 Ga0495637_0086044_431_1138 235
680 3300046522 Ga0495643_0052190 Ga0495643_0052190_885_1592 235
681 3300046523 Ga0495644_0000056 Ga0495644_0000056_25952_26659 235
682 3300046523 Ga0495644_0000146 Ga0495644_0000146_8905_9612 235
683 3300046523 Ga0495644_0085570 Ga0495644_0085570_449_1156 235
684 3300046524 Ga0495648_0043658 Ga0495648_0043658_960_1667 235
685 3300046528 Ga0495642_0000140 Ga0495642_0000140_19251_19958 235
686 3300046530 Ga0495654_0001744 Ga0495654_0001744_6305_7012 235
687 3300046530 Ga0495654_0021071 Ga0495654_0021071_859_1566 235
688 3300046530 Ga0495654_0122888 Ga0495654_0122888_215_922 235
689 3300046538 Ga0495609_0000812 Ga0495609_0000812_477_1184 235
690 3300046542 Ga0495597_0009856 Ga0495597_0009856_859_1566 235
691 3300046542 Ga0495597_0080221 Ga0495597_0080221_559_1266 235
692 3300046542 Ga0495597_0084099 Ga0495597_0084099_220_927 235
693 3300046557 Ga0495622_0011736 Ga0495622_0011736_2104_2817 235
694 3300046615 Ga0495656_0001074 Ga0495656_0001074_4572_5279 235
695 3300046616 Ga0495668_0006334 Ga0495668_0006334_3855_4562 235
696 3300046648 Ga0495611_0002700 Ga0495611_0002700_5272_5979 235
697 3300046660 Ga0495625_0159065 Ga0495625_0159065_638_1345 235
698 3300046664 Ga0495659_0001256 Ga0495659_0001256_2247_2954 235
699 3300046664 Ga0495659_0004730 Ga0495659_0004730_1376_2083 235
700 3300046665 Ga0495661_0009900 Ga0495661_0009900_1140_1847 235
701 3300046665 Ga0495661_0130351 Ga0495661_0130351_211_918 235
702 3300046678 Ga0495599_0363484 Ga0495599_0363484_97_810 235
703 3300046679 Ga0495623_0001659 Ga0495623_0001659_4507_5220 235
704 3300046684 Ga0495669_0000313 Ga0495669_0000313_13151_13858 235
705 3300046691 Ga0495670_0001013 Ga0495670_0001013_6252_6959 235
706 3300046691 Ga0495670_0002023 Ga0495670_0002023_121_828 235
707 3300046691 Ga0495670_0008875 Ga0495670_0008875_2018_2725 235
708 3300046692 Ga0495671_0010334 Ga0495671_0010334_178_885 235
709 3300046692 Ga0495671_0012325 Ga0495671_0012325_1828_2535 235
710 3300046694 Ga0495649_0001999 Ga0495649_0001999_9477_10184 235
711 3300046694 Ga0495649_0027806 Ga0495649_0027806_1648_2355 235
712 3300046694 Ga0495649_0059371 Ga0495649_0059371_192_899 235
713 3300046794 Ga0495589_0001664 Ga0495589_0001664_785_1492 235
714 3300046794 Ga0495589_0018420 Ga0495589_0018420_1937_2644 235
715 3300046810 Ga0495660_0038785 Ga0495660_0038785_1159_1866 235
716 3300046810 Ga0495660_0041669 Ga0495660_0041669_1208_1915 235
717 3300047317 Ga0495604_0080113 Ga0495604_0080113_1373_2086 235
718 3300047318 Ga0495636_0012176 Ga0495636_0012176_1566_2273 235
719 3300047320 Ga0495672_0010720 Ga0495672_0010720_3608_4315 235
720 3300047320 Ga0495672_0014576 Ga0495672_0014576_915_1622 235
721 3300047320 Ga0495672_0143906 Ga0495672_0143906_149_856 235
722 3300047322 Ga0495680_0038684 Ga0495680_0038684_1739_2452 235
723 3300047323 Ga0495683_0003248 Ga0495683_0003248_6277_6984 235
724 3300047323 Ga0495683_0004114 Ga0495683_0004114_6982_7689 235
725 3300047323 Ga0495683_0021947 Ga0495683_0021947_631_1338 235
726 3300047443 Ga0495687_002349 Ga0495687_002349_8515_9222 235
727 3300047444 Ga0495675_0020381 Ga0495675_0020381_1041_1754 235
728 3300047445 Ga0495677_0008612 Ga0495677_0008612_2603_3310 235
729 3300047446 Ga0495679_002497 Ga0495679_002497_8464_9171 235
730 3300047447 Ga0495685_088978 Ga0495685_088978_307_1014 235
731 3300047469 Ga0495673_0008415 Ga0495673_0008415_641_1348 235
732 3300047470 Ga0495681_0000298 Ga0495681_0000298_19164_19871 235
733 3300047470 Ga0495681_0000362 Ga0495681_0000362_25625_26332 235
734 3300047470 Ga0495681_0002556 Ga0495681_0002556_3158_3865 235
735 3300047470 Ga0495681_0021551 Ga0495681_0021551_2098_2805 235
736 3300048090 Ga0495615_0063703 Ga0495615_0063703_51_758 235
737 3300048091 Ga0495626_0090423 Ga0495626_0090423_452_1159 235
738 3300048091 Ga0495626_0094565 Ga0495626_0094565_107_814 235
739 3300048918 Ga0496115_0031228 Ga0496115_0031228_1668_2381 235
740 3300048927 Ga0496124_0004893 Ga0496124_0004893_13112_13819 235
741 3300048927 Ga0496124_0185568 Ga0496124_0185568_501_1208 235
742 3300049459 Ga0495678_004637 Ga0495678_004637_5583_6290 235
743 3300049459 Ga0495678_007631 Ga0495678_007631_551_1258 235
744 3300049460 Ga0495682_0014704 Ga0495682_0014704_1133_1840 235
745 3300049460 Ga0495682_0058660 Ga0495682_0058660_73_780 235
746 3300050489 nmdc:mga03683_8180_c1 nmdc:mga03683_8180_c1_394_1101 235
747 3300050491 nmdc:mga00v17_214197_c1 nmdc:mga00v17_214197_c1_183_890 235
748 3300050514 nmdc:mga08x19_51761_c1 nmdc:mga08x19_51761_c1_970_1677 235
749 3300041407 Ga0439447_004637 Ga0439447_004637_1682_2494 236
750 3300041411 Ga0439466_0001047 Ga0439466_0001047_3742_4554 236
751 3300042010 Ga0439452_001068 Ga0439452_001068_8340_9152 236
752 3300042124 Ga0450922_002651 Ga0450922_002651_405_1217 236
753 3300046524 Ga0495648_0000657 Ga0495648_0000657_22093_22806 237
754 3300046506 Ga0495583_0011208 Ga0495583_0011208_1653_2408 244
755 3300046810 Ga0495660_0004593 Ga0495660_0004593_2573_3328 244
756 3300041411 Ga0439466_0000673 Ga0439466_0000673_2222_2965 247
757 3300042006 Ga0439432_024001 Ga0439432_024001_1013_1756 247
758 3300042009 Ga0439451_001262 Ga0439451_001262_186_947 247
759 3300042010 Ga0439452_000686 Ga0439452_000686_7715_8458 247
760 3300042013 Ga0439456_051091 Ga0439456_051091_17_778 247
761 3300042185 Ga0450909_005425 Ga0450909_005425_595_1338 247
762 3300048915 Ga0496112_0339582 Ga0496112_0339582_522_1274 250
763 3300046475 Ga0495639_0006268 Ga0495639_0006268_3456_4211 251
764 3300046492 Ga0495585_0004649 Ga0495585_0004649_5711_6466 251
765 3300046499 Ga0495594_0019291 Ga0495594_0019291_717_1472 251
766 3300046517 Ga0495630_0006499 Ga0495630_0006499_1239_1994 251
767 3300046517 Ga0495630_0045849 Ga0495630_0045849_1620_2375 251
768 3300046536 Ga0495587_0010581 Ga0495587_0010581_984_1739 251
769 3300046543 Ga0495645_0043634 Ga0495645_0043634_964_1719 251
770 3300046642 Ga0495634_0062604 Ga0495634_0062604_1118_1873 251
771 3300046663 Ga0495635_0009906 Ga0495635_0009906_5401_6156 251
772 3300046674 Ga0495588_0079421 Ga0495588_0079421_583_1338 251
773 3300046680 Ga0495646_0003487 Ga0495646_0003487_2760_3515 251
774 3300046689 Ga0495613_0004886 Ga0495613_0004886_3845_4600 251
775 3300046809 Ga0495600_0084335 Ga0495600_0084335_1112_1867 251
776 3300047315 Ga0495581_0001346 Ga0495581_0001346_11898_12653 251
777 3300047317 Ga0495604_0001836 Ga0495604_0001836_4048_4803 251
778 3300047322 Ga0495680_0003229 Ga0495680_0003229_4127_4882 251
779 3300047322 Ga0495680_0013809 Ga0495680_0013809_2669_3424 251
780 3300047469 Ga0495673_0000857 Ga0495673_0000857_7968_8723 251
781 3300047673 Ga0495593_0004472 Ga0495593_0004472_5370_6125 251
782 3300047673 Ga0495593_0037894 Ga0495593_0037894_1809_2564 251
783 2124908027 MRS2a_Contig_742 MRS2a_00599500 252
784 2124908027 MRS2a_Contig_99 MRS2a_00822430 252
785 3300013306 Ga0163162_10722336 Ga0163162_107223362 252
786 3300042009 Ga0439451_001926 Ga0439451_001926_545_1357 252
787 3300042013 Ga0439456_001178 Ga0439456_001178_1173_1985 252
788 3300042461 Ga0439460_0055677 Ga0439460_0055677_174_986 252
789 3300046452 Ga0495617_002212 Ga0495617_002212_2768_3526 252
790 3300046475 Ga0495639_0048639 Ga0495639_0048639_720_1478 252
791 3300046492 Ga0495585_0006294 Ga0495585_0006294_3850_4608 252
792 3300046513 Ga0495616_0085177 Ga0495616_0085177_150_908 252
793 3300046524 Ga0495648_0105253 Ga0495648_0105253_384_1142 252
794 3300046542 Ga0495597_0002739 Ga0495597_0002739_4818_5576 252
795 3300046557 Ga0495622_0004150 Ga0495622_0004150_2053_2811 252
796 3300046648 Ga0495611_0008172 Ga0495611_0008172_190_948 252
797 3300046664 Ga0495659_0060421 Ga0495659_0060421_252_1010 252
798 3300046691 Ga0495670_0079547 Ga0495670_0079547_162_920 252
799 3300046692 Ga0495671_0001134 Ga0495671_0001134_5686_6444 252
800 3300046692 Ga0495671_0010138 Ga0495671_0010138_1533_2291 252
801 3300046810 Ga0495660_0006396 Ga0495660_0006396_2362_3120 252
802 3300047320 Ga0495672_0027509 Ga0495672_0027509_703_1461 252
803 3300047469 Ga0495673_0004073 Ga0495673_0004073_2310_3068 252
804 3300047469 Ga0495673_0013217 Ga0495673_0013217_1437_2195 252
805 3300047469 Ga0495673_0017866 Ga0495673_0017866_2218_2976 252
806 3300048913 Ga0496110_0339020 Ga0496110_0339020_477_1235 252
807 3300048927 Ga0496124_0442015 Ga0496124_0442015_15_773 252
808 3300048928 Ga0496125_0003643 Ga0496125_0003643_10717_11475 252
809 3300049460 Ga0495682_0004494 Ga0495682_0004494_3445_4203 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

99

225

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.858 62 203
3bqe-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (reduced form) 0.8575 67 203
3bqf-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) 0.8563 65 215
3bqg-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) 0.8543 67 213
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.8501 68 203
ID Description Score Start End Superfamily
af_A4HTE0_2_175_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8822 67 203 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8656 68 200 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8528 64 202 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8264 68 203 3.30.1060.10
af_Q5AD39_5_182_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8245 57 203 3.30.1060.10
ID Description Score Start End GO Terms
AF-Q6N2I0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9583 53 233 GO:0008113
GO:0033744
GO:0036211
AF-A0A2L1CRP3-F1-model_v4 deleted 0.9564 44 235
AF-A0A522GLU1-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9537 57 230 GO:0008113
GO:0033744
GO:0036211
AF-A0A4Q6EPI8-F1-model_v4 deleted 0.9531 42 230
AF-A0A2W5Q950-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9529 47 230 GO:0008113
GO:0033744
GO:0036211

Feature Viewer

pLDDT pTM Quality
82.35 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map