F481840

General Info

Members Datasets Scaffolds Average Seq Length
811 404 810 67

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_12045100|Ga0105245_120451002
Length 74
Sequence MSRGGKDMATGTVKWFNDDKGFGFITPDDSGKDLFVHHSAINANGYKSLAEGAKVSYDAEAGDKGPKAVNVTAL

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
127 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
128 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
129 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
130 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
131 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
146 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
149 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
257 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
258 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
262 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
265 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
266 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
267 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
268 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
269 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
270 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
271 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
272 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
362 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
363 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
391 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
392 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 7.15
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 7.03
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 5.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c028004 3300000041 Bacteria 523
2 ARCol0yngRDRAFT_1005103 3300000652 Unclassified 946
3 JGI24752J21851_1039726 3300001976 Bacteria 629
4 JGI24739J22299_10176951 3300001989 Bacteria 628
5 JGI24737J22298_10120012 3300001990 Bacteria 777
6 JGI24743J22301_10111487 3300001991 Bacteria 595
7 JGI24735J21928_10146789 3300002067 Bacteria 681
8 JGI24750J21931_1032661 3300002070 Bacteria 769
9 JGI24738J21930_10043036 3300002075 Bacteria 918
10 JGI24744J21845_10088344 3300002077 Bacteria 568
11 Ga0006759J45824_1009337 3300003163 Bacteria 559
12 Ga0006770J48903_1015579 3300003305 Bacteria 559
13 Ga0006777J48905_1007156 3300003308 Bacteria 568
14 rootH2_10173644 3300003320 Bacteria 1402
15 Ga0006781J51513_1005727 3300003568 Bacteria 570
16 Ga0007410J51695_1007933 3300003574 Bacteria 579
17 Ga0007410J51695_1070413 3300003574 Bacteria 524
18 Ga0007409J51694_1008940 3300003575 Bacteria 674
19 Ga0007416J51690_1009552 3300003577 Bacteria 770
20 Ga0007429J51699_1005706 3300003579 Bacteria 758
21 Ga0032354_1006874 3300003693 Bacteria 622
22 Ga0032354_1021963 3300003693 Bacteria 535
23 Ga0006780_1007240 3300003735 Bacteria 622
24 Ga0058863_10086156 3300004799 Bacteria 735
25 Ga0058861_10024356 3300004800 Bacteria 1442
26 Ga0058861_11947429 3300004800 Bacteria 675
27 Ga0058861_12055410 3300004800 Bacteria 556
28 Ga0058862_12747784 3300004803 Bacteria 803
29 Ga0070658_10103253 3300005327 Bacteria 2358
30 Ga0070658_11101661 3300005327 Bacteria 691
31 Ga0070683_100025174 3300005329 Bacteria 5341
32 Ga0070683_100029003 3300005329 Bacteria 5006
33 Ga0070683_100366571 3300005329 Bacteria 1372
34 Ga0070683_100946691 3300005329 Bacteria 826
35 Ga0070683_101255292 3300005329 Bacteria 712
36 Ga0070683_102220985 3300005329 Bacteria 527
37 Ga0070690_100209619 3300005330 Bacteria 1360
38 Ga0070690_100740480 3300005330 Bacteria 758
39 Ga0070670_100491451 3300005331 Bacteria 1091
40 Ga0068869_100131270 3300005334 Bacteria 1926
41 Ga0068869_101925432 3300005334 Bacteria 530
42 Ga0068869_102089018 3300005334 Bacteria 509
43 Ga0070666_10284923 3300005335 Bacteria 1175
44 Ga0070680_100009178 3300005336 Bacteria 7585
45 Ga0070680_100404398 3300005336 Bacteria 1164
46 Ga0070680_101121810 3300005336 Bacteria 680
47 Ga0070680_101571737 3300005336 Bacteria 570
48 Ga0070682_100013435 3300005337 Bacteria 4710
49 Ga0070682_100046836 3300005337 Bacteria 2685
50 Ga0070682_100047953 3300005337 Bacteria 2658
51 Ga0068868_100313688 3300005338 Unclassified 1335
52 Ga0068868_100741762 3300005338 Bacteria 882
53 Ga0070660_100062151 3300005339 Bacteria 2900
54 Ga0070689_100419091 3300005340 Bacteria 1134
55 Ga0070687_100050577 3300005343 Bacteria 2147
56 Ga0070661_100029696 3300005344 Bacteria 3947
57 Ga0070661_100458772 3300005344 Bacteria 1015
58 Ga0070661_100658155 3300005344 Bacteria 851
59 Ga0070661_100754912 3300005344 Bacteria 796
60 Ga0070692_10053130 3300005345 Bacteria 2112
61 Ga0070692_10065551 3300005345 Bacteria 1923
62 Ga0070692_10088816 3300005345 Bacteria 1677
63 Ga0070668_100148388 3300005347 Bacteria 1894
64 Ga0070669_100939135 3300005353 Bacteria 740
65 Ga0070675_100419253 3300005354 Bacteria 1197
66 Ga0070671_100234697 3300005355 Bacteria 1557
67 Ga0070671_101120267 3300005355 Bacteria 691
68 Ga0070674_101242586 3300005356 Bacteria 662
69 Ga0070673_100210805 3300005364 Bacteria 1678
70 Ga0070688_100081477 3300005365 Bacteria 2096
71 Ga0070659_100005205 3300005366 Bacteria 9336
72 Ga0070659_100062916 3300005366 Bacteria 2934
73 Ga0070659_100078511 3300005366 Bacteria 2633
74 Ga0070659_101540249 3300005366 Bacteria 593
75 Ga0070659_101934497 3300005366 Bacteria 529
76 Ga0070667_100289316 3300005367 Bacteria 1473
77 Ga0070667_101024455 3300005367 Bacteria 770
78 Ga0070714_100002604 3300005435 Bacteria 13295
79 Ga0070714_101415437 3300005435 Bacteria 679
80 Ga0070713_100330367 3300005436 Bacteria 1410
81 Ga0070710_10654659 3300005437 Bacteria 737
82 Ga0070701_10275998 3300005438 Bacteria 1025
83 Ga0070701_10406431 3300005438 Bacteria 864
84 Ga0070711_100079542 3300005439 Bacteria 2332
85 Ga0070711_100322223 3300005439 Unclassified 1235
86 Ga0070711_100853051 3300005439 Bacteria 775
87 Ga0070711_101297161 3300005439 Bacteria 632
88 Ga0070705_100434784 3300005440 Unclassified 980
89 Ga0070705_101553901 3300005440 Bacteria 556
90 Ga0070700_100375649 3300005441 Bacteria 1061
91 Ga0070700_100478003 3300005441 Bacteria 954
92 Ga0070700_100539675 3300005441 Bacteria 904
93 Ga0070700_100742285 3300005441 Bacteria 785
94 Ga0070663_100006400 3300005455 Bacteria 7081
95 Ga0070663_100851541 3300005455 Bacteria 785
96 Ga0070663_101167101 3300005455 Bacteria 675
97 Ga0070678_100511701 3300005456 Bacteria 1061
98 Ga0070678_101842352 3300005456 Bacteria 571
99 Ga0070662_101084174 3300005457 Bacteria 687
100 Ga0070662_101166461 3300005457 Bacteria 662
101 Ga0070681_10145576 3300005458 Bacteria 2298
102 Ga0070681_10560106 3300005458 Bacteria 1057
103 Ga0070681_11270119 3300005458 Bacteria 659
104 Ga0068867_100118120 3300005459 Bacteria 2045
105 Ga0068867_101653153 3300005459 Bacteria 600
106 Ga0070685_10185385 3300005466 Bacteria 1342
107 Ga0070706_100348118 3300005467 Bacteria 1381
108 Ga0070707_101753927 3300005468 Bacteria 588
109 Ga0070679_100026157 3300005530 Bacteria 5729
110 Ga0070679_100056108 3300005530 Bacteria 3924
111 Ga0070679_100402260 3300005530 Bacteria 1315
112 Ga0070684_100026063 3300005535 Bacteria 4920
113 Ga0070684_100075858 3300005535 Bacteria 2966
114 Ga0070684_100419587 3300005535 Bacteria 1235
115 Ga0070697_101401191 3300005536 Bacteria 624
116 Ga0068853_100064592 3300005539 Bacteria 3174
117 Ga0070672_100040675 3300005543 Bacteria 3568
118 Ga0070672_100311846 3300005543 Bacteria 1336
119 Ga0070686_100048872 3300005544 Bacteria 2682
120 Ga0070686_100533548 3300005544 Bacteria 915
121 Ga0070696_100341795 3300005546 Bacteria 1157
122 Ga0070696_101011553 3300005546 Bacteria 695
123 Ga0070696_101378053 3300005546 Bacteria 601
124 Ga0070693_100762898 3300005547 Bacteria 714
125 Ga0070693_100925773 3300005547 Bacteria 655
126 Ga0070665_100005382 3300005548 Bacteria 13218
127 Ga0070665_100164791 3300005548 Bacteria 2219
128 Ga0070665_101171359 3300005548 Bacteria 780
129 Ga0070704_100079527 3300005549 Bacteria 2409
130 Ga0070704_100259039 3300005549 Bacteria 1432
131 Ga0070704_100943971 3300005549 Bacteria 778
132 Ga0068855_100317450 3300005563 Bacteria 1723
133 Ga0068855_100739311 3300005563 Bacteria 1050
134 Ga0070664_100032412 3300005564 Bacteria 4370
135 Ga0070664_100506038 3300005564 Bacteria 1114
136 Ga0070664_100525023 3300005564 Bacteria 1093
137 Ga0068857_100073194 3300005577 Bacteria 3053
138 Ga0068857_101346251 3300005577 Bacteria 694
139 Ga0068857_102437117 3300005577 Bacteria 514
140 Ga0068854_100054326 3300005578 Bacteria 2880
141 Ga0068854_100197169 3300005578 Bacteria 1581
142 Ga0068854_100376455 3300005578 Bacteria 1169
143 Ga0068854_100485582 3300005578 Bacteria 1038
144 Ga0068856_100040528 3300005614 Bacteria 4576
145 Ga0068856_100054050 3300005614 Bacteria 3960
146 Ga0068856_100161677 3300005614 Bacteria 2250
147 Ga0070702_100005543 3300005615 Bacteria 5895
148 Ga0070702_100199352 3300005615 Bacteria 1324
149 Ga0068852_100002528 3300005616 Bacteria 12599
150 Ga0068852_100240582 3300005616 Bacteria 1729
151 Ga0068852_102411380 3300005616 Bacteria 547
152 Ga0068859_100722984 3300005617 Bacteria 1086
153 Ga0068864_100151139 3300005618 Bacteria 2103
154 Ga0068864_100907898 3300005618 Bacteria 870
155 Ga0068866_10103734 3300005718 Bacteria 1574
156 Ga0068866_10773972 3300005718 Bacteria 665
157 Ga0068866_11348211 3300005718 Bacteria 520
158 Ga0068861_100435847 3300005719 Bacteria 1171
159 Ga0068851_10314571 3300005834 Bacteria 903
160 Ga0068851_11066196 3300005834 Bacteria 512
161 Ga0068870_10084559 3300005840 Bacteria 1761
162 Ga0068863_101659012 3300005841 Bacteria 649
163 Ga0068858_100042042 3300005842 Bacteria 4237
164 Ga0068858_100490229 3300005842 Bacteria 1187
165 Ga0068860_101062020 3300005843 Bacteria 829
166 Ga0068860_101248419 3300005843 Bacteria 764
167 Ga0068860_101901347 3300005843 Bacteria 617
168 Ga0068862_100036198 3300005844 Bacteria 4183
169 Ga0068862_101270586 3300005844 Unclassified 737
170 Ga0081455_10062009 3300005937 Bacteria 3144
171 Ga0081455_10220635 3300005937 Bacteria 1405
172 Ga0081455_10229457 3300005937 Bacteria 1371
173 Ga0081455_10513489 3300005937 Bacteria 801
174 Ga0081538_10002285 3300005981 Bacteria 18925
175 Ga0081539_10009105 3300005985 Bacteria 8401
176 Ga0081539_10020386 3300005985 Bacteria 4484
177 Ga0081539_10218691 3300005985 Bacteria 868
178 Ga0081539_10435876 3300005985 Bacteria 543
179 Ga0070717_10013602 3300006028 Bacteria 6243
180 Ga0070717_10264087 3300006028 Bacteria 1523
181 Ga0070717_10364462 3300006028 Bacteria 1294
182 Ga0075365_10874710 3300006038 Bacteria 634
183 Ga0075363_100393107 3300006048 Bacteria 814
184 Ga0075364_10279860 3300006051 Bacteria 1135
185 Ga0075432_10348788 3300006058 Bacteria 627
186 Ga0070715_10234547 3300006163 Bacteria 951
187 Ga0070712_100040365 3300006175 Bacteria 3200
188 Ga0070712_100090701 3300006175 Bacteria 2238
189 Ga0070712_100152915 3300006175 Unclassified 1773
190 Ga0070712_100207020 3300006175 Bacteria 1545
191 Ga0070712_100552258 3300006175 Bacteria 970
192 Ga0070712_100873284 3300006175 Bacteria 774
193 Ga0070712_101875812 3300006175 Bacteria 525
194 Ga0097621_102050385 3300006237 Bacteria 547
195 Ga0068871_100301781 3300006358 Bacteria 1406
196 Ga0075428_100007826 3300006844 Bacteria 11845
197 Ga0075428_101404487 3300006844 Bacteria 733
198 Ga0075428_102103825 3300006844 Bacteria 584
199 Ga0075430_100686870 3300006846 Bacteria 844
200 Ga0075431_100914499 3300006847 Bacteria 847
201 Ga0075433_10267077 3300006852 Unclassified 1516
202 Ga0075433_10926550 3300006852 Bacteria 760
203 Ga0075433_11451899 3300006852 Bacteria 593
204 Ga0075433_11575123 3300006852 Bacteria 567
205 Ga0075434_100905870 3300006871 Bacteria 897
206 Ga0068865_100144646 3300006881 Bacteria 1797
207 Ga0097620_100723026 3300006931 Bacteria 1086
208 Ga0075435_101076346 3300007076 Bacteria 703
209 Ga0105250_10296314 3300009092 Bacteria 699
210 Ga0105240_10065467 3300009093 Bacteria 4512
211 Ga0105240_10542921 3300009093 Bacteria 1287
212 Ga0105240_10931442 3300009093 Bacteria 933
213 Ga0105240_11674293 3300009093 Bacteria 664
214 Ga0111539_10184773 3300009094 Bacteria 2435
215 Ga0111539_10217989 3300009094 Bacteria 2223
216 Ga0111539_10402244 3300009094 Bacteria 1595
217 Ga0111539_10552617 3300009094 Bacteria 1341
218 Ga0105245_10495140 3300009098 Bacteria 1238
219 Ga0105245_10560527 3300009098 Bacteria 1165
220 Ga0105245_10585998 3300009098 Bacteria 1140
221 Ga0105245_10625767 3300009098 Bacteria 1105
222 Ga0105245_11703325 3300009098 Bacteria 683
223 Ga0105245_12045100 3300009098 Bacteria 626
224 Ga0105247_10214320 3300009101 Bacteria 1300
225 Ga0114129_10381103 3300009147 Bacteria 1862
226 Ga0105243_10044918 3300009148 Bacteria 3469
227 Ga0105243_10174824 3300009148 Bacteria 1863
228 Ga0105243_10418111 3300009148 Bacteria 1249
229 Ga0105241_10917104 3300009174 Bacteria 814
230 Ga0105242_10210140 3300009176 Bacteria 1734
231 Ga0105242_10998434 3300009176 Bacteria 844
232 Ga0105242_11686467 3300009176 Bacteria 670
233 Ga0105248_10684395 3300009177 Bacteria 1157
234 Ga0105248_12048594 3300009177 Bacteria 650
235 Ga0105248_12233806 3300009177 Bacteria 623
236 Ga0105237_10088308 3300009545 Bacteria 3089
237 Ga0105237_10120564 3300009545 Bacteria 2617
238 Ga0105237_10736282 3300009545 Bacteria 992
239 Ga0105238_10020827 3300009551 Bacteria 6679
240 Ga0105238_10781069 3300009551 Bacteria 970
241 Ga0105238_10819065 3300009551 Bacteria 947
242 Ga0105249_10203210 3300009553 Bacteria 1940
243 Ga0105249_10211432 3300009553 Bacteria 1904
244 Ga0105249_11702719 3300009553 Bacteria 703
245 Ga0105249_12101419 3300009553 Bacteria 638
246 Ga0105249_12983364 3300009553 Bacteria 543
247 Ga0105239_10111552 3300010375 Bacteria 3032
248 Ga0105239_10621559 3300010375 Bacteria 1233
249 Ga0105239_11167630 3300010375 Bacteria 887
250 Ga0105239_13482531 3300010375 Bacteria 512
251 Ga0105246_10027459 3300011119 Bacteria 3729
252 Ga0105246_10170182 3300011119 Bacteria 1668
253 Ga0105246_10753653 3300011119 Bacteria 859
254 Ga0105246_11772598 3300011119 Bacteria 589
255 Ga0157320_1007222 3300012481 Bacteria 790
256 Ga0157337_1033561 3300012483 Bacteria 537
257 Ga0157321_1001289 3300012487 Unclassified 1251
258 Ga0157341_1014435 3300012494 Bacteria 717
259 Ga0157314_1005879 3300012500 Bacteria 945
260 Ga0157316_1001102 3300012510 Unclassified 1593
261 Ga0157371_10190198 3300013102 Bacteria 1469
262 Ga0157371_11182057 3300013102 Bacteria 589
263 Ga0157370_10212012 3300013104 Bacteria 1795
264 Ga0157369_12503444 3300013105 Bacteria 522
265 Ga0157374_10808412 3300013296 Bacteria 953
266 Ga0157378_10452082 3300013297 Bacteria 1275
267 Ga0163162_10097041 3300013306 Bacteria 3036
268 Ga0163162_10766286 3300013306 Bacteria 1084
269 Ga0163162_10862717 3300013306 Bacteria 1020
270 Ga0163162_11343259 3300013306 Bacteria 813
271 Ga0163162_11383608 3300013306 Bacteria 800
272 Ga0163162_11478242 3300013306 Bacteria 774
273 Ga0157372_10040300 3300013307 Bacteria 5158
274 Ga0157372_10569961 3300013307 Bacteria 1320
275 Ga0157372_12082466 3300013307 Bacteria 652
276 Ga0157372_12314821 3300013307 Bacteria 617
277 Ga0157372_12971660 3300013307 Bacteria 542
278 Ga0157375_10461886 3300013308 Bacteria 1435
279 Ga0157375_10850104 3300013308 Bacteria 1059
280 Ga0157375_12108423 3300013308 Bacteria 671
281 Ga0157375_13590201 3300013308 Bacteria 516
282 Ga0163163_10043188 3300014325 Bacteria 4419
283 Ga0163163_10078878 3300014325 Bacteria 3290
284 Ga0163163_10858482 3300014325 Bacteria 971
285 Ga0163163_11059568 3300014325 Bacteria 874
286 Ga0157380_10596324 3300014326 Bacteria 1092
287 Ga0157380_10745133 3300014326 Bacteria 990
288 Ga0157380_13474691 3300014326 Bacteria 504
289 Ga0182008_10161540 3300014497 Bacteria 1128
290 Ga0182008_10205933 3300014497 Bacteria 1002
291 Ga0182008_10414837 3300014497 Bacteria 726
292 Ga0157379_10005028 3300014968 Bacteria 11341
293 Ga0157379_10010528 3300014968 Bacteria 8062
294 Ga0157379_10260678 3300014968 Bacteria 1575
295 Ga0157379_10324024 3300014968 Bacteria 1407
296 Ga0157376_10478734 3300014969 Bacteria 1220
297 Ga0182006_1232934 3300015261 Bacteria 606
298 Ga0197907_10092187 3300020069 Bacteria 794
299 Ga0197907_10239788 3300020069 Bacteria 644
300 Ga0197907_10973848 3300020069 Bacteria 614
301 Ga0197907_11102414 3300020069 Bacteria 1131
302 Ga0206356_11646062 3300020070 Bacteria 1504
303 Ga0206355_1123530 3300020076 Bacteria 514
304 Ga0206355_1688314 3300020076 Bacteria 516
305 Ga0206352_10274325 3300020078 Bacteria 761
306 Ga0206350_11398817 3300020080 Bacteria 558
307 Ga0206354_10523478 3300020081 Bacteria 615
308 Ga0206354_11018118 3300020081 Bacteria 628
309 Ga0206354_11697946 3300020081 Bacteria 538
310 Ga0206353_10172718 3300020082 Bacteria 658
311 Ga0206353_10378576 3300020082 Bacteria 816
312 Ga0206353_11084932 3300020082 Bacteria 756
313 Ga0206353_11499693 3300020082 Bacteria 595
314 Ga0206353_11826723 3300020082 Bacteria 2055
315 Ga0154015_1534401 3300020610 Bacteria 742
316 Ga0213876_10031767 3300021384 Bacteria 2785
317 Ga0213876_10037964 3300021384 Bacteria 2541
318 Ga0213876_10145291 3300021384 Unclassified 1261
319 Ga0213876_10230597 3300021384 Bacteria 984
320 Ga0213875_10394599 3300021388 Bacteria 659
321 Ga0213875_10433333 3300021388 Bacteria 628
322 Ga0213875_10627677 3300021388 Unclassified 520
323 Ga0224712_10076530 3300022467 Bacteria 1371
324 Ga0224712_10449919 3300022467 Bacteria 618
325 Ga0224712_10667780 3300022467 Bacteria 510
326 Ga0247553_110050 3300023672 Bacteria 541
327 Ga0224572_1019933 3300024225 Bacteria 1288
328 Ga0207692_10011924 3300025898 Bacteria 3719
329 Ga0207692_11013671 3300025898 Bacteria 548
330 Ga0207642_10172657 3300025899 Bacteria 1171
331 Ga0207642_10537377 3300025899 Bacteria 720
332 Ga0207710_10124959 3300025900 Bacteria 1232
333 Ga0207688_10003660 3300025901 Bacteria 8395
334 Ga0207680_10032628 3300025903 Bacteria 2962
335 Ga0207680_10138418 3300025903 Bacteria 1612
336 Ga0207680_10858332 3300025903 Bacteria 651
337 Ga0207647_10242412 3300025904 Bacteria 1035
338 Ga0207699_11457374 3300025906 Bacteria 506
339 Ga0207643_10019178 3300025908 Bacteria 3747
340 Ga0207643_10290889 3300025908 Bacteria 1015
341 Ga0207705_10610596 3300025909 Bacteria 848
342 Ga0207705_10647338 3300025909 Bacteria 822
343 Ga0207705_10891066 3300025909 Bacteria 689
344 Ga0207654_10415930 3300025911 Bacteria 937
345 Ga0207707_10032934 3300025912 Bacteria 4536
346 Ga0207707_10444550 3300025912 Bacteria 1110
347 Ga0207707_11056780 3300025912 Bacteria 664
348 Ga0207695_10158233 3300025913 Bacteria 2199
349 Ga0207695_11227611 3300025913 Bacteria 630
350 Ga0207671_10056406 3300025914 Bacteria 2911
351 Ga0207671_10578605 3300025914 Bacteria 895
352 Ga0207671_10634694 3300025914 Bacteria 851
353 Ga0207671_10757848 3300025914 Bacteria 771
354 Ga0207693_10109594 3300025915 Bacteria 2165
355 Ga0207693_10127483 3300025915 Bacteria 2001
356 Ga0207693_10248343 3300025915 Bacteria 1396
357 Ga0207693_10314872 3300025915 Bacteria 1225
358 Ga0207693_10323124 3300025915 Unclassified 1208
359 Ga0207693_11075797 3300025915 Bacteria 612
360 Ga0207663_10305387 3300025916 Unclassified 1190
361 Ga0207663_10857561 3300025916 Bacteria 725
362 Ga0207663_11363796 3300025916 Bacteria 571
363 Ga0207660_10007525 3300025917 Bacteria 7050
364 Ga0207660_10158944 3300025917 Bacteria 1742
365 Ga0207660_10944957 3300025917 Bacteria 703
366 Ga0207660_11372464 3300025917 Bacteria 573
367 Ga0207662_10146599 3300025918 Bacteria 1499
368 Ga0207657_10027381 3300025919 Bacteria 5221
369 Ga0207657_10134714 3300025919 Bacteria 2022
370 Ga0207649_10029488 3300025920 Bacteria 3240
371 Ga0207649_10419488 3300025920 Bacteria 1005
372 Ga0207649_10505660 3300025920 Bacteria 919
373 Ga0207649_11284417 3300025920 Bacteria 579
374 Ga0207652_10003131 3300025921 Bacteria 13793
375 Ga0207652_10032286 3300025921 Bacteria 4399
376 Ga0207652_10058819 3300025921 Bacteria 3312
377 Ga0207652_10762269 3300025921 Bacteria 861
378 Ga0207681_10249412 3300025923 Bacteria 1385
379 Ga0207681_10813039 3300025923 Bacteria 781
380 Ga0207694_10042276 3300025924 Bacteria 3515
381 Ga0207694_10485036 3300025924 Bacteria 1034
382 Ga0207650_10658635 3300025925 Bacteria 883
383 Ga0207659_10902917 3300025926 Bacteria 759
384 Ga0207687_10571439 3300025927 Bacteria 950
385 Ga0207687_11262171 3300025927 Bacteria 635
386 Ga0207687_11263772 3300025927 Bacteria 635
387 Ga0207687_11658149 3300025927 Bacteria 548
388 Ga0207700_10904365 3300025928 Bacteria 790
389 Ga0207700_11007578 3300025928 Bacteria 745
390 Ga0207700_11029220 3300025928 Bacteria 737
391 Ga0207700_11486110 3300025928 Bacteria 601
392 Ga0207664_10006553 3300025929 Bacteria 8020
393 Ga0207664_10323760 3300025929 Bacteria 1360
394 Ga0207664_11084752 3300025929 Bacteria 716
395 Ga0207644_10154217 3300025931 Bacteria 1780
396 Ga0207644_10924766 3300025931 Bacteria 731
397 Ga0207690_10041521 3300025932 Bacteria 3015
398 Ga0207690_10120307 3300025932 Bacteria 1906
399 Ga0207690_10123871 3300025932 Bacteria 1882
400 Ga0207706_10320690 3300025933 Bacteria 1349
401 Ga0207706_10386689 3300025933 Bacteria 1214
402 Ga0207686_10313043 3300025934 Bacteria 1170
403 Ga0207686_10489907 3300025934 Bacteria 952
404 Ga0207686_10599848 3300025934 Bacteria 866
405 Ga0207686_10855341 3300025934 Bacteria 732
406 Ga0207686_10872660 3300025934 Bacteria 725
407 Ga0207709_10053930 3300025935 Bacteria 2476
408 Ga0207709_10068603 3300025935 Bacteria 2242
409 Ga0207709_10389008 3300025935 Bacteria 1063
410 Ga0207709_10671910 3300025935 Bacteria 826
411 Ga0207670_10036264 3300025936 Bacteria 3205
412 Ga0207704_10856106 3300025938 Bacteria 762
413 Ga0207704_11325229 3300025938 Bacteria 616
414 Ga0207691_10052766 3300025940 Bacteria 3713
415 Ga0207691_10919030 3300025940 Bacteria 732
416 Ga0207711_11824410 3300025941 Bacteria 551
417 Ga0207711_12051244 3300025941 Bacteria 515
418 Ga0207689_10025277 3300025942 Bacteria 4976
419 Ga0207689_10547656 3300025942 Bacteria 972
420 Ga0207661_10025325 3300025944 Bacteria 4507
421 Ga0207661_10313609 3300025944 Bacteria 1408
422 Ga0207661_10322800 3300025944 Bacteria 1388
423 Ga0207661_11673634 3300025944 Bacteria 581
424 Ga0207661_11862409 3300025944 Bacteria 547
425 Ga0207679_10552579 3300025945 Bacteria 1033
426 Ga0207679_10778668 3300025945 Bacteria 871
427 Ga0207679_12153407 3300025945 Bacteria 506
428 Ga0207667_10742754 3300025949 Bacteria 981
429 Ga0207667_10834386 3300025949 Bacteria 917
430 Ga0207651_10275786 3300025960 Bacteria 1387
431 Ga0207712_10174163 3300025961 Bacteria 1685
432 Ga0207712_10982705 3300025961 Bacteria 748
433 Ga0207712_11004610 3300025961 Bacteria 740
434 Ga0207668_10788565 3300025972 Bacteria 840
435 Ga0207640_10741274 3300025981 Bacteria 846
436 Ga0207640_10750854 3300025981 Bacteria 841
437 Ga0207658_10024718 3300025986 Bacteria 4203
438 Ga0207658_11562399 3300025986 Bacteria 603
439 Ga0207677_10190089 3300026023 Bacteria 1623
440 Ga0207677_10301622 3300026023 Unclassified 1323
441 Ga0207703_10116619 3300026035 Bacteria 2286
442 Ga0207703_11152083 3300026035 Bacteria 745
443 Ga0207639_11072401 3300026041 Bacteria 755
444 Ga0207678_10460419 3300026067 Bacteria 1106
445 Ga0207678_10817585 3300026067 Bacteria 823
446 Ga0207678_11323441 3300026067 Bacteria 637
447 Ga0207708_10160247 3300026075 Bacteria 1776
448 Ga0207708_11049557 3300026075 Bacteria 709
449 Ga0207702_10014101 3300026078 Bacteria 6636
450 Ga0207702_10901435 3300026078 Bacteria 876
451 Ga0207702_11241220 3300026078 Bacteria 739
452 Ga0207641_11386158 3300026088 Bacteria 704
453 Ga0207641_12607761 3300026088 Bacteria 503
454 Ga0207648_10092311 3300026089 Bacteria 2647
455 Ga0207648_10313114 3300026089 Bacteria 1409
456 Ga0207648_10369901 3300026089 Bacteria 1295
457 Ga0207648_11014940 3300026089 Bacteria 777
458 Ga0207676_10032636 3300026095 Bacteria 3926
459 Ga0207676_11485874 3300026095 Bacteria 674
460 Ga0207674_10040431 3300026116 Bacteria 4830
461 Ga0207674_10489005 3300026116 Bacteria 1189
462 Ga0207674_10614215 3300026116 Bacteria 1050
463 Ga0207674_10945240 3300026116 Bacteria 830
464 Ga0207674_11671768 3300026116 Bacteria 605
465 Ga0207675_100276286 3300026118 Bacteria 1631
466 Ga0207675_100986012 3300026118 Bacteria 861
467 Ga0207675_102447775 3300026118 Bacteria 534
468 Ga0207683_10413477 3300026121 Bacteria 1242
469 Ga0207683_11521360 3300026121 Bacteria 618
470 Ga0207698_10028653 3300026142 Bacteria 3975
471 Ga0207698_10324984 3300026142 Bacteria 1442
472 Ga0209974_10241200 3300027876 Bacteria 678
473 Ga0207428_10111641 3300027907 Bacteria 2103
474 Ga0207428_10284171 3300027907 Bacteria 1227
475 Ga0207428_10727435 3300027907 Unclassified 708
476 Ga0268266_10000715 3300028379 Bacteria 44804
477 Ga0268266_10130480 3300028379 Bacteria 2247
478 Ga0268265_10052448 3300028380 Bacteria 3085
479 Ga0268265_10518935 3300028380 Unclassified 1126
480 Ga0268264_10953111 3300028381 Bacteria 863
481 Ga0268264_11516921 3300028381 Bacteria 681
482 Ga0265338_10327162 3300028800 Bacteria 1108
483 Ga0265338_10441942 3300028800 Bacteria 922
484 Ga0265762_1162632 3300030760 Bacteria 539
485 Ga0265767_106388 3300030836 Bacteria 734
486 Ga0265766_1007124 3300030863 Bacteria 746
487 Ga0307408_101303121 3300031548 Bacteria 681
488 Ga0307408_102524544 3300031548 Bacteria 500
489 Ga0316576_10025487 3300031727 Bacteria 4141
490 Ga0316576_10499256 3300031727 Bacteria 895
491 Ga0307406_10338782 3300031901 Bacteria 1171
492 Ga0307406_11625360 3300031901 Bacteria 571
493 Ga0307409_100615760 3300031995 Bacteria 1075
494 Ga0307409_100749340 3300031995 Bacteria 980
495 Ga0307416_101191273 3300032002 Bacteria 867
496 Ga0307416_101278187 3300032002 Bacteria 840
497 Ga0307414_10567494 3300032004 Bacteria 1014
498 Ga0373959_0167033 3300034820 Bacteria 565
499 Ga0373928_0114961 3300035084 Bacteria 715
500 Ga0373934_0000135 3300035086 Bacteria 27297
501 Ga0373953_0000554 3300035117 Bacteria 10368
502 Ga0373954_0072834 3300035118 Bacteria 1634
503 Ga0373956_0000989 3300035119 Bacteria 11777
504 Ga0373957_0002047 3300035120 Bacteria 5648
505 Ga0373943_0039967 3300035170 Bacteria 2263
506 Ga0373955_0000137 3300035172 Bacteria 28923
507 Ga0373942_0143643 3300035207 Bacteria 762
508 Ga0373961_0221272 3300035241 Bacteria 675
509 Ga0373924_0003189 3300035410 Bacteria 5614
510 Ga0373931_0351334 3300035691 Bacteria 923
511 Ga0373935_0536195 3300035692 Bacteria 852
512 Ga0373933_0000015 3300035724 Bacteria 103111
513 Ga0373947_0701654 3300035725 Bacteria 690
514 Ga0373937_0000053 3300036401 Bacteria 103072
515 Ga0373925_0474514 3300037068 Bacteria 1026
516 Ga0395899_0297731 3300037312 Bacteria 1093
517 Ga0395900_0055408 3300037418 Bacteria 4083
518 Ga0395900_0377548 3300037418 Bacteria 1386
519 Ga0395900_0455918 3300037418 Bacteria 1234
520 Ga0395900_0653451 3300037418 Bacteria 988
521 Ga0395900_0802922 3300037418 Bacteria 869
522 Ga0395900_0886005 3300037418 Bacteria 816
523 Ga0395900_1147943 3300037418 Bacteria 693
524 Ga0395900_1426799 3300037418 Bacteria 605
525 Ga0395900_1681068 3300037418 Bacteria 546
526 Ga0395898_0004284 3300037466 Bacteria 15640
527 Ga0395898_0043019 3300037466 Bacteria 4452
528 Ga0395898_0047366 3300037466 Bacteria 4219
529 Ga0395898_0085742 3300037466 Bacteria 3036
530 Ga0395898_0177753 3300037466 Bacteria 2034
531 Ga0395898_0293392 3300037466 Bacteria 1551
532 Ga0395898_0386924 3300037466 Bacteria 1334
533 Ga0395898_0427378 3300037466 Bacteria 1262
534 Ga0395905_0484277 3300037471 Bacteria 1137
535 Ga0395905_0896645 3300037471 Bacteria 790
536 Ga0395905_0964298 3300037471 Bacteria 756
537 Ga0395905_1317433 3300037471 Bacteria 626
538 Ga0436364_0034070 3300037853 Bacteria 3323
539 Ga0436364_0372858 3300037853 Unclassified 1152
540 Ga0436364_0893802 3300037853 Bacteria 4722
541 Ga0436364_0985211 3300037853 Bacteria 659
542 Ga0436364_1172050 3300037853 Bacteria 1737
543 Ga0436364_1286757 3300037853 Bacteria 1185
544 Ga0436364_1422689 3300037853 Bacteria 734
545 Ga0395901_0042302 3300038443 Bacteria 4723
546 Ga0395901_0057070 3300038443 Bacteria 4061
547 Ga0395901_0101268 3300038443 Bacteria 3023
548 Ga0395901_0150453 3300038443 Bacteria 2446
549 Ga0395901_0242629 3300038443 Bacteria 1879
550 Ga0395901_0346873 3300038443 Bacteria 1533
551 Ga0395901_0428782 3300038443 Bacteria 1355
552 Ga0395901_0508238 3300038443 Bacteria 1226
553 Ga0395901_0510228 3300038443 Bacteria 1223
554 Ga0395901_0703250 3300038443 Bacteria 1008
555 Ga0395901_0726759 3300038443 Bacteria 988
556 Ga0395901_1290437 3300038443 Bacteria 692
557 Ga0400488_07726 3300038741 Bacteria 1443
558 Ga0242420_114517 3300038996 Bacteria 583
559 Ga0400483_071288 3300039062 Unclassified 1442
560 Ga0400483_245707 3300039062 Unclassified 2164
561 Ga0436365_0254787 3300039437 Bacteria 1152
562 Ga0436365_0860754 3300039437 Bacteria 2892
563 Ga0436365_1156917 3300039437 Bacteria 5140
564 Ga0436365_1252474 3300039437 Bacteria 718
565 Ga0436365_1357803 3300039437 Unclassified 1691
566 Ga0436363_0314174 3300039450 Bacteria 594
567 Ga0436363_0436762 3300039450 Bacteria 1102
568 Ga0436363_0753556 3300039450 Bacteria 517
569 Ga0436363_0814925 3300039450 Bacteria 1570
570 Ga0436363_1693937 3300039450 Bacteria 1123
571 Ga0436362_0074627 3300039453 Bacteria 526
572 Ga0436362_0990170 3300039453 Bacteria 2147
573 Ga0451789_0651530 3300041443 Bacteria 1214
574 Ga0451789_1165134 3300041443 Bacteria 656
575 Ga0451793_1298945 3300041452 Bacteria 754
576 Ga0451795_0263037 3300041456 Bacteria 715
577 Ga0451800_1364612 3300041459 Bacteria 520
578 Ga0451802_1226528 3300041460 Bacteria 926
579 Ga0451804_0044416 3300041463 Bacteria 1166
580 Ga0451804_1154896 3300041463 Bacteria 533
581 Ga0451851_0708761 3300041507 Bacteria 673
582 Ga0451855_1796818 3300041511 Bacteria 879
583 Ga0452271_38374 3300041916 Eukaryota 636
584 Ga0439456_097264 3300042013 Bacteria 665
585 Ga0439460_0226174 3300042461 Bacteria 642
586 Ga0451577_0002384 3300042876 Bacteria 22505
587 Ga0466965_0720345 3300044683 Bacteria 573
588 Ga0466966_0112099 3300044684 Bacteria 1681
589 Ga0466961_0099779 3300044693 Bacteria 1830
590 Ga0466961_0670796 3300044693 Bacteria 622
591 Ga0466963_0001854 3300044694 Bacteria 11530
592 Ga0466963_0040517 3300044694 Bacteria 3053
593 Ga0466963_0178057 3300044694 Bacteria 1484
594 Ga0453684_0006354 3300044712 Bacteria 22526
595 Ga0466971_0181606 3300044719 Bacteria 989
596 Ga0466971_0329889 3300044719 Bacteria 736
597 Ga0466968_0166505 3300044735 Bacteria 1019
598 Ga0466968_0199083 3300044735 Bacteria 938
599 Ga0466968_0359354 3300044735 Bacteria 709
600 Ga0466970_0137838 3300044765 Bacteria 1343
601 Ga0466957_0457415 3300044842 Bacteria 880
602 Ga0466960_0342783 3300044901 Bacteria 851
603 Ga0466960_0413950 3300044901 Bacteria 778
604 Ga0466959_0214896 3300045049 Bacteria 1335
605 Ga0466959_0248475 3300045049 Bacteria 1227
606 Ga0466959_0332664 3300045049 Bacteria 1037
607 Ga0466958_0003571 3300045836 Bacteria 8097
608 Ga0466967_0020832 3300045976 Bacteria 5310
609 Ga0466967_0170345 3300045976 Bacteria 2048
610 Ga0466967_0177322 3300045976 Bacteria 2008
611 Ga0466967_0533052 3300045976 Bacteria 1155
612 Ga0466967_0812872 3300045976 Bacteria 928
613 Ga0466967_0994020 3300045976 Bacteria 835
614 Ga0466967_2207433 3300045976 Bacteria 546
615 Ga0495592_0000057 3300046454 Bacteria 103108
616 Ga0495651_0000032 3300046462 Bacteria 103111
617 Ga0495653_0002066 3300046463 Bacteria 15786
618 Ga0495653_0904477 3300046463 Bacteria 526
619 Ga0495650_0000054 3300046471 Bacteria 313631
620 Ga0495664_0740530 3300046477 Bacteria 580
621 Ga0495608_0000045 3300046511 Bacteria 100413
622 Ga0495618_0918626 3300046514 Bacteria 505
623 Ga0495628_0000063 3300046516 Bacteria 86231
624 Ga0495631_0179580 3300046518 Bacteria 907
625 Ga0495631_0421932 3300046518 Bacteria 568
626 Ga0495663_0143722 3300046525 Bacteria 811
627 Ga0495663_0174304 3300046525 Bacteria 743
628 Ga0495652_0000003 3300046529 Bacteria 597094
629 Ga0495652_0000078 3300046529 Bacteria 103039
630 Ga0495587_0000050 3300046536 Bacteria 103111
631 Ga0495645_0070538 3300046543 Bacteria 2522
632 Ga0495645_0099480 3300046543 Bacteria 2069
633 Ga0495667_0000055 3300046559 Bacteria 103111
634 Ga0495668_0687304 3300046616 Bacteria 566
635 Ga0495635_0936874 3300046663 Bacteria 553
636 Ga0495635_0979017 3300046663 Bacteria 539
637 Ga0495659_0518246 3300046664 Bacteria 524
638 Ga0495588_0334251 3300046674 Bacteria 797
639 Ga0495657_0000009 3300046675 Bacteria 217555
640 Ga0495599_0000033 3300046678 Bacteria 106425
641 Ga0495599_0079939 3300046678 Bacteria 2042
642 Ga0495623_0000423 3300046679 Bacteria 27905
643 Ga0495646_0008673 3300046680 Bacteria 6462
644 Ga0495646_0660734 3300046680 Bacteria 528
645 Ga0495624_0927104 3300046690 Unclassified 512
646 Ga0495600_0001649 3300046809 Bacteria 12439
647 Ga0495604_0000052 3300047317 Bacteria 103088
648 Ga0495636_0009435 3300047318 Bacteria 3843
649 Ga0495672_0012173 3300047320 Bacteria 6019
650 Ga0495672_0118602 3300047320 Bacteria 1410
651 Ga0495672_0224915 3300047320 Bacteria 924
652 Ga0495676_1032985 3300047321 Bacteria 524
653 Ga0495680_0000027 3300047322 Bacteria 113036
654 Ga0495675_0000399 3300047444 Bacteria 29995
655 Ga0495684_0923875 3300047471 Bacteria 560
656 Ga0495602_0000236 3300048088 Bacteria 51630
657 Ga0495614_0600091 3300048089 Bacteria 529
658 Ga0496100_0068291 3300048903 Bacteria 2363
659 Ga0496100_0120824 3300048903 Bacteria 1832
660 Ga0496100_0122062 3300048903 Bacteria 1824
661 Ga0496100_0241510 3300048903 Bacteria 1333
662 Ga0496101_0006828 3300048904 Bacteria 7367
663 Ga0496101_0016994 3300048904 Bacteria 4926
664 Ga0496101_0068115 3300048904 Bacteria 2601
665 Ga0496101_0129260 3300048904 Bacteria 1917
666 Ga0496102_0034938 3300048905 Bacteria 4524
667 Ga0496102_0424111 3300048905 Bacteria 1249
668 Ga0496102_1463731 3300048905 Bacteria 602
669 Ga0496102_1477980 3300048905 Bacteria 598
670 Ga0496103_0250179 3300048906 Bacteria 1140
671 Ga0496104_0047023 3300048907 Bacteria 4066
672 Ga0496104_0166197 3300048907 Bacteria 2116
673 Ga0496105_0066026 3300048908 Bacteria 2986
674 Ga0496105_0520850 3300048908 Bacteria 931
675 Ga0496105_1029712 3300048908 Bacteria 614
676 Ga0496106_0004461 3300048909 Bacteria 10376
677 Ga0496106_0382104 3300048909 Bacteria 1131
678 Ga0496106_0569430 3300048909 Bacteria 908
679 Ga0496106_0573584 3300048909 Bacteria 905
680 Ga0496106_1458149 3300048909 Bacteria 527
681 Ga0496107_0008235 3300048910 Bacteria 7212
682 Ga0496107_0141702 3300048910 Bacteria 1777
683 Ga0496107_0176240 3300048910 Bacteria 1587
684 Ga0496107_0320390 3300048910 Bacteria 1154
685 Ga0496108_0146980 3300048911 Bacteria 2032
686 Ga0496108_0790283 3300048911 Bacteria 819
687 Ga0496108_1527511 3300048911 Bacteria 555
688 Ga0496109_0237577 3300048912 Bacteria 1714
689 Ga0496109_1068438 3300048912 Bacteria 744
690 Ga0496110_0214905 3300048913 Bacteria 1748
691 Ga0496110_0325196 3300048913 Bacteria 1401
692 Ga0496110_0368370 3300048913 Bacteria 1309
693 Ga0496110_0833710 3300048913 Bacteria 827
694 Ga0496110_1488204 3300048913 Bacteria 587
695 Ga0496111_0079671 3300048914 Bacteria 2390
696 Ga0496111_0108417 3300048914 Bacteria 2045
697 Ga0496111_0251187 3300048914 Bacteria 1313
698 Ga0496111_0313845 3300048914 Bacteria 1161
699 Ga0496112_0041797 3300048915 Bacteria 4485
700 Ga0496112_0476225 3300048915 Bacteria 1185
701 Ga0496112_0504950 3300048915 Bacteria 1144
702 Ga0496112_1191869 3300048915 Bacteria 678
703 Ga0496113_0147470 3300048916 Bacteria 1854
704 Ga0496114_0234038 3300048917 Bacteria 1614
705 Ga0496115_0043427 3300048918 Bacteria 3585
706 Ga0496115_0163769 3300048918 Bacteria 1839
707 Ga0496116_0001112 3300048919 Bacteria 32189
708 Ga0496118_0023973 3300048921 Bacteria 5282
709 Ga0496119_0001214 3300048922 Bacteria 32189
710 Ga0496119_0014838 3300048922 Bacteria 6059
711 Ga0496119_0134046 3300048922 Bacteria 1345
712 Ga0496121_0067583 3300048924 Bacteria 2896
713 Ga0496121_0287381 3300048924 Bacteria 1122
714 Ga0496124_0021502 3300048927 Bacteria 5944
715 Ga0496124_0683608 3300048927 Bacteria 653
716 Ga0496125_0559540 3300048928 Bacteria 632
717 Ga0496126_0019663 3300048929 Bacteria 6646
718 Ga0496126_0032528 3300048929 Bacteria 4912
719 Ga0496126_0695093 3300048929 Bacteria 791
720 Ga0496126_0811277 3300048929 Bacteria 717
721 Ga0501317_110580 3300049533 Bacteria 504
722 Ga0501318_055940 3300049534 Bacteria 596
723 Ga0501325_048641 3300049541 Bacteria 535
724 Ga0501031_0003150 3300049568 Bacteria 10580
725 Ga0501032_0001503 3300049569 Bacteria 18641
726 Ga0501032_0556670 3300049569 Bacteria 731
727 Ga0501033_0004824 3300049570 Bacteria 10762
728 Ga0501034_0007306 3300049571 Bacteria 11773
729 Ga0501034_0013330 3300049571 Bacteria 8466
730 Ga0501034_0999368 3300049571 Bacteria 721
731 Ga0501036_0004677 3300049572 Bacteria 11055
732 Ga0501037_0003839 3300049573 Bacteria 10912
733 Ga0501038_0006610 3300049574 Bacteria 10726
734 Ga0501039_0004345 3300049575 Bacteria 10689
735 Ga0501040_0005368 3300049576 Bacteria 8288
736 Ga0501042_0012040 3300049578 Bacteria 5850
737 Ga0501043_0001223 3300049579 Bacteria 22647
738 Ga0501046_0006075 3300049580 Bacteria 10745
739 Ga0501047_0006595 3300049581 Bacteria 10924
740 Ga0501048_0004454 3300049582 Bacteria 10658
741 Ga0501068_0035333 3300049584 Bacteria 2982
742 Ga0501068_0175128 3300049584 Bacteria 1355
743 Ga0501068_0497168 3300049584 Bacteria 791
744 Ga0501069_0030901 3300049585 Bacteria 2943
745 Ga0501069_0176141 3300049585 Bacteria 1235
746 Ga0501070_0000793 3300049586 Bacteria 28685
747 Ga0501070_0005358 3300049586 Bacteria 10945
748 Ga0501070_1150317 3300049586 Bacteria 597
749 Ga0501071_0650785 3300049587 Bacteria 811
750 Ga0501071_1080935 3300049587 Bacteria 620
751 Ga0501073_0051019 3300049589 Bacteria 2898
752 Ga0501074_0003906 3300049590 Bacteria 10615
753 Ga0501075_0481561 3300049591 Bacteria 947
754 Ga0501076_0836129 3300049592 Bacteria 759
755 Ga0501209_191789 3300049656 Bacteria 627
756 Ga0501079_0052396 3300049741 Bacteria 3149
757 Ga0501080_0073910 3300049742 Bacteria 3171
758 Ga0501080_0469572 3300049742 Bacteria 1126
759 Ga0501080_0475256 3300049742 Bacteria 1119
760 Ga0501083_0044176 3300049744 Bacteria 3016
761 Ga0501035_0006695 3300049822 Bacteria 10768
762 Ga0501044_0009251 3300049823 Bacteria 10759
763 Ga0501045_0125907 3300049824 Bacteria 1903
764 nmdc:mga03n38_588012_c1 3300050490 Bacteria 633
765 nmdc:mga00v17_996262_c1 3300050491 Bacteria 528
766 nmdc:mga0yw44_1098678_c1 3300050492 Bacteria 537
767 nmdc:mga0yw44_488469_c1 3300050492 Bacteria 835
768 nmdc:mga0yw44_882158_c1 3300050492 Bacteria 607
769 nmdc:mga05p37_929068_c1 3300050507 Bacteria 934
770 nmdc:mga09592_734563_c1 3300050508 Bacteria 838
771 nmdc:mga0qj67_161644_c1 3300050509 Bacteria 1818
772 nmdc:mga06r32_366023_c1 3300050510 Bacteria 1425
773 nmdc:mga06r32_580029_c1 3300050510 Bacteria 1094
774 nmdc:mga08y16_1090195_c1 3300050511 Bacteria 774
775 nmdc:mga08y16_1636592_c1 3300050511 Unclassified 601
776 nmdc:mga08y16_405079_c1 3300050511 Bacteria 1395
777 nmdc:mga08y16_552639_c1 3300050511 Bacteria 1165
778 nmdc:mga08y16_839682_c1 3300050511 Bacteria 909
779 nmdc:mga0n895_1496674_c1 3300050512 Bacteria 641
780 nmdc:mga0n895_901426_c1 3300050512 Bacteria 870
781 nmdc:mga0rr50_1664719_c1 3300050513 Bacteria 538
782 nmdc:mga0a205_1095873_c1 3300050515 Bacteria 644
783 nmdc:mga0a205_1498269_c1 3300050515 Bacteria 523
784 nmdc:mga0a205_44804_c2 3300050515 Bacteria 3523
785 nmdc:mga0a205_861382_c1 3300050515 Bacteria 753
786 Ga0495601_0321107 3300053077 Bacteria 1008
787 Ga0495601_0520981 3300053077 Bacteria 766
788 Ga0495655_0054357 3300053083 Bacteria 1071
789 Ga0495655_0086265 3300053083 Bacteria 907
790 Ga0495655_0122737 3300053083 Bacteria 792
791 Ga0495655_0166949 3300053083 Bacteria 702
792 Ga0495595_0000236 3300053084 Bacteria 21890
793 Ga0495619_0176001 3300053085 Bacteria 1480
794 Ga0500595_121452 3300053119 Bacteria 738
795 Ga0500616_0005157 3300053153 Bacteria 8970
796 Ga0500633_0385797 3300053160 Bacteria 507
797 Ga0501084_0912227 3300054114 Bacteria 739
798 Ga0587070_182123 3300059491 Bacteria 547
799 Ga0587073_0285125 3300059492 Bacteria 531
800 Ga0587083_0262879 3300059505 Bacteria 519
801 Ga0587088_162535 3300059508 Bacteria 548
802 Ga0587088_167909 3300059508 Bacteria 542
803 Ga0587089_103946 3300059509 Bacteria 518
804 Ga0587128_041580 3300059630 Bacteria 806
805 Ga0587067_202510 3300059640 Bacteria 528
806 Ga0587079_150043 3300059647 Bacteria 602
807 Ga0587114_041631 3300059655 Bacteria 746
808 Ga0587114_133851 3300059655 Bacteria 513
809 Ga0587111_0229322 3300060346 Bacteria 540
810 Ga0466962_0493019 3300061719 Bacteria 619

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0009435 Ga0495636_0009435_1206_1388 60
2 3300005468 Ga0070707_101753927 Ga0070707_1017539271 62
3 3300014497 Ga0182008_10205933 Ga0182008_102059331 62
4 3300041463 Ga0451804_1154896 Ga0451804_1154896_211_399 62
5 iso_pu_bacteria 2740891818 2740992345 62
6 3300006852 Ga0075433_11575123 Ga0075433_115751231 64
7 3300050515 nmdc:mga0a205_1498269_c1 nmdc:mga0a205_1498269_c1_178_372 64
8 3300005366 Ga0070659_101934497 Ga0070659_1019344971 65
9 3300005549 Ga0070704_100943971 Ga0070704_1009439712 65
10 3300005937 Ga0081455_10062009 Ga0081455_100620093 65
11 3300005937 Ga0081455_10229457 Ga0081455_102294573 65
12 3300006038 Ga0075365_10874710 Ga0075365_108747102 65
13 3300006844 Ga0075428_100007826 Ga0075428_1000078267 65
14 3300006846 Ga0075430_100686870 Ga0075430_1006868702 65
15 3300006847 Ga0075431_100914499 Ga0075431_1009144992 65
16 3300013307 Ga0157372_12082466 Ga0157372_120824662 65
17 3300037853 Ga0436364_1172050 Ga0436364_1172050_765_962 65
18 3300039437 Ga0436365_1252474 Ga0436365_1252474_201_398 65
19 3300041916 Ga0452271_38374 Ga0452271_38374_58_279 65
20 3300049584 Ga0501068_0175128 Ga0501068_0175128_316_513 65
21 3300049586 Ga0501070_1150317 Ga0501070_1150317_119_316 65
22 3300049587 Ga0501071_0650785 Ga0501071_0650785_71_268 65
23 3300049587 Ga0501071_1080935 Ga0501071_1080935_207_404 65
24 3300049591 Ga0501075_0481561 Ga0501075_0481561_219_416 65
25 3300049742 Ga0501080_0475256 Ga0501080_0475256_174_371 65
26 3300050492 nmdc:mga0yw44_488469_c1 nmdc:mga0yw44_488469_c1_600_797 65
27 3300050508 nmdc:mga09592_734563_c1 nmdc:mga09592_734563_c1_552_749 65
28 3300050509 nmdc:mga0qj67_161644_c1 nmdc:mga0qj67_161644_c1_245_442 65
29 3300050510 nmdc:mga06r32_580029_c1 nmdc:mga06r32_580029_c1_577_774 65
30 3300054114 Ga0501084_0912227 Ga0501084_0912227_154_351 65
31 3300025938 Ga0207704_11325229 Ga0207704_113252291 66
32 3300031727 Ga0316576_10499256 Ga0316576_104992561 66
33 3300038741 Ga0400488_07726 Ga0400488_07726_977_1177 66
34 3300039062 Ga0400483_071288 Ga0400483_071288_344_544 66
35 3300039062 Ga0400483_245707 Ga0400483_245707_701_901 66
36 3300042876 Ga0451577_0002384 Ga0451577_0002384_5204_5404 66
37 3300044712 Ga0453684_0006354 Ga0453684_0006354_5225_5425 66
38 3300001976 JGI24752J21851_1039726 JGI24752J21851_10397261 67
39 3300001989 JGI24739J22299_10176951 JGI24739J22299_101769512 67
40 3300001990 JGI24737J22298_10120012 JGI24737J22298_101200121 67
41 3300001991 JGI24743J22301_10111487 JGI24743J22301_101114871 67
42 3300002067 JGI24735J21928_10146789 JGI24735J21928_101467892 67
43 3300002070 JGI24750J21931_1032661 JGI24750J21931_10326611 67
44 3300002075 JGI24738J21930_10043036 JGI24738J21930_100430363 67
45 3300002077 JGI24744J21845_10088344 JGI24744J21845_100883441 67
46 3300003163 Ga0006759J45824_1009337 Ga0006759J45824_10093371 67
47 3300003305 Ga0006770J48903_1015579 Ga0006770J48903_10155791 67
48 3300003308 Ga0006777J48905_1007156 Ga0006777J48905_10071561 67
49 3300003320 rootH2_10173644 rootH2_101736441 67
50 3300003568 Ga0006781J51513_1005727 Ga0006781J51513_10057271 67
51 3300003574 Ga0007410J51695_1007933 Ga0007410J51695_10079331 67
52 3300003574 Ga0007410J51695_1070413 Ga0007410J51695_10704131 67
53 3300003575 Ga0007409J51694_1008940 Ga0007409J51694_10089401 67
54 3300003577 Ga0007416J51690_1009552 Ga0007416J51690_10095521 67
55 3300003579 Ga0007429J51699_1005706 Ga0007429J51699_10057061 67
56 3300003693 Ga0032354_1006874 Ga0032354_10068741 67
57 3300003693 Ga0032354_1021963 Ga0032354_10219631 67
58 3300003735 Ga0006780_1007240 Ga0006780_10072401 67
59 3300004799 Ga0058863_10086156 Ga0058863_100861562 67
60 3300004800 Ga0058861_10024356 Ga0058861_100243562 67
61 3300004800 Ga0058861_11947429 Ga0058861_119474291 67
62 3300004800 Ga0058861_12055410 Ga0058861_120554101 67
63 3300004803 Ga0058862_12747784 Ga0058862_127477841 67
64 3300005327 Ga0070658_10103253 Ga0070658_101032536 67
65 3300005327 Ga0070658_11101661 Ga0070658_111016611 67
66 3300005329 Ga0070683_100025174 Ga0070683_1000251747 67
67 3300005329 Ga0070683_100029003 Ga0070683_1000290037 67
68 3300005329 Ga0070683_100946691 Ga0070683_1009466913 67
69 3300005329 Ga0070683_101255292 Ga0070683_1012552922 67
70 3300005330 Ga0070690_100209619 Ga0070690_1002096192 67
71 3300005330 Ga0070690_100740480 Ga0070690_1007404802 67
72 3300005331 Ga0070670_100491451 Ga0070670_1004914511 67
73 3300005334 Ga0068869_100131270 Ga0068869_1001312701 67
74 3300005334 Ga0068869_101925432 Ga0068869_1019254322 67
75 3300005334 Ga0068869_102089018 Ga0068869_1020890181 67
76 3300005335 Ga0070666_10284923 Ga0070666_102849231 67
77 3300005336 Ga0070680_100009178 Ga0070680_10000917810 67
78 3300005336 Ga0070680_100404398 Ga0070680_1004043982 67
79 3300005336 Ga0070680_101121810 Ga0070680_1011218101 67
80 3300005336 Ga0070680_101571737 Ga0070680_1015717371 67
81 3300005337 Ga0070682_100013435 Ga0070682_1000134355 67
82 3300005337 Ga0070682_100046836 Ga0070682_1000468361 67
83 3300005337 Ga0070682_100047953 Ga0070682_1000479534 67
84 3300005338 Ga0068868_100741762 Ga0068868_1007417621 67
85 3300005339 Ga0070660_100062151 Ga0070660_1000621513 67
86 3300005340 Ga0070689_100419091 Ga0070689_1004190912 67
87 3300005343 Ga0070687_100050577 Ga0070687_1000505772 67
88 3300005344 Ga0070661_100029696 Ga0070661_1000296966 67
89 3300005344 Ga0070661_100458772 Ga0070661_1004587722 67
90 3300005344 Ga0070661_100658155 Ga0070661_1006581552 67
91 3300005344 Ga0070661_100754912 Ga0070661_1007549122 67
92 3300005345 Ga0070692_10053130 Ga0070692_100531304 67
93 3300005345 Ga0070692_10065551 Ga0070692_100655511 67
94 3300005345 Ga0070692_10088816 Ga0070692_100888162 67
95 3300005347 Ga0070668_100148388 Ga0070668_1001483882 67
96 3300005353 Ga0070669_100939135 Ga0070669_1009391352 67
97 3300005354 Ga0070675_100419253 Ga0070675_1004192532 67
98 3300005355 Ga0070671_100234697 Ga0070671_1002346972 67
99 3300005355 Ga0070671_101120267 Ga0070671_1011202671 67
100 3300005356 Ga0070674_101242586 Ga0070674_1012425861 67
101 3300005364 Ga0070673_100210805 Ga0070673_1002108052 67
102 3300005365 Ga0070688_100081477 Ga0070688_1000814774 67
103 3300005366 Ga0070659_100005205 Ga0070659_1000052057 67
104 3300005366 Ga0070659_100062916 Ga0070659_1000629162 67
105 3300005366 Ga0070659_100078511 Ga0070659_1000785114 67
106 3300005366 Ga0070659_101540249 Ga0070659_1015402491 67
107 3300005367 Ga0070667_100289316 Ga0070667_1002893161 67
108 3300005367 Ga0070667_101024455 Ga0070667_1010244551 67
109 3300005435 Ga0070714_100002604 Ga0070714_1000026044 67
110 3300005435 Ga0070714_101415437 Ga0070714_1014154372 67
111 3300005436 Ga0070713_100330367 Ga0070713_1003303673 67
112 3300005437 Ga0070710_10654659 Ga0070710_106546592 67
113 3300005438 Ga0070701_10275998 Ga0070701_102759981 67
114 3300005438 Ga0070701_10406431 Ga0070701_104064312 67
115 3300005439 Ga0070711_100079542 Ga0070711_1000795425 67
116 3300005439 Ga0070711_100853051 Ga0070711_1008530512 67
117 3300005439 Ga0070711_101297161 Ga0070711_1012971612 67
118 3300005440 Ga0070705_101553901 Ga0070705_1015539011 67
119 3300005441 Ga0070700_100375649 Ga0070700_1003756492 67
120 3300005441 Ga0070700_100478003 Ga0070700_1004780032 67
121 3300005441 Ga0070700_100539675 Ga0070700_1005396752 67
122 3300005441 Ga0070700_100742285 Ga0070700_1007422851 67
123 3300005455 Ga0070663_100006400 Ga0070663_1000064007 67
124 3300005455 Ga0070663_100851541 Ga0070663_1008515411 67
125 3300005455 Ga0070663_101167101 Ga0070663_1011671011 67
126 3300005456 Ga0070678_100511701 Ga0070678_1005117012 67
127 3300005456 Ga0070678_101842352 Ga0070678_1018423521 67
128 3300005457 Ga0070662_101084174 Ga0070662_1010841742 67
129 3300005457 Ga0070662_101166461 Ga0070662_1011664612 67
130 3300005458 Ga0070681_10145576 Ga0070681_101455765 67
131 3300005458 Ga0070681_10560106 Ga0070681_105601063 67
132 3300005458 Ga0070681_11270119 Ga0070681_112701192 67
133 3300005459 Ga0068867_100118120 Ga0068867_1001181204 67
134 3300005466 Ga0070685_10185385 Ga0070685_101853852 67
135 3300005467 Ga0070706_100348118 Ga0070706_1003481182 67
136 3300005530 Ga0070679_100026157 Ga0070679_1000261577 67
137 3300005530 Ga0070679_100056108 Ga0070679_1000561082 67
138 3300005530 Ga0070679_100402260 Ga0070679_1004022603 67
139 3300005535 Ga0070684_100026063 Ga0070684_1000260639 67
140 3300005535 Ga0070684_100075858 Ga0070684_1000758584 67
141 3300005536 Ga0070697_101401191 Ga0070697_1014011911 67
142 3300005539 Ga0068853_100064592 Ga0068853_1000645925 67
143 3300005543 Ga0070672_100040675 Ga0070672_1000406756 67
144 3300005543 Ga0070672_100311846 Ga0070672_1003118462 67
145 3300005544 Ga0070686_100048872 Ga0070686_1000488723 67
146 3300005544 Ga0070686_100533548 Ga0070686_1005335482 67
147 3300005546 Ga0070696_100341795 Ga0070696_1003417952 67
148 3300005546 Ga0070696_101011553 Ga0070696_1010115532 67
149 3300005546 Ga0070696_101378053 Ga0070696_1013780531 67
150 3300005547 Ga0070693_100762898 Ga0070693_1007628982 67
151 3300005547 Ga0070693_100925773 Ga0070693_1009257732 67
152 3300005548 Ga0070665_100005382 Ga0070665_1000053828 67
153 3300005548 Ga0070665_100164791 Ga0070665_1001647913 67
154 3300005548 Ga0070665_101171359 Ga0070665_1011713591 67
155 3300005549 Ga0070704_100079527 Ga0070704_1000795273 67
156 3300005549 Ga0070704_100259039 Ga0070704_1002590393 67
157 3300005563 Ga0068855_100317450 Ga0068855_1003174503 67
158 3300005563 Ga0068855_100739311 Ga0068855_1007393112 67
159 3300005564 Ga0070664_100032412 Ga0070664_1000324126 67
160 3300005564 Ga0070664_100506038 Ga0070664_1005060383 67
161 3300005564 Ga0070664_100525023 Ga0070664_1005250232 67
162 3300005577 Ga0068857_100073194 Ga0068857_1000731944 67
163 3300005577 Ga0068857_101346251 Ga0068857_1013462512 67
164 3300005577 Ga0068857_102437117 Ga0068857_1024371171 67
165 3300005578 Ga0068854_100054326 Ga0068854_1000543262 67
166 3300005578 Ga0068854_100197169 Ga0068854_1001971695 67
167 3300005578 Ga0068854_100376455 Ga0068854_1003764552 67
168 3300005578 Ga0068854_100485582 Ga0068854_1004855822 67
169 3300005614 Ga0068856_100040528 Ga0068856_1000405284 67
170 3300005614 Ga0068856_100054050 Ga0068856_1000540509 67
171 3300005614 Ga0068856_100161677 Ga0068856_1001616772 67
172 3300005615 Ga0070702_100005543 Ga0070702_1000055437 67
173 3300005615 Ga0070702_100199352 Ga0070702_1001993522 67
174 3300005616 Ga0068852_100002528 Ga0068852_1000025284 67
175 3300005616 Ga0068852_100240582 Ga0068852_1002405822 67
176 3300005616 Ga0068852_102411380 Ga0068852_1024113801 67
177 3300005617 Ga0068859_100722984 Ga0068859_1007229843 67
178 3300005618 Ga0068864_100151139 Ga0068864_1001511391 67
179 3300005618 Ga0068864_100907898 Ga0068864_1009078981 67
180 3300005718 Ga0068866_10103734 Ga0068866_101037341 67
181 3300005718 Ga0068866_10773972 Ga0068866_107739722 67
182 3300005718 Ga0068866_11348211 Ga0068866_113482112 67
183 3300005719 Ga0068861_100435847 Ga0068861_1004358472 67
184 3300005834 Ga0068851_10314571 Ga0068851_103145712 67
185 3300005834 Ga0068851_11066196 Ga0068851_110661962 67
186 3300005840 Ga0068870_10084559 Ga0068870_100845592 67
187 3300005841 Ga0068863_101659012 Ga0068863_1016590122 67
188 3300005842 Ga0068858_100042042 Ga0068858_1000420423 67
189 3300005842 Ga0068858_100490229 Ga0068858_1004902291 67
190 3300005843 Ga0068860_101062020 Ga0068860_1010620203 67
191 3300005843 Ga0068860_101248419 Ga0068860_1012484192 67
192 3300005843 Ga0068860_101901347 Ga0068860_1019013472 67
193 3300005844 Ga0068862_100036198 Ga0068862_10003619811 67
194 3300005937 Ga0081455_10220635 Ga0081455_102206352 67
195 3300005937 Ga0081455_10513489 Ga0081455_105134891 67
196 3300005981 Ga0081538_10002285 Ga0081538_1000228515 67
197 3300005985 Ga0081539_10009105 Ga0081539_100091056 67
198 3300005985 Ga0081539_10020386 Ga0081539_1002038612 67
199 3300005985 Ga0081539_10218691 Ga0081539_102186911 67
200 3300005985 Ga0081539_10435876 Ga0081539_104358762 67
201 3300006028 Ga0070717_10013602 Ga0070717_100136024 67
202 3300006028 Ga0070717_10264087 Ga0070717_102640873 67
203 3300006028 Ga0070717_10364462 Ga0070717_103644624 67
204 3300006048 Ga0075363_100393107 Ga0075363_1003931072 67
205 3300006051 Ga0075364_10279860 Ga0075364_102798602 67
206 3300006058 Ga0075432_10348788 Ga0075432_103487882 67
207 3300006163 Ga0070715_10234547 Ga0070715_102345472 67
208 3300006175 Ga0070712_100040365 Ga0070712_1000403652 67
209 3300006175 Ga0070712_100090701 Ga0070712_1000907013 67
210 3300006175 Ga0070712_100207020 Ga0070712_1002070202 67
211 3300006175 Ga0070712_100552258 Ga0070712_1005522582 67
212 3300006175 Ga0070712_100873284 Ga0070712_1008732842 67
213 3300006175 Ga0070712_101875812 Ga0070712_1018758122 67
214 3300006237 Ga0097621_102050385 Ga0097621_1020503851 67
215 3300006358 Ga0068871_100301781 Ga0068871_1003017812 67
216 3300006844 Ga0075428_101404487 Ga0075428_1014044872 67
217 3300006852 Ga0075433_10926550 Ga0075433_109265502 67
218 3300006852 Ga0075433_11451899 Ga0075433_114518992 67
219 3300006871 Ga0075434_100905870 Ga0075434_1009058702 67
220 3300006881 Ga0068865_100144646 Ga0068865_1001446466 67
221 3300006931 Ga0097620_100723026 Ga0097620_1007230263 67
222 3300009092 Ga0105250_10296314 Ga0105250_102963142 67
223 3300009093 Ga0105240_10065467 Ga0105240_100654674 67
224 3300009093 Ga0105240_10542921 Ga0105240_105429212 67
225 3300009093 Ga0105240_10931442 Ga0105240_109314421 67
226 3300009093 Ga0105240_11674293 Ga0105240_116742931 67
227 3300009094 Ga0111539_10184773 Ga0111539_101847734 67
228 3300009094 Ga0111539_10217989 Ga0111539_102179895 67
229 3300009094 Ga0111539_10402244 Ga0111539_104022444 67
230 3300009098 Ga0105245_10560527 Ga0105245_105605272 67
231 3300009098 Ga0105245_10585998 Ga0105245_105859983 67
232 3300009098 Ga0105245_10625767 Ga0105245_106257672 67
233 3300009098 Ga0105245_11703325 Ga0105245_117033252 67
234 3300009098 Ga0105245_12045100 Ga0105245_120451002 67
235 3300009101 Ga0105247_10214320 Ga0105247_102143202 67
236 3300009148 Ga0105243_10044918 Ga0105243_100449182 67
237 3300009148 Ga0105243_10174824 Ga0105243_101748242 67
238 3300009148 Ga0105243_10418111 Ga0105243_104181114 67
239 3300009174 Ga0105241_10917104 Ga0105241_109171042 67
240 3300009176 Ga0105242_10210140 Ga0105242_102101402 67
241 3300009176 Ga0105242_10998434 Ga0105242_109984342 67
242 3300009176 Ga0105242_11686467 Ga0105242_116864671 67
243 3300009177 Ga0105248_10684395 Ga0105248_106843952 67
244 3300009177 Ga0105248_12048594 Ga0105248_120485941 67
245 3300009177 Ga0105248_12233806 Ga0105248_122338061 67
246 3300009545 Ga0105237_10088308 Ga0105237_100883083 67
247 3300009545 Ga0105237_10120564 Ga0105237_101205642 67
248 3300009545 Ga0105237_10736282 Ga0105237_107362823 67
249 3300009551 Ga0105238_10020827 Ga0105238_100208277 67
250 3300009551 Ga0105238_10781069 Ga0105238_107810692 67
251 3300009551 Ga0105238_10819065 Ga0105238_108190651 67
252 3300009553 Ga0105249_10203210 Ga0105249_102032102 67
253 3300009553 Ga0105249_10211432 Ga0105249_102114322 67
254 3300009553 Ga0105249_11702719 Ga0105249_117027191 67
255 3300009553 Ga0105249_12101419 Ga0105249_121014191 67
256 3300009553 Ga0105249_12983364 Ga0105249_129833641 67
257 3300010375 Ga0105239_10111552 Ga0105239_101115524 67
258 3300010375 Ga0105239_10621559 Ga0105239_106215592 67
259 3300010375 Ga0105239_11167630 Ga0105239_111676302 67
260 3300010375 Ga0105239_13482531 Ga0105239_134825311 67
261 3300011119 Ga0105246_10027459 Ga0105246_100274593 67
262 3300011119 Ga0105246_10170182 Ga0105246_101701822 67
263 3300011119 Ga0105246_10753653 Ga0105246_107536531 67
264 3300011119 Ga0105246_11772598 Ga0105246_117725982 67
265 3300013102 Ga0157371_10190198 Ga0157371_101901983 67
266 3300013102 Ga0157371_11182057 Ga0157371_111820571 67
267 3300013104 Ga0157370_10212012 Ga0157370_102120124 67
268 3300013296 Ga0157374_10808412 Ga0157374_108084121 67
269 3300013306 Ga0163162_10097041 Ga0163162_100970413 67
270 3300013306 Ga0163162_10766286 Ga0163162_107662862 67
271 3300013306 Ga0163162_10862717 Ga0163162_108627172 67
272 3300013306 Ga0163162_11343259 Ga0163162_113432592 67
273 3300013306 Ga0163162_11383608 Ga0163162_113836081 67
274 3300013306 Ga0163162_11478242 Ga0163162_114782422 67
275 3300013307 Ga0157372_10040300 Ga0157372_100403001 67
276 3300013307 Ga0157372_10569961 Ga0157372_105699613 67
277 3300013307 Ga0157372_12314821 Ga0157372_123148212 67
278 3300013307 Ga0157372_12971660 Ga0157372_129716602 67
279 3300013308 Ga0157375_10461886 Ga0157375_104618862 67
280 3300013308 Ga0157375_10850104 Ga0157375_108501042 67
281 3300013308 Ga0157375_12108423 Ga0157375_121084232 67
282 3300013308 Ga0157375_13590201 Ga0157375_135902012 67
283 3300014325 Ga0163163_10043188 Ga0163163_100431886 67
284 3300014325 Ga0163163_10078878 Ga0163163_100788785 67
285 3300014325 Ga0163163_10858482 Ga0163163_108584821 67
286 3300014325 Ga0163163_11059568 Ga0163163_110595682 67
287 3300014326 Ga0157380_10596324 Ga0157380_105963243 67
288 3300014326 Ga0157380_10745133 Ga0157380_107451333 67
289 3300014326 Ga0157380_13474691 Ga0157380_134746912 67
290 3300014497 Ga0182008_10161540 Ga0182008_101615401 67
291 3300014497 Ga0182008_10414837 Ga0182008_104148371 67
292 3300014968 Ga0157379_10005028 Ga0157379_100050287 67
293 3300014968 Ga0157379_10010528 Ga0157379_100105289 67
294 3300014968 Ga0157379_10260678 Ga0157379_102606783 67
295 3300014968 Ga0157379_10324024 Ga0157379_103240242 67
296 3300014969 Ga0157376_10478734 Ga0157376_104787342 67
297 3300015261 Ga0182006_1232934 Ga0182006_12329342 67
298 3300020069 Ga0197907_10092187 Ga0197907_100921871 67
299 3300020069 Ga0197907_10239788 Ga0197907_102397881 67
300 3300020069 Ga0197907_10973848 Ga0197907_109738481 67
301 3300020069 Ga0197907_11102414 Ga0197907_111024141 67
302 3300020070 Ga0206356_11646062 Ga0206356_116460624 67
303 3300020076 Ga0206355_1123530 Ga0206355_11235301 67
304 3300020076 Ga0206355_1688314 Ga0206355_16883141 67
305 3300020078 Ga0206352_10274325 Ga0206352_102743251 67
306 3300020080 Ga0206350_11398817 Ga0206350_113988172 67
307 3300020081 Ga0206354_10523478 Ga0206354_105234782 67
308 3300020081 Ga0206354_11018118 Ga0206354_110181181 67
309 3300020081 Ga0206354_11697946 Ga0206354_116979462 67
310 3300020082 Ga0206353_10172718 Ga0206353_101727183 67
311 3300020082 Ga0206353_11084932 Ga0206353_110849321 67
312 3300020082 Ga0206353_11499693 Ga0206353_114996931 67
313 3300020082 Ga0206353_11826723 Ga0206353_118267233 67
314 3300020610 Ga0154015_1534401 Ga0154015_15344011 67
315 3300021384 Ga0213876_10031767 Ga0213876_100317673 67
316 3300021384 Ga0213876_10037964 Ga0213876_100379644 67
317 3300021384 Ga0213876_10145291 Ga0213876_101452913 67
318 3300021384 Ga0213876_10230597 Ga0213876_102305972 67
319 3300021388 Ga0213875_10394599 Ga0213875_103945991 67
320 3300021388 Ga0213875_10433333 Ga0213875_104333331 67
321 3300021388 Ga0213875_10627677 Ga0213875_106276771 67
322 3300022467 Ga0224712_10076530 Ga0224712_100765303 67
323 3300022467 Ga0224712_10449919 Ga0224712_104499192 67
324 3300022467 Ga0224712_10667780 Ga0224712_106677801 67
325 3300023672 Ga0247553_110050 Ga0247553_1100501 67
326 3300024225 Ga0224572_1019933 Ga0224572_10199331 67
327 3300025898 Ga0207692_10011924 Ga0207692_100119242 67
328 3300025898 Ga0207692_11013671 Ga0207692_110136711 67
329 3300025899 Ga0207642_10172657 Ga0207642_101726572 67
330 3300025899 Ga0207642_10537377 Ga0207642_105373771 67
331 3300025900 Ga0207710_10124959 Ga0207710_101249592 67
332 3300025901 Ga0207688_10003660 Ga0207688_1000366011 67
333 3300025903 Ga0207680_10032628 Ga0207680_100326282 67
334 3300025903 Ga0207680_10138418 Ga0207680_101384182 67
335 3300025903 Ga0207680_10858332 Ga0207680_108583321 67
336 3300025904 Ga0207647_10242412 Ga0207647_102424122 67
337 3300025906 Ga0207699_11457374 Ga0207699_114573741 67
338 3300025908 Ga0207643_10019178 Ga0207643_1001917810 67
339 3300025908 Ga0207643_10290889 Ga0207643_102908892 67
340 3300025909 Ga0207705_10610596 Ga0207705_106105963 67
341 3300025909 Ga0207705_10647338 Ga0207705_106473382 67
342 3300025909 Ga0207705_10891066 Ga0207705_108910662 67
343 3300025911 Ga0207654_10415930 Ga0207654_104159302 67
344 3300025912 Ga0207707_10032934 Ga0207707_100329345 67
345 3300025912 Ga0207707_10444550 Ga0207707_104445501 67
346 3300025912 Ga0207707_11056780 Ga0207707_110567801 67
347 3300025913 Ga0207695_10158233 Ga0207695_101582333 67
348 3300025913 Ga0207695_11227611 Ga0207695_112276111 67
349 3300025914 Ga0207671_10056406 Ga0207671_100564062 67
350 3300025914 Ga0207671_10578605 Ga0207671_105786051 67
351 3300025914 Ga0207671_10634694 Ga0207671_106346941 67
352 3300025914 Ga0207671_10757848 Ga0207671_107578481 67
353 3300025915 Ga0207693_10109594 Ga0207693_101095941 67
354 3300025915 Ga0207693_10127483 Ga0207693_101274833 67
355 3300025915 Ga0207693_10248343 Ga0207693_102483433 67
356 3300025915 Ga0207693_10314872 Ga0207693_103148723 67
357 3300025915 Ga0207693_11075797 Ga0207693_110757971 67
358 3300025916 Ga0207663_10857561 Ga0207663_108575611 67
359 3300025916 Ga0207663_11363796 Ga0207663_113637961 67
360 3300025917 Ga0207660_10007525 Ga0207660_100075259 67
361 3300025917 Ga0207660_10158944 Ga0207660_101589441 67
362 3300025917 Ga0207660_10944957 Ga0207660_109449572 67
363 3300025917 Ga0207660_11372464 Ga0207660_113724641 67
364 3300025918 Ga0207662_10146599 Ga0207662_101465991 67
365 3300025919 Ga0207657_10027381 Ga0207657_100273815 67
366 3300025919 Ga0207657_10134714 Ga0207657_101347145 67
367 3300025920 Ga0207649_10029488 Ga0207649_100294885 67
368 3300025920 Ga0207649_10419488 Ga0207649_104194881 67
369 3300025920 Ga0207649_10505660 Ga0207649_105056602 67
370 3300025920 Ga0207649_11284417 Ga0207649_112844172 67
371 3300025921 Ga0207652_10003131 Ga0207652_1000313112 67
372 3300025921 Ga0207652_10032286 Ga0207652_100322864 67
373 3300025921 Ga0207652_10762269 Ga0207652_107622691 67
374 3300025923 Ga0207681_10249412 Ga0207681_102494121 67
375 3300025923 Ga0207681_10813039 Ga0207681_108130392 67
376 3300025924 Ga0207694_10042276 Ga0207694_100422765 67
377 3300025924 Ga0207694_10485036 Ga0207694_104850362 67
378 3300025925 Ga0207650_10658635 Ga0207650_106586352 67
379 3300025926 Ga0207659_10902917 Ga0207659_109029171 67
380 3300025927 Ga0207687_10571439 Ga0207687_105714393 67
381 3300025927 Ga0207687_11262171 Ga0207687_112621711 67
382 3300025927 Ga0207687_11658149 Ga0207687_116581492 67
383 3300025928 Ga0207700_10904365 Ga0207700_109043651 67
384 3300025928 Ga0207700_11007578 Ga0207700_110075782 67
385 3300025928 Ga0207700_11029220 Ga0207700_110292202 67
386 3300025928 Ga0207700_11486110 Ga0207700_114861101 67
387 3300025929 Ga0207664_10006553 Ga0207664_100065536 67
388 3300025929 Ga0207664_10323760 Ga0207664_103237602 67
389 3300025929 Ga0207664_11084752 Ga0207664_110847522 67
390 3300025931 Ga0207644_10154217 Ga0207644_101542172 67
391 3300025931 Ga0207644_10924766 Ga0207644_109247662 67
392 3300025932 Ga0207690_10041521 Ga0207690_100415213 67
393 3300025932 Ga0207690_10120307 Ga0207690_101203073 67
394 3300025932 Ga0207690_10123871 Ga0207690_101238713 67
395 3300025933 Ga0207706_10320690 Ga0207706_103206902 67
396 3300025933 Ga0207706_10386689 Ga0207706_103866892 67
397 3300025934 Ga0207686_10313043 Ga0207686_103130432 67
398 3300025934 Ga0207686_10599848 Ga0207686_105998482 67
399 3300025934 Ga0207686_10855341 Ga0207686_108553412 67
400 3300025934 Ga0207686_10872660 Ga0207686_108726601 67
401 3300025935 Ga0207709_10053930 Ga0207709_100539302 67
402 3300025935 Ga0207709_10068603 Ga0207709_100686032 67
403 3300025935 Ga0207709_10389008 Ga0207709_103890084 67
404 3300025935 Ga0207709_10671910 Ga0207709_106719101 67
405 3300025936 Ga0207670_10036264 Ga0207670_100362646 67
406 3300025938 Ga0207704_10856106 Ga0207704_108561061 67
407 3300025940 Ga0207691_10052766 Ga0207691_100527662 67
408 3300025940 Ga0207691_10919030 Ga0207691_109190301 67
409 3300025941 Ga0207711_11824410 Ga0207711_118244101 67
410 3300025941 Ga0207711_12051244 Ga0207711_120512442 67
411 3300025942 Ga0207689_10025277 Ga0207689_100252776 67
412 3300025942 Ga0207689_10547656 Ga0207689_105476561 67
413 3300025944 Ga0207661_10025325 Ga0207661_100253255 67
414 3300025944 Ga0207661_10313609 Ga0207661_103136093 67
415 3300025944 Ga0207661_11673634 Ga0207661_116736341 67
416 3300025945 Ga0207679_10552579 Ga0207679_105525791 67
417 3300025945 Ga0207679_10778668 Ga0207679_107786681 67
418 3300025945 Ga0207679_12153407 Ga0207679_121534071 67
419 3300025949 Ga0207667_10742754 Ga0207667_107427542 67
420 3300025949 Ga0207667_10834386 Ga0207667_108343862 67
421 3300025960 Ga0207651_10275786 Ga0207651_102757861 67
422 3300025961 Ga0207712_10174163 Ga0207712_101741632 67
423 3300025961 Ga0207712_10982705 Ga0207712_109827052 67
424 3300025961 Ga0207712_11004610 Ga0207712_110046102 67
425 3300025972 Ga0207668_10788565 Ga0207668_107885652 67
426 3300025981 Ga0207640_10741274 Ga0207640_107412742 67
427 3300025981 Ga0207640_10750854 Ga0207640_107508541 67
428 3300025986 Ga0207658_10024718 Ga0207658_100247181 67
429 3300025986 Ga0207658_11562399 Ga0207658_115623991 67
430 3300026023 Ga0207677_10190089 Ga0207677_101900892 67
431 3300026035 Ga0207703_10116619 Ga0207703_101166193 67
432 3300026035 Ga0207703_11152083 Ga0207703_111520832 67
433 3300026041 Ga0207639_11072401 Ga0207639_110724011 67
434 3300026067 Ga0207678_10460419 Ga0207678_104604191 67
435 3300026067 Ga0207678_10817585 Ga0207678_108175852 67
436 3300026067 Ga0207678_11323441 Ga0207678_113234412 67
437 3300026075 Ga0207708_10160247 Ga0207708_101602472 67
438 3300026075 Ga0207708_11049557 Ga0207708_110495572 67
439 3300026078 Ga0207702_10014101 Ga0207702_100141012 67
440 3300026078 Ga0207702_10901435 Ga0207702_109014351 67
441 3300026078 Ga0207702_11241220 Ga0207702_112412201 67
442 3300026088 Ga0207641_11386158 Ga0207641_113861582 67
443 3300026088 Ga0207641_12607761 Ga0207641_126077611 67
444 3300026089 Ga0207648_10092311 Ga0207648_100923112 67
445 3300026089 Ga0207648_10313114 Ga0207648_103131143 67
446 3300026089 Ga0207648_11014940 Ga0207648_110149402 67
447 3300026095 Ga0207676_10032636 Ga0207676_100326369 67
448 3300026095 Ga0207676_11485874 Ga0207676_114858741 67
449 3300026116 Ga0207674_10040431 Ga0207674_100404316 67
450 3300026116 Ga0207674_10489005 Ga0207674_104890051 67
451 3300026116 Ga0207674_10614215 Ga0207674_106142151 67
452 3300026116 Ga0207674_10945240 Ga0207674_109452403 67
453 3300026116 Ga0207674_11671768 Ga0207674_116717681 67
454 3300026118 Ga0207675_100276286 Ga0207675_1002762862 67
455 3300026118 Ga0207675_100986012 Ga0207675_1009860122 67
456 3300026118 Ga0207675_102447775 Ga0207675_1024477752 67
457 3300026121 Ga0207683_10413477 Ga0207683_104134772 67
458 3300026121 Ga0207683_11521360 Ga0207683_115213601 67
459 3300026142 Ga0207698_10028653 Ga0207698_100286535 67
460 3300026142 Ga0207698_10324984 Ga0207698_103249841 67
461 3300027876 Ga0209974_10241200 Ga0209974_102412001 67
462 3300027907 Ga0207428_10111641 Ga0207428_101116412 67
463 3300027907 Ga0207428_10284171 Ga0207428_102841712 67
464 3300028379 Ga0268266_10000715 Ga0268266_1000071521 67
465 3300028379 Ga0268266_10130480 Ga0268266_101304802 67
466 3300028380 Ga0268265_10052448 Ga0268265_100524482 67
467 3300028381 Ga0268264_10953111 Ga0268264_109531112 67
468 3300028381 Ga0268264_11516921 Ga0268264_115169212 67
469 3300028800 Ga0265338_10327162 Ga0265338_103271621 67
470 3300028800 Ga0265338_10441942 Ga0265338_104419421 67
471 3300030760 Ga0265762_1162632 Ga0265762_11626322 67
472 3300030836 Ga0265767_106388 Ga0265767_1063882 67
473 3300030863 Ga0265766_1007124 Ga0265766_10071241 67
474 3300031548 Ga0307408_102524544 Ga0307408_1025245441 67
475 3300031727 Ga0316576_10025487 Ga0316576_100254872 67
476 3300031901 Ga0307406_10338782 Ga0307406_103387821 67
477 3300031901 Ga0307406_11625360 Ga0307406_116253601 67
478 3300031995 Ga0307409_100615760 Ga0307409_1006157604 67
479 3300031995 Ga0307409_100749340 Ga0307409_1007493402 67
480 3300032002 Ga0307416_101191273 Ga0307416_1011912731 67
481 3300032002 Ga0307416_101278187 Ga0307416_1012781872 67
482 3300032004 Ga0307414_10567494 Ga0307414_105674942 67
483 3300034820 Ga0373959_0167033 Ga0373959_0167033_99_302 67
484 3300035084 Ga0373928_0114961 Ga0373928_0114961_345_548 67
485 3300035086 Ga0373934_0000135 Ga0373934_0000135_26460_26663 67
486 3300035117 Ga0373953_0000554 Ga0373953_0000554_1785_1988 67
487 3300035118 Ga0373954_0072834 Ga0373954_0072834_898_1101 67
488 3300035119 Ga0373956_0000989 Ga0373956_0000989_7140_7343 67
489 3300035120 Ga0373957_0002047 Ga0373957_0002047_1960_2163 67
490 3300035170 Ga0373943_0039967 Ga0373943_0039967_1882_2085 67
491 3300035172 Ga0373955_0000137 Ga0373955_0000137_28356_28559 67
492 3300035207 Ga0373942_0143643 Ga0373942_0143643_523_726 67
493 3300035241 Ga0373961_0221272 Ga0373961_0221272_391_594 67
494 3300035410 Ga0373924_0003189 Ga0373924_0003189_3429_3632 67
495 3300035691 Ga0373931_0351334 Ga0373931_0351334_597_800 67
496 3300035692 Ga0373935_0536195 Ga0373935_0536195_517_720 67
497 3300035724 Ga0373933_0000015 Ga0373933_0000015_73829_74032 67
498 3300035725 Ga0373947_0701654 Ga0373947_0701654_302_505 67
499 3300036401 Ga0373937_0000053 Ga0373937_0000053_73829_74032 67
500 3300037068 Ga0373925_0474514 Ga0373925_0474514_335_538 67
501 3300037312 Ga0395899_0297731 Ga0395899_0297731_644_847 67
502 3300037418 Ga0395900_0055408 Ga0395900_0055408_861_1064 67
503 3300037418 Ga0395900_0377548 Ga0395900_0377548_415_618 67
504 3300037418 Ga0395900_0455918 Ga0395900_0455918_678_881 67
505 3300037418 Ga0395900_0653451 Ga0395900_0653451_176_379 67
506 3300037418 Ga0395900_0802922 Ga0395900_0802922_298_501 67
507 3300037418 Ga0395900_0886005 Ga0395900_0886005_209_412 67
508 3300037418 Ga0395900_1147943 Ga0395900_1147943_99_302 67
509 3300037418 Ga0395900_1426799 Ga0395900_1426799_276_479 67
510 3300037418 Ga0395900_1681068 Ga0395900_1681068_22_225 67
511 3300037466 Ga0395898_0004284 Ga0395898_0004284_7183_7386 67
512 3300037466 Ga0395898_0043019 Ga0395898_0043019_2466_2669 67
513 3300037466 Ga0395898_0047366 Ga0395898_0047366_1727_1930 67
514 3300037466 Ga0395898_0085742 Ga0395898_0085742_959_1162 67
515 3300037466 Ga0395898_0177753 Ga0395898_0177753_1027_1230 67
516 3300037466 Ga0395898_0293392 Ga0395898_0293392_1070_1273 67
517 3300037466 Ga0395898_0386924 Ga0395898_0386924_920_1123 67
518 3300037466 Ga0395898_0427378 Ga0395898_0427378_482_685 67
519 3300037471 Ga0395905_0484277 Ga0395905_0484277_877_1080 67
520 3300037471 Ga0395905_0896645 Ga0395905_0896645_558_761 67
521 3300037471 Ga0395905_0964298 Ga0395905_0964298_30_233 67
522 3300037471 Ga0395905_1317433 Ga0395905_1317433_59_262 67
523 3300037853 Ga0436364_0034070 Ga0436364_0034070_2054_2257 67
524 3300037853 Ga0436364_0372858 Ga0436364_0372858_210_413 67
525 3300037853 Ga0436364_0893802 Ga0436364_0893802_3577_3780 67
526 3300037853 Ga0436364_0985211 Ga0436364_0985211_410_613 67
527 3300037853 Ga0436364_1286757 Ga0436364_1286757_805_1008 67
528 3300037853 Ga0436364_1422689 Ga0436364_1422689_25_228 67
529 3300038443 Ga0395901_0042302 Ga0395901_0042302_913_1116 67
530 3300038443 Ga0395901_0057070 Ga0395901_0057070_1982_2185 67
531 3300038443 Ga0395901_0101268 Ga0395901_0101268_2788_2991 67
532 3300038443 Ga0395901_0150453 Ga0395901_0150453_800_1003 67
533 3300038443 Ga0395901_0242629 Ga0395901_0242629_644_847 67
534 3300038443 Ga0395901_0346873 Ga0395901_0346873_618_821 67
535 3300038443 Ga0395901_0428782 Ga0395901_0428782_692_895 67
536 3300038443 Ga0395901_0508238 Ga0395901_0508238_565_768 67
537 3300038443 Ga0395901_0510228 Ga0395901_0510228_129_332 67
538 3300038443 Ga0395901_0703250 Ga0395901_0703250_490_693 67
539 3300038443 Ga0395901_0726759 Ga0395901_0726759_754_957 67
540 3300038443 Ga0395901_1290437 Ga0395901_1290437_151_354 67
541 3300038996 Ga0242420_114517 Ga0242420_114517_160_363 67
542 3300039437 Ga0436365_0254787 Ga0436365_0254787_506_709 67
543 3300039437 Ga0436365_0860754 Ga0436365_0860754_954_1157 67
544 3300039437 Ga0436365_1156917 Ga0436365_1156917_845_1048 67
545 3300039437 Ga0436365_1357803 Ga0436365_1357803_660_863 67
546 3300039450 Ga0436363_0314174 Ga0436363_0314174_56_259 67
547 3300039450 Ga0436363_0436762 Ga0436363_0436762_677_880 67
548 3300039450 Ga0436363_0753556 Ga0436363_0753556_189_392 67
549 3300039450 Ga0436363_0814925 Ga0436363_0814925_831_1034 67
550 3300039450 Ga0436363_1693937 Ga0436363_1693937_704_907 67
551 3300039453 Ga0436362_0074627 Ga0436362_0074627_193_396 67
552 3300039453 Ga0436362_0990170 Ga0436362_0990170_268_471 67
553 3300041443 Ga0451789_1165134 Ga0451789_1165134_278_481 67
554 3300041452 Ga0451793_1298945 Ga0451793_1298945_356_559 67
555 3300041456 Ga0451795_0263037 Ga0451795_0263037_408_611 67
556 3300041459 Ga0451800_1364612 Ga0451800_1364612_283_486 67
557 3300041460 Ga0451802_1226528 Ga0451802_1226528_474_677 67
558 3300041463 Ga0451804_0044416 Ga0451804_0044416_441_644 67
559 3300041507 Ga0451851_0708761 Ga0451851_0708761_443_646 67
560 3300041511 Ga0451855_1796818 Ga0451855_1796818_422_625 67
561 3300042013 Ga0439456_097264 Ga0439456_097264_86_289 67
562 3300042461 Ga0439460_0226174 Ga0439460_0226174_18_221 67
563 3300044683 Ga0466965_0720345 Ga0466965_0720345_192_395 67
564 3300044684 Ga0466966_0112099 Ga0466966_0112099_1339_1542 67
565 3300044693 Ga0466961_0099779 Ga0466961_0099779_349_552 67
566 3300044693 Ga0466961_0670796 Ga0466961_0670796_319_522 67
567 3300044694 Ga0466963_0001854 Ga0466963_0001854_7301_7504 67
568 3300044694 Ga0466963_0040517 Ga0466963_0040517_1487_1690 67
569 3300044694 Ga0466963_0178057 Ga0466963_0178057_1181_1384 67
570 3300044719 Ga0466971_0181606 Ga0466971_0181606_572_775 67
571 3300044719 Ga0466971_0329889 Ga0466971_0329889_11_214 67
572 3300044735 Ga0466968_0166505 Ga0466968_0166505_328_531 67
573 3300044735 Ga0466968_0199083 Ga0466968_0199083_196_399 67
574 3300044735 Ga0466968_0359354 Ga0466968_0359354_219_422 67
575 3300044765 Ga0466970_0137838 Ga0466970_0137838_874_1077 67
576 3300044842 Ga0466957_0457415 Ga0466957_0457415_158_361 67
577 3300044901 Ga0466960_0342783 Ga0466960_0342783_296_499 67
578 3300044901 Ga0466960_0413950 Ga0466960_0413950_52_255 67
579 3300045049 Ga0466959_0214896 Ga0466959_0214896_1089_1292 67
580 3300045049 Ga0466959_0248475 Ga0466959_0248475_940_1143 67
581 3300045049 Ga0466959_0332664 Ga0466959_0332664_181_384 67
582 3300045836 Ga0466958_0003571 Ga0466958_0003571_1160_1363 67
583 3300045976 Ga0466967_0020832 Ga0466967_0020832_853_1056 67
584 3300045976 Ga0466967_0170345 Ga0466967_0170345_559_762 67
585 3300045976 Ga0466967_0177322 Ga0466967_0177322_1780_1983 67
586 3300045976 Ga0466967_0533052 Ga0466967_0533052_816_1019 67
587 3300045976 Ga0466967_0812872 Ga0466967_0812872_455_658 67
588 3300045976 Ga0466967_0994020 Ga0466967_0994020_267_470 67
589 3300045976 Ga0466967_2207433 Ga0466967_2207433_94_297 67
590 3300046454 Ga0495592_0000057 Ga0495592_0000057_73829_74032 67
591 3300046462 Ga0495651_0000032 Ga0495651_0000032_73829_74032 67
592 3300046463 Ga0495653_0002066 Ga0495653_0002066_1352_1555 67
593 3300046463 Ga0495653_0904477 Ga0495653_0904477_25_228 67
594 3300046471 Ga0495650_0000054 Ga0495650_0000054_248121_248324 67
595 3300046477 Ga0495664_0740530 Ga0495664_0740530_30_233 67
596 3300046511 Ga0495608_0000045 Ga0495608_0000045_29662_29865 67
597 3300046514 Ga0495618_0918626 Ga0495618_0918626_159_362 67
598 3300046516 Ga0495628_0000063 Ga0495628_0000063_28896_29099 67
599 3300046518 Ga0495631_0179580 Ga0495631_0179580_287_490 67
600 3300046518 Ga0495631_0421932 Ga0495631_0421932_61_264 67
601 3300046525 Ga0495663_0143722 Ga0495663_0143722_275_478 67
602 3300046529 Ga0495652_0000003 Ga0495652_0000003_105309_105512 67
603 3300046529 Ga0495652_0000078 Ga0495652_0000078_29057_29260 67
604 3300046536 Ga0495587_0000050 Ga0495587_0000050_73829_74032 67
605 3300046543 Ga0495645_0070538 Ga0495645_0070538_2057_2260 67
606 3300046543 Ga0495645_0099480 Ga0495645_0099480_1695_1898 67
607 3300046559 Ga0495667_0000055 Ga0495667_0000055_73829_74032 67
608 3300046616 Ga0495668_0687304 Ga0495668_0687304_203_406 67
609 3300046663 Ga0495635_0936874 Ga0495635_0936874_144_347 67
610 3300046663 Ga0495635_0979017 Ga0495635_0979017_282_485 67
611 3300046664 Ga0495659_0518246 Ga0495659_0518246_52_261 67
612 3300046674 Ga0495588_0334251 Ga0495588_0334251_318_521 67
613 3300046675 Ga0495657_0000009 Ga0495657_0000009_29080_29283 67
614 3300046678 Ga0495599_0000033 Ga0495599_0000033_77171_77374 67
615 3300046678 Ga0495599_0079939 Ga0495599_0079939_1458_1661 67
616 3300046679 Ga0495623_0000423 Ga0495623_0000423_7330_7533 67
617 3300046680 Ga0495646_0008673 Ga0495646_0008673_3497_3700 67
618 3300046680 Ga0495646_0660734 Ga0495646_0660734_314_517 67
619 3300046809 Ga0495600_0001649 Ga0495600_0001649_11824_12027 67
620 3300047317 Ga0495604_0000052 Ga0495604_0000052_73829_74032 67
621 3300047320 Ga0495672_0012173 Ga0495672_0012173_3233_3439 67
622 3300047320 Ga0495672_0118602 Ga0495672_0118602_549_752 67
623 3300047321 Ga0495676_1032985 Ga0495676_1032985_268_471 67
624 3300047322 Ga0495680_0000027 Ga0495680_0000027_62002_62205 67
625 3300047444 Ga0495675_0000399 Ga0495675_0000399_18989_19192 67
626 3300047471 Ga0495684_0923875 Ga0495684_0923875_162_365 67
627 3300048088 Ga0495602_0000236 Ga0495602_0000236_39185_39388 67
628 3300048089 Ga0495614_0600091 Ga0495614_0600091_158_361 67
629 3300048903 Ga0496100_0068291 Ga0496100_0068291_143_346 67
630 3300048903 Ga0496100_0120824 Ga0496100_0120824_69_272 67
631 3300048903 Ga0496100_0122062 Ga0496100_0122062_886_1089 67
632 3300048903 Ga0496100_0241510 Ga0496100_0241510_1035_1253 67
633 3300048904 Ga0496101_0006828 Ga0496101_0006828_4882_5085 67
634 3300048904 Ga0496101_0016994 Ga0496101_0016994_3023_3226 67
635 3300048904 Ga0496101_0068115 Ga0496101_0068115_1268_1471 67
636 3300048904 Ga0496101_0129260 Ga0496101_0129260_84_302 67
637 3300048905 Ga0496102_0034938 Ga0496102_0034938_2871_3074 67
638 3300048905 Ga0496102_0424111 Ga0496102_0424111_444_662 67
639 3300048905 Ga0496102_1463731 Ga0496102_1463731_316_519 67
640 3300048905 Ga0496102_1477980 Ga0496102_1477980_218_421 67
641 3300048906 Ga0496103_0250179 Ga0496103_0250179_775_978 67
642 3300048907 Ga0496104_0047023 Ga0496104_0047023_2156_2359 67
643 3300048907 Ga0496104_0166197 Ga0496104_0166197_487_690 67
644 3300048908 Ga0496105_0066026 Ga0496105_0066026_798_1001 67
645 3300048908 Ga0496105_0520850 Ga0496105_0520850_558_761 67
646 3300048908 Ga0496105_1029712 Ga0496105_1029712_122_325 67
647 3300048909 Ga0496106_0004461 Ga0496106_0004461_9748_9951 67
648 3300048909 Ga0496106_0382104 Ga0496106_0382104_495_698 67
649 3300048909 Ga0496106_0569430 Ga0496106_0569430_225_428 67
650 3300048909 Ga0496106_0573584 Ga0496106_0573584_427_630 67
651 3300048909 Ga0496106_1458149 Ga0496106_1458149_120_323 67
652 3300048910 Ga0496107_0008235 Ga0496107_0008235_941_1144 67
653 3300048910 Ga0496107_0141702 Ga0496107_0141702_757_960 67
654 3300048910 Ga0496107_0176240 Ga0496107_0176240_965_1168 67
655 3300048910 Ga0496107_0320390 Ga0496107_0320390_227_430 67
656 3300048911 Ga0496108_0146980 Ga0496108_0146980_1613_1816 67
657 3300048911 Ga0496108_0790283 Ga0496108_0790283_377_580 67
658 3300048911 Ga0496108_1527511 Ga0496108_1527511_263_466 67
659 3300048912 Ga0496109_0237577 Ga0496109_0237577_411_614 67
660 3300048912 Ga0496109_1068438 Ga0496109_1068438_523_726 67
661 3300048913 Ga0496110_0214905 Ga0496110_0214905_443_646 67
662 3300048913 Ga0496110_0325196 Ga0496110_0325196_982_1185 67
663 3300048913 Ga0496110_0368370 Ga0496110_0368370_796_999 67
664 3300048913 Ga0496110_0833710 Ga0496110_0833710_506_709 67
665 3300048913 Ga0496110_1488204 Ga0496110_1488204_103_306 67
666 3300048914 Ga0496111_0079671 Ga0496111_0079671_353_556 67
667 3300048914 Ga0496111_0108417 Ga0496111_0108417_862_1065 67
668 3300048914 Ga0496111_0251187 Ga0496111_0251187_461_664 67
669 3300048914 Ga0496111_0313845 Ga0496111_0313845_519_722 67
670 3300048915 Ga0496112_0041797 Ga0496112_0041797_2361_2564 67
671 3300048915 Ga0496112_0476225 Ga0496112_0476225_842_1045 67
672 3300048915 Ga0496112_0504950 Ga0496112_0504950_454_657 67
673 3300048915 Ga0496112_1191869 Ga0496112_1191869_115_318 67
674 3300048916 Ga0496113_0147470 Ga0496113_0147470_285_488 67
675 3300048917 Ga0496114_0234038 Ga0496114_0234038_1258_1461 67
676 3300048918 Ga0496115_0043427 Ga0496115_0043427_1618_1821 67
677 3300048918 Ga0496115_0163769 Ga0496115_0163769_660_863 67
678 3300048919 Ga0496116_0001112 Ga0496116_0001112_10894_11097 67
679 3300048921 Ga0496118_0023973 Ga0496118_0023973_3698_3901 67
680 3300048922 Ga0496119_0001214 Ga0496119_0001214_10903_11106 67
681 3300048922 Ga0496119_0014838 Ga0496119_0014838_3789_3992 67
682 3300048922 Ga0496119_0134046 Ga0496119_0134046_378_581 67
683 3300048924 Ga0496121_0067583 Ga0496121_0067583_527_730 67
684 3300048924 Ga0496121_0287381 Ga0496121_0287381_136_339 67
685 3300048927 Ga0496124_0021502 Ga0496124_0021502_5510_5713 67
686 3300048927 Ga0496124_0683608 Ga0496124_0683608_179_382 67
687 3300048928 Ga0496125_0559540 Ga0496125_0559540_403_606 67
688 3300048929 Ga0496126_0019663 Ga0496126_0019663_5553_5756 67
689 3300048929 Ga0496126_0032528 Ga0496126_0032528_4350_4553 67
690 3300048929 Ga0496126_0695093 Ga0496126_0695093_477_680 67
691 3300048929 Ga0496126_0811277 Ga0496126_0811277_409_612 67
692 3300049533 Ga0501317_110580 Ga0501317_110580_202_405 67
693 3300049534 Ga0501318_055940 Ga0501318_055940_224_427 67
694 3300049541 Ga0501325_048641 Ga0501325_048641_205_408 67
695 3300049568 Ga0501031_0003150 Ga0501031_0003150_8616_8819 67
696 3300049569 Ga0501032_0001503 Ga0501032_0001503_9616_9819 67
697 3300049569 Ga0501032_0556670 Ga0501032_0556670_373_576 67
698 3300049570 Ga0501033_0004824 Ga0501033_0004824_1770_1973 67
699 3300049571 Ga0501034_0007306 Ga0501034_0007306_41_244 67
700 3300049571 Ga0501034_0013330 Ga0501034_0013330_6494_6697 67
701 3300049571 Ga0501034_0999368 Ga0501034_0999368_58_261 67
702 3300049572 Ga0501036_0004677 Ga0501036_0004677_1063_1266 67
703 3300049573 Ga0501037_0003839 Ga0501037_0003839_8790_8993 67
704 3300049574 Ga0501038_0006610 Ga0501038_0006610_8762_8965 67
705 3300049575 Ga0501039_0004345 Ga0501039_0004345_8775_8978 67
706 3300049576 Ga0501040_0005368 Ga0501040_0005368_6387_6590 67
707 3300049578 Ga0501042_0012040 Ga0501042_0012040_4646_4849 67
708 3300049579 Ga0501043_0001223 Ga0501043_0001223_21416_21619 67
709 3300049580 Ga0501046_0006075 Ga0501046_0006075_1766_1969 67
710 3300049581 Ga0501047_0006595 Ga0501047_0006595_8783_8986 67
711 3300049582 Ga0501048_0004454 Ga0501048_0004454_8698_8901 67
712 3300049584 Ga0501068_0035333 Ga0501068_0035333_1698_1901 67
713 3300049584 Ga0501068_0497168 Ga0501068_0497168_87_290 67
714 3300049585 Ga0501069_0030901 Ga0501069_0030901_943_1146 67
715 3300049585 Ga0501069_0176141 Ga0501069_0176141_768_971 67
716 3300049586 Ga0501070_0000793 Ga0501070_0000793_6061_6264 67
717 3300049586 Ga0501070_0005358 Ga0501070_0005358_1770_1973 67
718 3300049589 Ga0501073_0051019 Ga0501073_0051019_926_1129 67
719 3300049590 Ga0501074_0003906 Ga0501074_0003906_1643_1846 67
720 3300049592 Ga0501076_0836129 Ga0501076_0836129_379_582 67
721 3300049656 Ga0501209_191789 Ga0501209_191789_251_454 67
722 3300049741 Ga0501079_0052396 Ga0501079_0052396_1056_1259 67
723 3300049742 Ga0501080_0073910 Ga0501080_0073910_1878_2081 67
724 3300049742 Ga0501080_0469572 Ga0501080_0469572_90_293 67
725 3300049744 Ga0501083_0044176 Ga0501083_0044176_1756_1959 67
726 3300049822 Ga0501035_0006695 Ga0501035_0006695_8796_8999 67
727 3300049823 Ga0501044_0009251 Ga0501044_0009251_1770_1973 67
728 3300049824 Ga0501045_0125907 Ga0501045_0125907_979_1182 67
729 3300050490 nmdc:mga03n38_588012_c1 nmdc:mga03n38_588012_c1_259_462 67
730 3300050491 nmdc:mga00v17_996262_c1 nmdc:mga00v17_996262_c1_48_251 67
731 3300050492 nmdc:mga0yw44_1098678_c1 nmdc:mga0yw44_1098678_c1_179_382 67
732 3300050492 nmdc:mga0yw44_882158_c1 nmdc:mga0yw44_882158_c1_34_237 67
733 3300050510 nmdc:mga06r32_366023_c1 nmdc:mga06r32_366023_c1_955_1158 67
734 3300050511 nmdc:mga08y16_1090195_c1 nmdc:mga08y16_1090195_c1_508_711 67
735 3300050511 nmdc:mga08y16_552639_c1 nmdc:mga08y16_552639_c1_68_271 67
736 3300050511 nmdc:mga08y16_839682_c1 nmdc:mga08y16_839682_c1_473_676 67
737 3300050512 nmdc:mga0n895_901426_c1 nmdc:mga0n895_901426_c1_446_649 67
738 3300050515 nmdc:mga0a205_1095873_c1 nmdc:mga0a205_1095873_c1_246_449 67
739 3300050515 nmdc:mga0a205_861382_c1 nmdc:mga0a205_861382_c1_249_452 67
740 3300053077 Ga0495601_0321107 Ga0495601_0321107_45_248 67
741 3300053077 Ga0495601_0520981 Ga0495601_0520981_248_451 67
742 3300053083 Ga0495655_0054357 Ga0495655_0054357_418_627 67
743 3300053083 Ga0495655_0086265 Ga0495655_0086265_459_662 67
744 3300053083 Ga0495655_0122737 Ga0495655_0122737_92_295 67
745 3300053083 Ga0495655_0166949 Ga0495655_0166949_433_636 67
746 3300053084 Ga0495595_0000236 Ga0495595_0000236_19339_19542 67
747 3300053085 Ga0495619_0176001 Ga0495619_0176001_662_865 67
748 3300053119 Ga0500595_121452 Ga0500595_121452_390_593 67
749 3300053153 Ga0500616_0005157 Ga0500616_0005157_4264_4467 67
750 3300053160 Ga0500633_0385797 Ga0500633_0385797_72_275 67
751 3300059491 Ga0587070_182123 Ga0587070_182123_263_466 67
752 3300059492 Ga0587073_0285125 Ga0587073_0285125_91_294 67
753 3300059505 Ga0587083_0262879 Ga0587083_0262879_152_355 67
754 3300059508 Ga0587088_162535 Ga0587088_162535_276_479 67
755 3300059508 Ga0587088_167909 Ga0587088_167909_151_354 67
756 3300059509 Ga0587089_103946 Ga0587089_103946_284_493 67
757 3300059630 Ga0587128_041580 Ga0587128_041580_92_295 67
758 3300059640 Ga0587067_202510 Ga0587067_202510_233_436 67
759 3300059647 Ga0587079_150043 Ga0587079_150043_268_471 67
760 3300059655 Ga0587114_041631 Ga0587114_041631_241_444 67
761 3300059655 Ga0587114_133851 Ga0587114_133851_87_290 67
762 3300060346 Ga0587111_0229322 Ga0587111_0229322_103_306 67
763 3300061719 Ga0466962_0493019 Ga0466962_0493019_307_510 67
764 3300005329 Ga0070683_100366571 Ga0070683_1003665713 68
765 3300005329 Ga0070683_102220985 Ga0070683_1022209852 68
766 3300005338 Ga0068868_100313688 Ga0068868_1003136882 68
767 3300005439 Ga0070711_100322223 Ga0070711_1003222232 68
768 3300005440 Ga0070705_100434784 Ga0070705_1004347842 68
769 3300005459 Ga0068867_101653153 Ga0068867_1016531531 68
770 3300005535 Ga0070684_100419587 Ga0070684_1004195872 68
771 3300005844 Ga0068862_101270586 Ga0068862_1012705862 68
772 3300006175 Ga0070712_100152915 Ga0070712_1001529153 68
773 3300009098 Ga0105245_10495140 Ga0105245_104951402 68
774 3300013105 Ga0157369_12503444 Ga0157369_125034441 68
775 3300013297 Ga0157378_10452082 Ga0157378_104520823 68
776 3300020082 Ga0206353_10378576 Ga0206353_103785762 68
777 3300025915 Ga0207693_10323124 Ga0207693_103231242 68
778 3300025916 Ga0207663_10305387 Ga0207663_103053872 68
779 3300025921 Ga0207652_10058819 Ga0207652_100588192 68
780 3300025927 Ga0207687_11263772 Ga0207687_112637722 68
781 3300025934 Ga0207686_10489907 Ga0207686_104899071 68
782 3300025944 Ga0207661_10322800 Ga0207661_103228003 68
783 3300025944 Ga0207661_11862409 Ga0207661_118624091 68
784 3300026023 Ga0207677_10301622 Ga0207677_103016222 68
785 3300026089 Ga0207648_10369901 Ga0207648_103699013 68
786 3300028380 Ga0268265_10518935 Ga0268265_105189352 68
787 3300031548 Ga0307408_101303121 Ga0307408_1013031211 68
788 3300041443 Ga0451789_0651530 Ga0451789_0651530_524_730 68
789 3300046525 Ga0495663_0174304 Ga0495663_0174304_408_614 68
790 3300046690 Ga0495624_0927104 Ga0495624_0927104_141_347 68
791 3300047320 Ga0495672_0224915 Ga0495672_0224915_588_794 68
792 3300000041 ARcpr5oldR_c028004 ARcpr5oldR_0280042 69
793 3300000652 ARCol0yngRDRAFT_1005103 ARCol0yngRDRAFT_10051032 69
794 3300006844 Ga0075428_102103825 Ga0075428_1021038252 69
795 3300006852 Ga0075433_10267077 Ga0075433_102670772 69
796 3300007076 Ga0075435_101076346 Ga0075435_1010763462 69
797 3300009094 Ga0111539_10552617 Ga0111539_105526174 69
798 3300009147 Ga0114129_10381103 Ga0114129_103811035 69
799 3300012481 Ga0157320_1007222 Ga0157320_10072222 69
800 3300012483 Ga0157337_1033561 Ga0157337_10335612 69
801 3300012487 Ga0157321_1001289 Ga0157321_10012892 69
802 3300012494 Ga0157341_1014435 Ga0157341_10144352 69
803 3300012500 Ga0157314_1005879 Ga0157314_10058792 69
804 3300012510 Ga0157316_1001102 Ga0157316_10011025 69
805 3300027907 Ga0207428_10727435 Ga0207428_107274352 69
806 3300050507 nmdc:mga05p37_929068_c1 nmdc:mga05p37_929068_c1_246_455 69
807 3300050511 nmdc:mga08y16_1636592_c1 nmdc:mga08y16_1636592_c1_86_295 69
808 3300050511 nmdc:mga08y16_405079_c1 nmdc:mga08y16_405079_c1_242_451 69
809 3300050512 nmdc:mga0n895_1496674_c1 nmdc:mga0n895_1496674_c1_20_229 69
810 3300050513 nmdc:mga0rr50_1664719_c1 nmdc:mga0rr50_1664719_c1_276_485 69
811 3300050515 nmdc:mga0a205_44804_c2 nmdc:mga0a205_44804_c2_414_623 69

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

9

74

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.978 2 67
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9701 2 67
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9679 1 67
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9669 1 68
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9619 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9691 2 64 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9601 2 64 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9593 2 64 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9499 2 67 2.40.50.140
5o6fA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9304 1 69 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7K0C223-F1-model_v4 Cold shock protein CapB 1.004 2 67 GO:0003676
GO:0005737
AF-A0A7V9UEA4-F1-model_v4 DEAD/DEAH box helicase 1.003 1 67 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787
AF-A0A3B8Y5C0-F1-model_v4 Cold-shock protein 1.003 2 67 GO:0003676
GO:0005737
AF-A0A7X8IDF8-F1-model_v4 Cold shock domain-containing protein 1.002 2 67 GO:0003676
GO:0005737
AF-A0A381X0R8-F1-model_v4 CSD domain-containing protein 1.002 2 67 GO:0003676
GO:0005737

Feature Viewer

pLDDT pTM Quality
89.58 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map