F481840
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 811 | 404 | 810 | 67 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_12045100|Ga0105245_120451002 |
| Length | 74 |
| Sequence | MSRGGKDMATGTVKWFNDDKGFGFITPDDSGKDLFVHHSAINANGYKSLAEGAKVSYDAEAGDKGPKAVNVTAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 127 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 128 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 129 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 130 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 131 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 149 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 257 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 258 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 262 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 269 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 270 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 271 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 272 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 337 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 338 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.73 |
| Metatranscriptomes | 7.15 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.36 |
| Nodule | 0 |
| Rhizoplane | 7.03 |
| Rhizosphere | 85.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c028004 | 3300000041 | Bacteria | 523 |
| 2 | ARCol0yngRDRAFT_1005103 | 3300000652 | Unclassified | 946 |
| 3 | JGI24752J21851_1039726 | 3300001976 | Bacteria | 629 |
| 4 | JGI24739J22299_10176951 | 3300001989 | Bacteria | 628 |
| 5 | JGI24737J22298_10120012 | 3300001990 | Bacteria | 777 |
| 6 | JGI24743J22301_10111487 | 3300001991 | Bacteria | 595 |
| 7 | JGI24735J21928_10146789 | 3300002067 | Bacteria | 681 |
| 8 | JGI24750J21931_1032661 | 3300002070 | Bacteria | 769 |
| 9 | JGI24738J21930_10043036 | 3300002075 | Bacteria | 918 |
| 10 | JGI24744J21845_10088344 | 3300002077 | Bacteria | 568 |
| 11 | Ga0006759J45824_1009337 | 3300003163 | Bacteria | 559 |
| 12 | Ga0006770J48903_1015579 | 3300003305 | Bacteria | 559 |
| 13 | Ga0006777J48905_1007156 | 3300003308 | Bacteria | 568 |
| 14 | rootH2_10173644 | 3300003320 | Bacteria | 1402 |
| 15 | Ga0006781J51513_1005727 | 3300003568 | Bacteria | 570 |
| 16 | Ga0007410J51695_1007933 | 3300003574 | Bacteria | 579 |
| 17 | Ga0007410J51695_1070413 | 3300003574 | Bacteria | 524 |
| 18 | Ga0007409J51694_1008940 | 3300003575 | Bacteria | 674 |
| 19 | Ga0007416J51690_1009552 | 3300003577 | Bacteria | 770 |
| 20 | Ga0007429J51699_1005706 | 3300003579 | Bacteria | 758 |
| 21 | Ga0032354_1006874 | 3300003693 | Bacteria | 622 |
| 22 | Ga0032354_1021963 | 3300003693 | Bacteria | 535 |
| 23 | Ga0006780_1007240 | 3300003735 | Bacteria | 622 |
| 24 | Ga0058863_10086156 | 3300004799 | Bacteria | 735 |
| 25 | Ga0058861_10024356 | 3300004800 | Bacteria | 1442 |
| 26 | Ga0058861_11947429 | 3300004800 | Bacteria | 675 |
| 27 | Ga0058861_12055410 | 3300004800 | Bacteria | 556 |
| 28 | Ga0058862_12747784 | 3300004803 | Bacteria | 803 |
| 29 | Ga0070658_10103253 | 3300005327 | Bacteria | 2358 |
| 30 | Ga0070658_11101661 | 3300005327 | Bacteria | 691 |
| 31 | Ga0070683_100025174 | 3300005329 | Bacteria | 5341 |
| 32 | Ga0070683_100029003 | 3300005329 | Bacteria | 5006 |
| 33 | Ga0070683_100366571 | 3300005329 | Bacteria | 1372 |
| 34 | Ga0070683_100946691 | 3300005329 | Bacteria | 826 |
| 35 | Ga0070683_101255292 | 3300005329 | Bacteria | 712 |
| 36 | Ga0070683_102220985 | 3300005329 | Bacteria | 527 |
| 37 | Ga0070690_100209619 | 3300005330 | Bacteria | 1360 |
| 38 | Ga0070690_100740480 | 3300005330 | Bacteria | 758 |
| 39 | Ga0070670_100491451 | 3300005331 | Bacteria | 1091 |
| 40 | Ga0068869_100131270 | 3300005334 | Bacteria | 1926 |
| 41 | Ga0068869_101925432 | 3300005334 | Bacteria | 530 |
| 42 | Ga0068869_102089018 | 3300005334 | Bacteria | 509 |
| 43 | Ga0070666_10284923 | 3300005335 | Bacteria | 1175 |
| 44 | Ga0070680_100009178 | 3300005336 | Bacteria | 7585 |
| 45 | Ga0070680_100404398 | 3300005336 | Bacteria | 1164 |
| 46 | Ga0070680_101121810 | 3300005336 | Bacteria | 680 |
| 47 | Ga0070680_101571737 | 3300005336 | Bacteria | 570 |
| 48 | Ga0070682_100013435 | 3300005337 | Bacteria | 4710 |
| 49 | Ga0070682_100046836 | 3300005337 | Bacteria | 2685 |
| 50 | Ga0070682_100047953 | 3300005337 | Bacteria | 2658 |
| 51 | Ga0068868_100313688 | 3300005338 | Unclassified | 1335 |
| 52 | Ga0068868_100741762 | 3300005338 | Bacteria | 882 |
| 53 | Ga0070660_100062151 | 3300005339 | Bacteria | 2900 |
| 54 | Ga0070689_100419091 | 3300005340 | Bacteria | 1134 |
| 55 | Ga0070687_100050577 | 3300005343 | Bacteria | 2147 |
| 56 | Ga0070661_100029696 | 3300005344 | Bacteria | 3947 |
| 57 | Ga0070661_100458772 | 3300005344 | Bacteria | 1015 |
| 58 | Ga0070661_100658155 | 3300005344 | Bacteria | 851 |
| 59 | Ga0070661_100754912 | 3300005344 | Bacteria | 796 |
| 60 | Ga0070692_10053130 | 3300005345 | Bacteria | 2112 |
| 61 | Ga0070692_10065551 | 3300005345 | Bacteria | 1923 |
| 62 | Ga0070692_10088816 | 3300005345 | Bacteria | 1677 |
| 63 | Ga0070668_100148388 | 3300005347 | Bacteria | 1894 |
| 64 | Ga0070669_100939135 | 3300005353 | Bacteria | 740 |
| 65 | Ga0070675_100419253 | 3300005354 | Bacteria | 1197 |
| 66 | Ga0070671_100234697 | 3300005355 | Bacteria | 1557 |
| 67 | Ga0070671_101120267 | 3300005355 | Bacteria | 691 |
| 68 | Ga0070674_101242586 | 3300005356 | Bacteria | 662 |
| 69 | Ga0070673_100210805 | 3300005364 | Bacteria | 1678 |
| 70 | Ga0070688_100081477 | 3300005365 | Bacteria | 2096 |
| 71 | Ga0070659_100005205 | 3300005366 | Bacteria | 9336 |
| 72 | Ga0070659_100062916 | 3300005366 | Bacteria | 2934 |
| 73 | Ga0070659_100078511 | 3300005366 | Bacteria | 2633 |
| 74 | Ga0070659_101540249 | 3300005366 | Bacteria | 593 |
| 75 | Ga0070659_101934497 | 3300005366 | Bacteria | 529 |
| 76 | Ga0070667_100289316 | 3300005367 | Bacteria | 1473 |
| 77 | Ga0070667_101024455 | 3300005367 | Bacteria | 770 |
| 78 | Ga0070714_100002604 | 3300005435 | Bacteria | 13295 |
| 79 | Ga0070714_101415437 | 3300005435 | Bacteria | 679 |
| 80 | Ga0070713_100330367 | 3300005436 | Bacteria | 1410 |
| 81 | Ga0070710_10654659 | 3300005437 | Bacteria | 737 |
| 82 | Ga0070701_10275998 | 3300005438 | Bacteria | 1025 |
| 83 | Ga0070701_10406431 | 3300005438 | Bacteria | 864 |
| 84 | Ga0070711_100079542 | 3300005439 | Bacteria | 2332 |
| 85 | Ga0070711_100322223 | 3300005439 | Unclassified | 1235 |
| 86 | Ga0070711_100853051 | 3300005439 | Bacteria | 775 |
| 87 | Ga0070711_101297161 | 3300005439 | Bacteria | 632 |
| 88 | Ga0070705_100434784 | 3300005440 | Unclassified | 980 |
| 89 | Ga0070705_101553901 | 3300005440 | Bacteria | 556 |
| 90 | Ga0070700_100375649 | 3300005441 | Bacteria | 1061 |
| 91 | Ga0070700_100478003 | 3300005441 | Bacteria | 954 |
| 92 | Ga0070700_100539675 | 3300005441 | Bacteria | 904 |
| 93 | Ga0070700_100742285 | 3300005441 | Bacteria | 785 |
| 94 | Ga0070663_100006400 | 3300005455 | Bacteria | 7081 |
| 95 | Ga0070663_100851541 | 3300005455 | Bacteria | 785 |
| 96 | Ga0070663_101167101 | 3300005455 | Bacteria | 675 |
| 97 | Ga0070678_100511701 | 3300005456 | Bacteria | 1061 |
| 98 | Ga0070678_101842352 | 3300005456 | Bacteria | 571 |
| 99 | Ga0070662_101084174 | 3300005457 | Bacteria | 687 |
| 100 | Ga0070662_101166461 | 3300005457 | Bacteria | 662 |
| 101 | Ga0070681_10145576 | 3300005458 | Bacteria | 2298 |
| 102 | Ga0070681_10560106 | 3300005458 | Bacteria | 1057 |
| 103 | Ga0070681_11270119 | 3300005458 | Bacteria | 659 |
| 104 | Ga0068867_100118120 | 3300005459 | Bacteria | 2045 |
| 105 | Ga0068867_101653153 | 3300005459 | Bacteria | 600 |
| 106 | Ga0070685_10185385 | 3300005466 | Bacteria | 1342 |
| 107 | Ga0070706_100348118 | 3300005467 | Bacteria | 1381 |
| 108 | Ga0070707_101753927 | 3300005468 | Bacteria | 588 |
| 109 | Ga0070679_100026157 | 3300005530 | Bacteria | 5729 |
| 110 | Ga0070679_100056108 | 3300005530 | Bacteria | 3924 |
| 111 | Ga0070679_100402260 | 3300005530 | Bacteria | 1315 |
| 112 | Ga0070684_100026063 | 3300005535 | Bacteria | 4920 |
| 113 | Ga0070684_100075858 | 3300005535 | Bacteria | 2966 |
| 114 | Ga0070684_100419587 | 3300005535 | Bacteria | 1235 |
| 115 | Ga0070697_101401191 | 3300005536 | Bacteria | 624 |
| 116 | Ga0068853_100064592 | 3300005539 | Bacteria | 3174 |
| 117 | Ga0070672_100040675 | 3300005543 | Bacteria | 3568 |
| 118 | Ga0070672_100311846 | 3300005543 | Bacteria | 1336 |
| 119 | Ga0070686_100048872 | 3300005544 | Bacteria | 2682 |
| 120 | Ga0070686_100533548 | 3300005544 | Bacteria | 915 |
| 121 | Ga0070696_100341795 | 3300005546 | Bacteria | 1157 |
| 122 | Ga0070696_101011553 | 3300005546 | Bacteria | 695 |
| 123 | Ga0070696_101378053 | 3300005546 | Bacteria | 601 |
| 124 | Ga0070693_100762898 | 3300005547 | Bacteria | 714 |
| 125 | Ga0070693_100925773 | 3300005547 | Bacteria | 655 |
| 126 | Ga0070665_100005382 | 3300005548 | Bacteria | 13218 |
| 127 | Ga0070665_100164791 | 3300005548 | Bacteria | 2219 |
| 128 | Ga0070665_101171359 | 3300005548 | Bacteria | 780 |
| 129 | Ga0070704_100079527 | 3300005549 | Bacteria | 2409 |
| 130 | Ga0070704_100259039 | 3300005549 | Bacteria | 1432 |
| 131 | Ga0070704_100943971 | 3300005549 | Bacteria | 778 |
| 132 | Ga0068855_100317450 | 3300005563 | Bacteria | 1723 |
| 133 | Ga0068855_100739311 | 3300005563 | Bacteria | 1050 |
| 134 | Ga0070664_100032412 | 3300005564 | Bacteria | 4370 |
| 135 | Ga0070664_100506038 | 3300005564 | Bacteria | 1114 |
| 136 | Ga0070664_100525023 | 3300005564 | Bacteria | 1093 |
| 137 | Ga0068857_100073194 | 3300005577 | Bacteria | 3053 |
| 138 | Ga0068857_101346251 | 3300005577 | Bacteria | 694 |
| 139 | Ga0068857_102437117 | 3300005577 | Bacteria | 514 |
| 140 | Ga0068854_100054326 | 3300005578 | Bacteria | 2880 |
| 141 | Ga0068854_100197169 | 3300005578 | Bacteria | 1581 |
| 142 | Ga0068854_100376455 | 3300005578 | Bacteria | 1169 |
| 143 | Ga0068854_100485582 | 3300005578 | Bacteria | 1038 |
| 144 | Ga0068856_100040528 | 3300005614 | Bacteria | 4576 |
| 145 | Ga0068856_100054050 | 3300005614 | Bacteria | 3960 |
| 146 | Ga0068856_100161677 | 3300005614 | Bacteria | 2250 |
| 147 | Ga0070702_100005543 | 3300005615 | Bacteria | 5895 |
| 148 | Ga0070702_100199352 | 3300005615 | Bacteria | 1324 |
| 149 | Ga0068852_100002528 | 3300005616 | Bacteria | 12599 |
| 150 | Ga0068852_100240582 | 3300005616 | Bacteria | 1729 |
| 151 | Ga0068852_102411380 | 3300005616 | Bacteria | 547 |
| 152 | Ga0068859_100722984 | 3300005617 | Bacteria | 1086 |
| 153 | Ga0068864_100151139 | 3300005618 | Bacteria | 2103 |
| 154 | Ga0068864_100907898 | 3300005618 | Bacteria | 870 |
| 155 | Ga0068866_10103734 | 3300005718 | Bacteria | 1574 |
| 156 | Ga0068866_10773972 | 3300005718 | Bacteria | 665 |
| 157 | Ga0068866_11348211 | 3300005718 | Bacteria | 520 |
| 158 | Ga0068861_100435847 | 3300005719 | Bacteria | 1171 |
| 159 | Ga0068851_10314571 | 3300005834 | Bacteria | 903 |
| 160 | Ga0068851_11066196 | 3300005834 | Bacteria | 512 |
| 161 | Ga0068870_10084559 | 3300005840 | Bacteria | 1761 |
| 162 | Ga0068863_101659012 | 3300005841 | Bacteria | 649 |
| 163 | Ga0068858_100042042 | 3300005842 | Bacteria | 4237 |
| 164 | Ga0068858_100490229 | 3300005842 | Bacteria | 1187 |
| 165 | Ga0068860_101062020 | 3300005843 | Bacteria | 829 |
| 166 | Ga0068860_101248419 | 3300005843 | Bacteria | 764 |
| 167 | Ga0068860_101901347 | 3300005843 | Bacteria | 617 |
| 168 | Ga0068862_100036198 | 3300005844 | Bacteria | 4183 |
| 169 | Ga0068862_101270586 | 3300005844 | Unclassified | 737 |
| 170 | Ga0081455_10062009 | 3300005937 | Bacteria | 3144 |
| 171 | Ga0081455_10220635 | 3300005937 | Bacteria | 1405 |
| 172 | Ga0081455_10229457 | 3300005937 | Bacteria | 1371 |
| 173 | Ga0081455_10513489 | 3300005937 | Bacteria | 801 |
| 174 | Ga0081538_10002285 | 3300005981 | Bacteria | 18925 |
| 175 | Ga0081539_10009105 | 3300005985 | Bacteria | 8401 |
| 176 | Ga0081539_10020386 | 3300005985 | Bacteria | 4484 |
| 177 | Ga0081539_10218691 | 3300005985 | Bacteria | 868 |
| 178 | Ga0081539_10435876 | 3300005985 | Bacteria | 543 |
| 179 | Ga0070717_10013602 | 3300006028 | Bacteria | 6243 |
| 180 | Ga0070717_10264087 | 3300006028 | Bacteria | 1523 |
| 181 | Ga0070717_10364462 | 3300006028 | Bacteria | 1294 |
| 182 | Ga0075365_10874710 | 3300006038 | Bacteria | 634 |
| 183 | Ga0075363_100393107 | 3300006048 | Bacteria | 814 |
| 184 | Ga0075364_10279860 | 3300006051 | Bacteria | 1135 |
| 185 | Ga0075432_10348788 | 3300006058 | Bacteria | 627 |
| 186 | Ga0070715_10234547 | 3300006163 | Bacteria | 951 |
| 187 | Ga0070712_100040365 | 3300006175 | Bacteria | 3200 |
| 188 | Ga0070712_100090701 | 3300006175 | Bacteria | 2238 |
| 189 | Ga0070712_100152915 | 3300006175 | Unclassified | 1773 |
| 190 | Ga0070712_100207020 | 3300006175 | Bacteria | 1545 |
| 191 | Ga0070712_100552258 | 3300006175 | Bacteria | 970 |
| 192 | Ga0070712_100873284 | 3300006175 | Bacteria | 774 |
| 193 | Ga0070712_101875812 | 3300006175 | Bacteria | 525 |
| 194 | Ga0097621_102050385 | 3300006237 | Bacteria | 547 |
| 195 | Ga0068871_100301781 | 3300006358 | Bacteria | 1406 |
| 196 | Ga0075428_100007826 | 3300006844 | Bacteria | 11845 |
| 197 | Ga0075428_101404487 | 3300006844 | Bacteria | 733 |
| 198 | Ga0075428_102103825 | 3300006844 | Bacteria | 584 |
| 199 | Ga0075430_100686870 | 3300006846 | Bacteria | 844 |
| 200 | Ga0075431_100914499 | 3300006847 | Bacteria | 847 |
| 201 | Ga0075433_10267077 | 3300006852 | Unclassified | 1516 |
| 202 | Ga0075433_10926550 | 3300006852 | Bacteria | 760 |
| 203 | Ga0075433_11451899 | 3300006852 | Bacteria | 593 |
| 204 | Ga0075433_11575123 | 3300006852 | Bacteria | 567 |
| 205 | Ga0075434_100905870 | 3300006871 | Bacteria | 897 |
| 206 | Ga0068865_100144646 | 3300006881 | Bacteria | 1797 |
| 207 | Ga0097620_100723026 | 3300006931 | Bacteria | 1086 |
| 208 | Ga0075435_101076346 | 3300007076 | Bacteria | 703 |
| 209 | Ga0105250_10296314 | 3300009092 | Bacteria | 699 |
| 210 | Ga0105240_10065467 | 3300009093 | Bacteria | 4512 |
| 211 | Ga0105240_10542921 | 3300009093 | Bacteria | 1287 |
| 212 | Ga0105240_10931442 | 3300009093 | Bacteria | 933 |
| 213 | Ga0105240_11674293 | 3300009093 | Bacteria | 664 |
| 214 | Ga0111539_10184773 | 3300009094 | Bacteria | 2435 |
| 215 | Ga0111539_10217989 | 3300009094 | Bacteria | 2223 |
| 216 | Ga0111539_10402244 | 3300009094 | Bacteria | 1595 |
| 217 | Ga0111539_10552617 | 3300009094 | Bacteria | 1341 |
| 218 | Ga0105245_10495140 | 3300009098 | Bacteria | 1238 |
| 219 | Ga0105245_10560527 | 3300009098 | Bacteria | 1165 |
| 220 | Ga0105245_10585998 | 3300009098 | Bacteria | 1140 |
| 221 | Ga0105245_10625767 | 3300009098 | Bacteria | 1105 |
| 222 | Ga0105245_11703325 | 3300009098 | Bacteria | 683 |
| 223 | Ga0105245_12045100 | 3300009098 | Bacteria | 626 |
| 224 | Ga0105247_10214320 | 3300009101 | Bacteria | 1300 |
| 225 | Ga0114129_10381103 | 3300009147 | Bacteria | 1862 |
| 226 | Ga0105243_10044918 | 3300009148 | Bacteria | 3469 |
| 227 | Ga0105243_10174824 | 3300009148 | Bacteria | 1863 |
| 228 | Ga0105243_10418111 | 3300009148 | Bacteria | 1249 |
| 229 | Ga0105241_10917104 | 3300009174 | Bacteria | 814 |
| 230 | Ga0105242_10210140 | 3300009176 | Bacteria | 1734 |
| 231 | Ga0105242_10998434 | 3300009176 | Bacteria | 844 |
| 232 | Ga0105242_11686467 | 3300009176 | Bacteria | 670 |
| 233 | Ga0105248_10684395 | 3300009177 | Bacteria | 1157 |
| 234 | Ga0105248_12048594 | 3300009177 | Bacteria | 650 |
| 235 | Ga0105248_12233806 | 3300009177 | Bacteria | 623 |
| 236 | Ga0105237_10088308 | 3300009545 | Bacteria | 3089 |
| 237 | Ga0105237_10120564 | 3300009545 | Bacteria | 2617 |
| 238 | Ga0105237_10736282 | 3300009545 | Bacteria | 992 |
| 239 | Ga0105238_10020827 | 3300009551 | Bacteria | 6679 |
| 240 | Ga0105238_10781069 | 3300009551 | Bacteria | 970 |
| 241 | Ga0105238_10819065 | 3300009551 | Bacteria | 947 |
| 242 | Ga0105249_10203210 | 3300009553 | Bacteria | 1940 |
| 243 | Ga0105249_10211432 | 3300009553 | Bacteria | 1904 |
| 244 | Ga0105249_11702719 | 3300009553 | Bacteria | 703 |
| 245 | Ga0105249_12101419 | 3300009553 | Bacteria | 638 |
| 246 | Ga0105249_12983364 | 3300009553 | Bacteria | 543 |
| 247 | Ga0105239_10111552 | 3300010375 | Bacteria | 3032 |
| 248 | Ga0105239_10621559 | 3300010375 | Bacteria | 1233 |
| 249 | Ga0105239_11167630 | 3300010375 | Bacteria | 887 |
| 250 | Ga0105239_13482531 | 3300010375 | Bacteria | 512 |
| 251 | Ga0105246_10027459 | 3300011119 | Bacteria | 3729 |
| 252 | Ga0105246_10170182 | 3300011119 | Bacteria | 1668 |
| 253 | Ga0105246_10753653 | 3300011119 | Bacteria | 859 |
| 254 | Ga0105246_11772598 | 3300011119 | Bacteria | 589 |
| 255 | Ga0157320_1007222 | 3300012481 | Bacteria | 790 |
| 256 | Ga0157337_1033561 | 3300012483 | Bacteria | 537 |
| 257 | Ga0157321_1001289 | 3300012487 | Unclassified | 1251 |
| 258 | Ga0157341_1014435 | 3300012494 | Bacteria | 717 |
| 259 | Ga0157314_1005879 | 3300012500 | Bacteria | 945 |
| 260 | Ga0157316_1001102 | 3300012510 | Unclassified | 1593 |
| 261 | Ga0157371_10190198 | 3300013102 | Bacteria | 1469 |
| 262 | Ga0157371_11182057 | 3300013102 | Bacteria | 589 |
| 263 | Ga0157370_10212012 | 3300013104 | Bacteria | 1795 |
| 264 | Ga0157369_12503444 | 3300013105 | Bacteria | 522 |
| 265 | Ga0157374_10808412 | 3300013296 | Bacteria | 953 |
| 266 | Ga0157378_10452082 | 3300013297 | Bacteria | 1275 |
| 267 | Ga0163162_10097041 | 3300013306 | Bacteria | 3036 |
| 268 | Ga0163162_10766286 | 3300013306 | Bacteria | 1084 |
| 269 | Ga0163162_10862717 | 3300013306 | Bacteria | 1020 |
| 270 | Ga0163162_11343259 | 3300013306 | Bacteria | 813 |
| 271 | Ga0163162_11383608 | 3300013306 | Bacteria | 800 |
| 272 | Ga0163162_11478242 | 3300013306 | Bacteria | 774 |
| 273 | Ga0157372_10040300 | 3300013307 | Bacteria | 5158 |
| 274 | Ga0157372_10569961 | 3300013307 | Bacteria | 1320 |
| 275 | Ga0157372_12082466 | 3300013307 | Bacteria | 652 |
| 276 | Ga0157372_12314821 | 3300013307 | Bacteria | 617 |
| 277 | Ga0157372_12971660 | 3300013307 | Bacteria | 542 |
| 278 | Ga0157375_10461886 | 3300013308 | Bacteria | 1435 |
| 279 | Ga0157375_10850104 | 3300013308 | Bacteria | 1059 |
| 280 | Ga0157375_12108423 | 3300013308 | Bacteria | 671 |
| 281 | Ga0157375_13590201 | 3300013308 | Bacteria | 516 |
| 282 | Ga0163163_10043188 | 3300014325 | Bacteria | 4419 |
| 283 | Ga0163163_10078878 | 3300014325 | Bacteria | 3290 |
| 284 | Ga0163163_10858482 | 3300014325 | Bacteria | 971 |
| 285 | Ga0163163_11059568 | 3300014325 | Bacteria | 874 |
| 286 | Ga0157380_10596324 | 3300014326 | Bacteria | 1092 |
| 287 | Ga0157380_10745133 | 3300014326 | Bacteria | 990 |
| 288 | Ga0157380_13474691 | 3300014326 | Bacteria | 504 |
| 289 | Ga0182008_10161540 | 3300014497 | Bacteria | 1128 |
| 290 | Ga0182008_10205933 | 3300014497 | Bacteria | 1002 |
| 291 | Ga0182008_10414837 | 3300014497 | Bacteria | 726 |
| 292 | Ga0157379_10005028 | 3300014968 | Bacteria | 11341 |
| 293 | Ga0157379_10010528 | 3300014968 | Bacteria | 8062 |
| 294 | Ga0157379_10260678 | 3300014968 | Bacteria | 1575 |
| 295 | Ga0157379_10324024 | 3300014968 | Bacteria | 1407 |
| 296 | Ga0157376_10478734 | 3300014969 | Bacteria | 1220 |
| 297 | Ga0182006_1232934 | 3300015261 | Bacteria | 606 |
| 298 | Ga0197907_10092187 | 3300020069 | Bacteria | 794 |
| 299 | Ga0197907_10239788 | 3300020069 | Bacteria | 644 |
| 300 | Ga0197907_10973848 | 3300020069 | Bacteria | 614 |
| 301 | Ga0197907_11102414 | 3300020069 | Bacteria | 1131 |
| 302 | Ga0206356_11646062 | 3300020070 | Bacteria | 1504 |
| 303 | Ga0206355_1123530 | 3300020076 | Bacteria | 514 |
| 304 | Ga0206355_1688314 | 3300020076 | Bacteria | 516 |
| 305 | Ga0206352_10274325 | 3300020078 | Bacteria | 761 |
| 306 | Ga0206350_11398817 | 3300020080 | Bacteria | 558 |
| 307 | Ga0206354_10523478 | 3300020081 | Bacteria | 615 |
| 308 | Ga0206354_11018118 | 3300020081 | Bacteria | 628 |
| 309 | Ga0206354_11697946 | 3300020081 | Bacteria | 538 |
| 310 | Ga0206353_10172718 | 3300020082 | Bacteria | 658 |
| 311 | Ga0206353_10378576 | 3300020082 | Bacteria | 816 |
| 312 | Ga0206353_11084932 | 3300020082 | Bacteria | 756 |
| 313 | Ga0206353_11499693 | 3300020082 | Bacteria | 595 |
| 314 | Ga0206353_11826723 | 3300020082 | Bacteria | 2055 |
| 315 | Ga0154015_1534401 | 3300020610 | Bacteria | 742 |
| 316 | Ga0213876_10031767 | 3300021384 | Bacteria | 2785 |
| 317 | Ga0213876_10037964 | 3300021384 | Bacteria | 2541 |
| 318 | Ga0213876_10145291 | 3300021384 | Unclassified | 1261 |
| 319 | Ga0213876_10230597 | 3300021384 | Bacteria | 984 |
| 320 | Ga0213875_10394599 | 3300021388 | Bacteria | 659 |
| 321 | Ga0213875_10433333 | 3300021388 | Bacteria | 628 |
| 322 | Ga0213875_10627677 | 3300021388 | Unclassified | 520 |
| 323 | Ga0224712_10076530 | 3300022467 | Bacteria | 1371 |
| 324 | Ga0224712_10449919 | 3300022467 | Bacteria | 618 |
| 325 | Ga0224712_10667780 | 3300022467 | Bacteria | 510 |
| 326 | Ga0247553_110050 | 3300023672 | Bacteria | 541 |
| 327 | Ga0224572_1019933 | 3300024225 | Bacteria | 1288 |
| 328 | Ga0207692_10011924 | 3300025898 | Bacteria | 3719 |
| 329 | Ga0207692_11013671 | 3300025898 | Bacteria | 548 |
| 330 | Ga0207642_10172657 | 3300025899 | Bacteria | 1171 |
| 331 | Ga0207642_10537377 | 3300025899 | Bacteria | 720 |
| 332 | Ga0207710_10124959 | 3300025900 | Bacteria | 1232 |
| 333 | Ga0207688_10003660 | 3300025901 | Bacteria | 8395 |
| 334 | Ga0207680_10032628 | 3300025903 | Bacteria | 2962 |
| 335 | Ga0207680_10138418 | 3300025903 | Bacteria | 1612 |
| 336 | Ga0207680_10858332 | 3300025903 | Bacteria | 651 |
| 337 | Ga0207647_10242412 | 3300025904 | Bacteria | 1035 |
| 338 | Ga0207699_11457374 | 3300025906 | Bacteria | 506 |
| 339 | Ga0207643_10019178 | 3300025908 | Bacteria | 3747 |
| 340 | Ga0207643_10290889 | 3300025908 | Bacteria | 1015 |
| 341 | Ga0207705_10610596 | 3300025909 | Bacteria | 848 |
| 342 | Ga0207705_10647338 | 3300025909 | Bacteria | 822 |
| 343 | Ga0207705_10891066 | 3300025909 | Bacteria | 689 |
| 344 | Ga0207654_10415930 | 3300025911 | Bacteria | 937 |
| 345 | Ga0207707_10032934 | 3300025912 | Bacteria | 4536 |
| 346 | Ga0207707_10444550 | 3300025912 | Bacteria | 1110 |
| 347 | Ga0207707_11056780 | 3300025912 | Bacteria | 664 |
| 348 | Ga0207695_10158233 | 3300025913 | Bacteria | 2199 |
| 349 | Ga0207695_11227611 | 3300025913 | Bacteria | 630 |
| 350 | Ga0207671_10056406 | 3300025914 | Bacteria | 2911 |
| 351 | Ga0207671_10578605 | 3300025914 | Bacteria | 895 |
| 352 | Ga0207671_10634694 | 3300025914 | Bacteria | 851 |
| 353 | Ga0207671_10757848 | 3300025914 | Bacteria | 771 |
| 354 | Ga0207693_10109594 | 3300025915 | Bacteria | 2165 |
| 355 | Ga0207693_10127483 | 3300025915 | Bacteria | 2001 |
| 356 | Ga0207693_10248343 | 3300025915 | Bacteria | 1396 |
| 357 | Ga0207693_10314872 | 3300025915 | Bacteria | 1225 |
| 358 | Ga0207693_10323124 | 3300025915 | Unclassified | 1208 |
| 359 | Ga0207693_11075797 | 3300025915 | Bacteria | 612 |
| 360 | Ga0207663_10305387 | 3300025916 | Unclassified | 1190 |
| 361 | Ga0207663_10857561 | 3300025916 | Bacteria | 725 |
| 362 | Ga0207663_11363796 | 3300025916 | Bacteria | 571 |
| 363 | Ga0207660_10007525 | 3300025917 | Bacteria | 7050 |
| 364 | Ga0207660_10158944 | 3300025917 | Bacteria | 1742 |
| 365 | Ga0207660_10944957 | 3300025917 | Bacteria | 703 |
| 366 | Ga0207660_11372464 | 3300025917 | Bacteria | 573 |
| 367 | Ga0207662_10146599 | 3300025918 | Bacteria | 1499 |
| 368 | Ga0207657_10027381 | 3300025919 | Bacteria | 5221 |
| 369 | Ga0207657_10134714 | 3300025919 | Bacteria | 2022 |
| 370 | Ga0207649_10029488 | 3300025920 | Bacteria | 3240 |
| 371 | Ga0207649_10419488 | 3300025920 | Bacteria | 1005 |
| 372 | Ga0207649_10505660 | 3300025920 | Bacteria | 919 |
| 373 | Ga0207649_11284417 | 3300025920 | Bacteria | 579 |
| 374 | Ga0207652_10003131 | 3300025921 | Bacteria | 13793 |
| 375 | Ga0207652_10032286 | 3300025921 | Bacteria | 4399 |
| 376 | Ga0207652_10058819 | 3300025921 | Bacteria | 3312 |
| 377 | Ga0207652_10762269 | 3300025921 | Bacteria | 861 |
| 378 | Ga0207681_10249412 | 3300025923 | Bacteria | 1385 |
| 379 | Ga0207681_10813039 | 3300025923 | Bacteria | 781 |
| 380 | Ga0207694_10042276 | 3300025924 | Bacteria | 3515 |
| 381 | Ga0207694_10485036 | 3300025924 | Bacteria | 1034 |
| 382 | Ga0207650_10658635 | 3300025925 | Bacteria | 883 |
| 383 | Ga0207659_10902917 | 3300025926 | Bacteria | 759 |
| 384 | Ga0207687_10571439 | 3300025927 | Bacteria | 950 |
| 385 | Ga0207687_11262171 | 3300025927 | Bacteria | 635 |
| 386 | Ga0207687_11263772 | 3300025927 | Bacteria | 635 |
| 387 | Ga0207687_11658149 | 3300025927 | Bacteria | 548 |
| 388 | Ga0207700_10904365 | 3300025928 | Bacteria | 790 |
| 389 | Ga0207700_11007578 | 3300025928 | Bacteria | 745 |
| 390 | Ga0207700_11029220 | 3300025928 | Bacteria | 737 |
| 391 | Ga0207700_11486110 | 3300025928 | Bacteria | 601 |
| 392 | Ga0207664_10006553 | 3300025929 | Bacteria | 8020 |
| 393 | Ga0207664_10323760 | 3300025929 | Bacteria | 1360 |
| 394 | Ga0207664_11084752 | 3300025929 | Bacteria | 716 |
| 395 | Ga0207644_10154217 | 3300025931 | Bacteria | 1780 |
| 396 | Ga0207644_10924766 | 3300025931 | Bacteria | 731 |
| 397 | Ga0207690_10041521 | 3300025932 | Bacteria | 3015 |
| 398 | Ga0207690_10120307 | 3300025932 | Bacteria | 1906 |
| 399 | Ga0207690_10123871 | 3300025932 | Bacteria | 1882 |
| 400 | Ga0207706_10320690 | 3300025933 | Bacteria | 1349 |
| 401 | Ga0207706_10386689 | 3300025933 | Bacteria | 1214 |
| 402 | Ga0207686_10313043 | 3300025934 | Bacteria | 1170 |
| 403 | Ga0207686_10489907 | 3300025934 | Bacteria | 952 |
| 404 | Ga0207686_10599848 | 3300025934 | Bacteria | 866 |
| 405 | Ga0207686_10855341 | 3300025934 | Bacteria | 732 |
| 406 | Ga0207686_10872660 | 3300025934 | Bacteria | 725 |
| 407 | Ga0207709_10053930 | 3300025935 | Bacteria | 2476 |
| 408 | Ga0207709_10068603 | 3300025935 | Bacteria | 2242 |
| 409 | Ga0207709_10389008 | 3300025935 | Bacteria | 1063 |
| 410 | Ga0207709_10671910 | 3300025935 | Bacteria | 826 |
| 411 | Ga0207670_10036264 | 3300025936 | Bacteria | 3205 |
| 412 | Ga0207704_10856106 | 3300025938 | Bacteria | 762 |
| 413 | Ga0207704_11325229 | 3300025938 | Bacteria | 616 |
| 414 | Ga0207691_10052766 | 3300025940 | Bacteria | 3713 |
| 415 | Ga0207691_10919030 | 3300025940 | Bacteria | 732 |
| 416 | Ga0207711_11824410 | 3300025941 | Bacteria | 551 |
| 417 | Ga0207711_12051244 | 3300025941 | Bacteria | 515 |
| 418 | Ga0207689_10025277 | 3300025942 | Bacteria | 4976 |
| 419 | Ga0207689_10547656 | 3300025942 | Bacteria | 972 |
| 420 | Ga0207661_10025325 | 3300025944 | Bacteria | 4507 |
| 421 | Ga0207661_10313609 | 3300025944 | Bacteria | 1408 |
| 422 | Ga0207661_10322800 | 3300025944 | Bacteria | 1388 |
| 423 | Ga0207661_11673634 | 3300025944 | Bacteria | 581 |
| 424 | Ga0207661_11862409 | 3300025944 | Bacteria | 547 |
| 425 | Ga0207679_10552579 | 3300025945 | Bacteria | 1033 |
| 426 | Ga0207679_10778668 | 3300025945 | Bacteria | 871 |
| 427 | Ga0207679_12153407 | 3300025945 | Bacteria | 506 |
| 428 | Ga0207667_10742754 | 3300025949 | Bacteria | 981 |
| 429 | Ga0207667_10834386 | 3300025949 | Bacteria | 917 |
| 430 | Ga0207651_10275786 | 3300025960 | Bacteria | 1387 |
| 431 | Ga0207712_10174163 | 3300025961 | Bacteria | 1685 |
| 432 | Ga0207712_10982705 | 3300025961 | Bacteria | 748 |
| 433 | Ga0207712_11004610 | 3300025961 | Bacteria | 740 |
| 434 | Ga0207668_10788565 | 3300025972 | Bacteria | 840 |
| 435 | Ga0207640_10741274 | 3300025981 | Bacteria | 846 |
| 436 | Ga0207640_10750854 | 3300025981 | Bacteria | 841 |
| 437 | Ga0207658_10024718 | 3300025986 | Bacteria | 4203 |
| 438 | Ga0207658_11562399 | 3300025986 | Bacteria | 603 |
| 439 | Ga0207677_10190089 | 3300026023 | Bacteria | 1623 |
| 440 | Ga0207677_10301622 | 3300026023 | Unclassified | 1323 |
| 441 | Ga0207703_10116619 | 3300026035 | Bacteria | 2286 |
| 442 | Ga0207703_11152083 | 3300026035 | Bacteria | 745 |
| 443 | Ga0207639_11072401 | 3300026041 | Bacteria | 755 |
| 444 | Ga0207678_10460419 | 3300026067 | Bacteria | 1106 |
| 445 | Ga0207678_10817585 | 3300026067 | Bacteria | 823 |
| 446 | Ga0207678_11323441 | 3300026067 | Bacteria | 637 |
| 447 | Ga0207708_10160247 | 3300026075 | Bacteria | 1776 |
| 448 | Ga0207708_11049557 | 3300026075 | Bacteria | 709 |
| 449 | Ga0207702_10014101 | 3300026078 | Bacteria | 6636 |
| 450 | Ga0207702_10901435 | 3300026078 | Bacteria | 876 |
| 451 | Ga0207702_11241220 | 3300026078 | Bacteria | 739 |
| 452 | Ga0207641_11386158 | 3300026088 | Bacteria | 704 |
| 453 | Ga0207641_12607761 | 3300026088 | Bacteria | 503 |
| 454 | Ga0207648_10092311 | 3300026089 | Bacteria | 2647 |
| 455 | Ga0207648_10313114 | 3300026089 | Bacteria | 1409 |
| 456 | Ga0207648_10369901 | 3300026089 | Bacteria | 1295 |
| 457 | Ga0207648_11014940 | 3300026089 | Bacteria | 777 |
| 458 | Ga0207676_10032636 | 3300026095 | Bacteria | 3926 |
| 459 | Ga0207676_11485874 | 3300026095 | Bacteria | 674 |
| 460 | Ga0207674_10040431 | 3300026116 | Bacteria | 4830 |
| 461 | Ga0207674_10489005 | 3300026116 | Bacteria | 1189 |
| 462 | Ga0207674_10614215 | 3300026116 | Bacteria | 1050 |
| 463 | Ga0207674_10945240 | 3300026116 | Bacteria | 830 |
| 464 | Ga0207674_11671768 | 3300026116 | Bacteria | 605 |
| 465 | Ga0207675_100276286 | 3300026118 | Bacteria | 1631 |
| 466 | Ga0207675_100986012 | 3300026118 | Bacteria | 861 |
| 467 | Ga0207675_102447775 | 3300026118 | Bacteria | 534 |
| 468 | Ga0207683_10413477 | 3300026121 | Bacteria | 1242 |
| 469 | Ga0207683_11521360 | 3300026121 | Bacteria | 618 |
| 470 | Ga0207698_10028653 | 3300026142 | Bacteria | 3975 |
| 471 | Ga0207698_10324984 | 3300026142 | Bacteria | 1442 |
| 472 | Ga0209974_10241200 | 3300027876 | Bacteria | 678 |
| 473 | Ga0207428_10111641 | 3300027907 | Bacteria | 2103 |
| 474 | Ga0207428_10284171 | 3300027907 | Bacteria | 1227 |
| 475 | Ga0207428_10727435 | 3300027907 | Unclassified | 708 |
| 476 | Ga0268266_10000715 | 3300028379 | Bacteria | 44804 |
| 477 | Ga0268266_10130480 | 3300028379 | Bacteria | 2247 |
| 478 | Ga0268265_10052448 | 3300028380 | Bacteria | 3085 |
| 479 | Ga0268265_10518935 | 3300028380 | Unclassified | 1126 |
| 480 | Ga0268264_10953111 | 3300028381 | Bacteria | 863 |
| 481 | Ga0268264_11516921 | 3300028381 | Bacteria | 681 |
| 482 | Ga0265338_10327162 | 3300028800 | Bacteria | 1108 |
| 483 | Ga0265338_10441942 | 3300028800 | Bacteria | 922 |
| 484 | Ga0265762_1162632 | 3300030760 | Bacteria | 539 |
| 485 | Ga0265767_106388 | 3300030836 | Bacteria | 734 |
| 486 | Ga0265766_1007124 | 3300030863 | Bacteria | 746 |
| 487 | Ga0307408_101303121 | 3300031548 | Bacteria | 681 |
| 488 | Ga0307408_102524544 | 3300031548 | Bacteria | 500 |
| 489 | Ga0316576_10025487 | 3300031727 | Bacteria | 4141 |
| 490 | Ga0316576_10499256 | 3300031727 | Bacteria | 895 |
| 491 | Ga0307406_10338782 | 3300031901 | Bacteria | 1171 |
| 492 | Ga0307406_11625360 | 3300031901 | Bacteria | 571 |
| 493 | Ga0307409_100615760 | 3300031995 | Bacteria | 1075 |
| 494 | Ga0307409_100749340 | 3300031995 | Bacteria | 980 |
| 495 | Ga0307416_101191273 | 3300032002 | Bacteria | 867 |
| 496 | Ga0307416_101278187 | 3300032002 | Bacteria | 840 |
| 497 | Ga0307414_10567494 | 3300032004 | Bacteria | 1014 |
| 498 | Ga0373959_0167033 | 3300034820 | Bacteria | 565 |
| 499 | Ga0373928_0114961 | 3300035084 | Bacteria | 715 |
| 500 | Ga0373934_0000135 | 3300035086 | Bacteria | 27297 |
| 501 | Ga0373953_0000554 | 3300035117 | Bacteria | 10368 |
| 502 | Ga0373954_0072834 | 3300035118 | Bacteria | 1634 |
| 503 | Ga0373956_0000989 | 3300035119 | Bacteria | 11777 |
| 504 | Ga0373957_0002047 | 3300035120 | Bacteria | 5648 |
| 505 | Ga0373943_0039967 | 3300035170 | Bacteria | 2263 |
| 506 | Ga0373955_0000137 | 3300035172 | Bacteria | 28923 |
| 507 | Ga0373942_0143643 | 3300035207 | Bacteria | 762 |
| 508 | Ga0373961_0221272 | 3300035241 | Bacteria | 675 |
| 509 | Ga0373924_0003189 | 3300035410 | Bacteria | 5614 |
| 510 | Ga0373931_0351334 | 3300035691 | Bacteria | 923 |
| 511 | Ga0373935_0536195 | 3300035692 | Bacteria | 852 |
| 512 | Ga0373933_0000015 | 3300035724 | Bacteria | 103111 |
| 513 | Ga0373947_0701654 | 3300035725 | Bacteria | 690 |
| 514 | Ga0373937_0000053 | 3300036401 | Bacteria | 103072 |
| 515 | Ga0373925_0474514 | 3300037068 | Bacteria | 1026 |
| 516 | Ga0395899_0297731 | 3300037312 | Bacteria | 1093 |
| 517 | Ga0395900_0055408 | 3300037418 | Bacteria | 4083 |
| 518 | Ga0395900_0377548 | 3300037418 | Bacteria | 1386 |
| 519 | Ga0395900_0455918 | 3300037418 | Bacteria | 1234 |
| 520 | Ga0395900_0653451 | 3300037418 | Bacteria | 988 |
| 521 | Ga0395900_0802922 | 3300037418 | Bacteria | 869 |
| 522 | Ga0395900_0886005 | 3300037418 | Bacteria | 816 |
| 523 | Ga0395900_1147943 | 3300037418 | Bacteria | 693 |
| 524 | Ga0395900_1426799 | 3300037418 | Bacteria | 605 |
| 525 | Ga0395900_1681068 | 3300037418 | Bacteria | 546 |
| 526 | Ga0395898_0004284 | 3300037466 | Bacteria | 15640 |
| 527 | Ga0395898_0043019 | 3300037466 | Bacteria | 4452 |
| 528 | Ga0395898_0047366 | 3300037466 | Bacteria | 4219 |
| 529 | Ga0395898_0085742 | 3300037466 | Bacteria | 3036 |
| 530 | Ga0395898_0177753 | 3300037466 | Bacteria | 2034 |
| 531 | Ga0395898_0293392 | 3300037466 | Bacteria | 1551 |
| 532 | Ga0395898_0386924 | 3300037466 | Bacteria | 1334 |
| 533 | Ga0395898_0427378 | 3300037466 | Bacteria | 1262 |
| 534 | Ga0395905_0484277 | 3300037471 | Bacteria | 1137 |
| 535 | Ga0395905_0896645 | 3300037471 | Bacteria | 790 |
| 536 | Ga0395905_0964298 | 3300037471 | Bacteria | 756 |
| 537 | Ga0395905_1317433 | 3300037471 | Bacteria | 626 |
| 538 | Ga0436364_0034070 | 3300037853 | Bacteria | 3323 |
| 539 | Ga0436364_0372858 | 3300037853 | Unclassified | 1152 |
| 540 | Ga0436364_0893802 | 3300037853 | Bacteria | 4722 |
| 541 | Ga0436364_0985211 | 3300037853 | Bacteria | 659 |
| 542 | Ga0436364_1172050 | 3300037853 | Bacteria | 1737 |
| 543 | Ga0436364_1286757 | 3300037853 | Bacteria | 1185 |
| 544 | Ga0436364_1422689 | 3300037853 | Bacteria | 734 |
| 545 | Ga0395901_0042302 | 3300038443 | Bacteria | 4723 |
| 546 | Ga0395901_0057070 | 3300038443 | Bacteria | 4061 |
| 547 | Ga0395901_0101268 | 3300038443 | Bacteria | 3023 |
| 548 | Ga0395901_0150453 | 3300038443 | Bacteria | 2446 |
| 549 | Ga0395901_0242629 | 3300038443 | Bacteria | 1879 |
| 550 | Ga0395901_0346873 | 3300038443 | Bacteria | 1533 |
| 551 | Ga0395901_0428782 | 3300038443 | Bacteria | 1355 |
| 552 | Ga0395901_0508238 | 3300038443 | Bacteria | 1226 |
| 553 | Ga0395901_0510228 | 3300038443 | Bacteria | 1223 |
| 554 | Ga0395901_0703250 | 3300038443 | Bacteria | 1008 |
| 555 | Ga0395901_0726759 | 3300038443 | Bacteria | 988 |
| 556 | Ga0395901_1290437 | 3300038443 | Bacteria | 692 |
| 557 | Ga0400488_07726 | 3300038741 | Bacteria | 1443 |
| 558 | Ga0242420_114517 | 3300038996 | Bacteria | 583 |
| 559 | Ga0400483_071288 | 3300039062 | Unclassified | 1442 |
| 560 | Ga0400483_245707 | 3300039062 | Unclassified | 2164 |
| 561 | Ga0436365_0254787 | 3300039437 | Bacteria | 1152 |
| 562 | Ga0436365_0860754 | 3300039437 | Bacteria | 2892 |
| 563 | Ga0436365_1156917 | 3300039437 | Bacteria | 5140 |
| 564 | Ga0436365_1252474 | 3300039437 | Bacteria | 718 |
| 565 | Ga0436365_1357803 | 3300039437 | Unclassified | 1691 |
| 566 | Ga0436363_0314174 | 3300039450 | Bacteria | 594 |
| 567 | Ga0436363_0436762 | 3300039450 | Bacteria | 1102 |
| 568 | Ga0436363_0753556 | 3300039450 | Bacteria | 517 |
| 569 | Ga0436363_0814925 | 3300039450 | Bacteria | 1570 |
| 570 | Ga0436363_1693937 | 3300039450 | Bacteria | 1123 |
| 571 | Ga0436362_0074627 | 3300039453 | Bacteria | 526 |
| 572 | Ga0436362_0990170 | 3300039453 | Bacteria | 2147 |
| 573 | Ga0451789_0651530 | 3300041443 | Bacteria | 1214 |
| 574 | Ga0451789_1165134 | 3300041443 | Bacteria | 656 |
| 575 | Ga0451793_1298945 | 3300041452 | Bacteria | 754 |
| 576 | Ga0451795_0263037 | 3300041456 | Bacteria | 715 |
| 577 | Ga0451800_1364612 | 3300041459 | Bacteria | 520 |
| 578 | Ga0451802_1226528 | 3300041460 | Bacteria | 926 |
| 579 | Ga0451804_0044416 | 3300041463 | Bacteria | 1166 |
| 580 | Ga0451804_1154896 | 3300041463 | Bacteria | 533 |
| 581 | Ga0451851_0708761 | 3300041507 | Bacteria | 673 |
| 582 | Ga0451855_1796818 | 3300041511 | Bacteria | 879 |
| 583 | Ga0452271_38374 | 3300041916 | Eukaryota | 636 |
| 584 | Ga0439456_097264 | 3300042013 | Bacteria | 665 |
| 585 | Ga0439460_0226174 | 3300042461 | Bacteria | 642 |
| 586 | Ga0451577_0002384 | 3300042876 | Bacteria | 22505 |
| 587 | Ga0466965_0720345 | 3300044683 | Bacteria | 573 |
| 588 | Ga0466966_0112099 | 3300044684 | Bacteria | 1681 |
| 589 | Ga0466961_0099779 | 3300044693 | Bacteria | 1830 |
| 590 | Ga0466961_0670796 | 3300044693 | Bacteria | 622 |
| 591 | Ga0466963_0001854 | 3300044694 | Bacteria | 11530 |
| 592 | Ga0466963_0040517 | 3300044694 | Bacteria | 3053 |
| 593 | Ga0466963_0178057 | 3300044694 | Bacteria | 1484 |
| 594 | Ga0453684_0006354 | 3300044712 | Bacteria | 22526 |
| 595 | Ga0466971_0181606 | 3300044719 | Bacteria | 989 |
| 596 | Ga0466971_0329889 | 3300044719 | Bacteria | 736 |
| 597 | Ga0466968_0166505 | 3300044735 | Bacteria | 1019 |
| 598 | Ga0466968_0199083 | 3300044735 | Bacteria | 938 |
| 599 | Ga0466968_0359354 | 3300044735 | Bacteria | 709 |
| 600 | Ga0466970_0137838 | 3300044765 | Bacteria | 1343 |
| 601 | Ga0466957_0457415 | 3300044842 | Bacteria | 880 |
| 602 | Ga0466960_0342783 | 3300044901 | Bacteria | 851 |
| 603 | Ga0466960_0413950 | 3300044901 | Bacteria | 778 |
| 604 | Ga0466959_0214896 | 3300045049 | Bacteria | 1335 |
| 605 | Ga0466959_0248475 | 3300045049 | Bacteria | 1227 |
| 606 | Ga0466959_0332664 | 3300045049 | Bacteria | 1037 |
| 607 | Ga0466958_0003571 | 3300045836 | Bacteria | 8097 |
| 608 | Ga0466967_0020832 | 3300045976 | Bacteria | 5310 |
| 609 | Ga0466967_0170345 | 3300045976 | Bacteria | 2048 |
| 610 | Ga0466967_0177322 | 3300045976 | Bacteria | 2008 |
| 611 | Ga0466967_0533052 | 3300045976 | Bacteria | 1155 |
| 612 | Ga0466967_0812872 | 3300045976 | Bacteria | 928 |
| 613 | Ga0466967_0994020 | 3300045976 | Bacteria | 835 |
| 614 | Ga0466967_2207433 | 3300045976 | Bacteria | 546 |
| 615 | Ga0495592_0000057 | 3300046454 | Bacteria | 103108 |
| 616 | Ga0495651_0000032 | 3300046462 | Bacteria | 103111 |
| 617 | Ga0495653_0002066 | 3300046463 | Bacteria | 15786 |
| 618 | Ga0495653_0904477 | 3300046463 | Bacteria | 526 |
| 619 | Ga0495650_0000054 | 3300046471 | Bacteria | 313631 |
| 620 | Ga0495664_0740530 | 3300046477 | Bacteria | 580 |
| 621 | Ga0495608_0000045 | 3300046511 | Bacteria | 100413 |
| 622 | Ga0495618_0918626 | 3300046514 | Bacteria | 505 |
| 623 | Ga0495628_0000063 | 3300046516 | Bacteria | 86231 |
| 624 | Ga0495631_0179580 | 3300046518 | Bacteria | 907 |
| 625 | Ga0495631_0421932 | 3300046518 | Bacteria | 568 |
| 626 | Ga0495663_0143722 | 3300046525 | Bacteria | 811 |
| 627 | Ga0495663_0174304 | 3300046525 | Bacteria | 743 |
| 628 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 629 | Ga0495652_0000078 | 3300046529 | Bacteria | 103039 |
| 630 | Ga0495587_0000050 | 3300046536 | Bacteria | 103111 |
| 631 | Ga0495645_0070538 | 3300046543 | Bacteria | 2522 |
| 632 | Ga0495645_0099480 | 3300046543 | Bacteria | 2069 |
| 633 | Ga0495667_0000055 | 3300046559 | Bacteria | 103111 |
| 634 | Ga0495668_0687304 | 3300046616 | Bacteria | 566 |
| 635 | Ga0495635_0936874 | 3300046663 | Bacteria | 553 |
| 636 | Ga0495635_0979017 | 3300046663 | Bacteria | 539 |
| 637 | Ga0495659_0518246 | 3300046664 | Bacteria | 524 |
| 638 | Ga0495588_0334251 | 3300046674 | Bacteria | 797 |
| 639 | Ga0495657_0000009 | 3300046675 | Bacteria | 217555 |
| 640 | Ga0495599_0000033 | 3300046678 | Bacteria | 106425 |
| 641 | Ga0495599_0079939 | 3300046678 | Bacteria | 2042 |
| 642 | Ga0495623_0000423 | 3300046679 | Bacteria | 27905 |
| 643 | Ga0495646_0008673 | 3300046680 | Bacteria | 6462 |
| 644 | Ga0495646_0660734 | 3300046680 | Bacteria | 528 |
| 645 | Ga0495624_0927104 | 3300046690 | Unclassified | 512 |
| 646 | Ga0495600_0001649 | 3300046809 | Bacteria | 12439 |
| 647 | Ga0495604_0000052 | 3300047317 | Bacteria | 103088 |
| 648 | Ga0495636_0009435 | 3300047318 | Bacteria | 3843 |
| 649 | Ga0495672_0012173 | 3300047320 | Bacteria | 6019 |
| 650 | Ga0495672_0118602 | 3300047320 | Bacteria | 1410 |
| 651 | Ga0495672_0224915 | 3300047320 | Bacteria | 924 |
| 652 | Ga0495676_1032985 | 3300047321 | Bacteria | 524 |
| 653 | Ga0495680_0000027 | 3300047322 | Bacteria | 113036 |
| 654 | Ga0495675_0000399 | 3300047444 | Bacteria | 29995 |
| 655 | Ga0495684_0923875 | 3300047471 | Bacteria | 560 |
| 656 | Ga0495602_0000236 | 3300048088 | Bacteria | 51630 |
| 657 | Ga0495614_0600091 | 3300048089 | Bacteria | 529 |
| 658 | Ga0496100_0068291 | 3300048903 | Bacteria | 2363 |
| 659 | Ga0496100_0120824 | 3300048903 | Bacteria | 1832 |
| 660 | Ga0496100_0122062 | 3300048903 | Bacteria | 1824 |
| 661 | Ga0496100_0241510 | 3300048903 | Bacteria | 1333 |
| 662 | Ga0496101_0006828 | 3300048904 | Bacteria | 7367 |
| 663 | Ga0496101_0016994 | 3300048904 | Bacteria | 4926 |
| 664 | Ga0496101_0068115 | 3300048904 | Bacteria | 2601 |
| 665 | Ga0496101_0129260 | 3300048904 | Bacteria | 1917 |
| 666 | Ga0496102_0034938 | 3300048905 | Bacteria | 4524 |
| 667 | Ga0496102_0424111 | 3300048905 | Bacteria | 1249 |
| 668 | Ga0496102_1463731 | 3300048905 | Bacteria | 602 |
| 669 | Ga0496102_1477980 | 3300048905 | Bacteria | 598 |
| 670 | Ga0496103_0250179 | 3300048906 | Bacteria | 1140 |
| 671 | Ga0496104_0047023 | 3300048907 | Bacteria | 4066 |
| 672 | Ga0496104_0166197 | 3300048907 | Bacteria | 2116 |
| 673 | Ga0496105_0066026 | 3300048908 | Bacteria | 2986 |
| 674 | Ga0496105_0520850 | 3300048908 | Bacteria | 931 |
| 675 | Ga0496105_1029712 | 3300048908 | Bacteria | 614 |
| 676 | Ga0496106_0004461 | 3300048909 | Bacteria | 10376 |
| 677 | Ga0496106_0382104 | 3300048909 | Bacteria | 1131 |
| 678 | Ga0496106_0569430 | 3300048909 | Bacteria | 908 |
| 679 | Ga0496106_0573584 | 3300048909 | Bacteria | 905 |
| 680 | Ga0496106_1458149 | 3300048909 | Bacteria | 527 |
| 681 | Ga0496107_0008235 | 3300048910 | Bacteria | 7212 |
| 682 | Ga0496107_0141702 | 3300048910 | Bacteria | 1777 |
| 683 | Ga0496107_0176240 | 3300048910 | Bacteria | 1587 |
| 684 | Ga0496107_0320390 | 3300048910 | Bacteria | 1154 |
| 685 | Ga0496108_0146980 | 3300048911 | Bacteria | 2032 |
| 686 | Ga0496108_0790283 | 3300048911 | Bacteria | 819 |
| 687 | Ga0496108_1527511 | 3300048911 | Bacteria | 555 |
| 688 | Ga0496109_0237577 | 3300048912 | Bacteria | 1714 |
| 689 | Ga0496109_1068438 | 3300048912 | Bacteria | 744 |
| 690 | Ga0496110_0214905 | 3300048913 | Bacteria | 1748 |
| 691 | Ga0496110_0325196 | 3300048913 | Bacteria | 1401 |
| 692 | Ga0496110_0368370 | 3300048913 | Bacteria | 1309 |
| 693 | Ga0496110_0833710 | 3300048913 | Bacteria | 827 |
| 694 | Ga0496110_1488204 | 3300048913 | Bacteria | 587 |
| 695 | Ga0496111_0079671 | 3300048914 | Bacteria | 2390 |
| 696 | Ga0496111_0108417 | 3300048914 | Bacteria | 2045 |
| 697 | Ga0496111_0251187 | 3300048914 | Bacteria | 1313 |
| 698 | Ga0496111_0313845 | 3300048914 | Bacteria | 1161 |
| 699 | Ga0496112_0041797 | 3300048915 | Bacteria | 4485 |
| 700 | Ga0496112_0476225 | 3300048915 | Bacteria | 1185 |
| 701 | Ga0496112_0504950 | 3300048915 | Bacteria | 1144 |
| 702 | Ga0496112_1191869 | 3300048915 | Bacteria | 678 |
| 703 | Ga0496113_0147470 | 3300048916 | Bacteria | 1854 |
| 704 | Ga0496114_0234038 | 3300048917 | Bacteria | 1614 |
| 705 | Ga0496115_0043427 | 3300048918 | Bacteria | 3585 |
| 706 | Ga0496115_0163769 | 3300048918 | Bacteria | 1839 |
| 707 | Ga0496116_0001112 | 3300048919 | Bacteria | 32189 |
| 708 | Ga0496118_0023973 | 3300048921 | Bacteria | 5282 |
| 709 | Ga0496119_0001214 | 3300048922 | Bacteria | 32189 |
| 710 | Ga0496119_0014838 | 3300048922 | Bacteria | 6059 |
| 711 | Ga0496119_0134046 | 3300048922 | Bacteria | 1345 |
| 712 | Ga0496121_0067583 | 3300048924 | Bacteria | 2896 |
| 713 | Ga0496121_0287381 | 3300048924 | Bacteria | 1122 |
| 714 | Ga0496124_0021502 | 3300048927 | Bacteria | 5944 |
| 715 | Ga0496124_0683608 | 3300048927 | Bacteria | 653 |
| 716 | Ga0496125_0559540 | 3300048928 | Bacteria | 632 |
| 717 | Ga0496126_0019663 | 3300048929 | Bacteria | 6646 |
| 718 | Ga0496126_0032528 | 3300048929 | Bacteria | 4912 |
| 719 | Ga0496126_0695093 | 3300048929 | Bacteria | 791 |
| 720 | Ga0496126_0811277 | 3300048929 | Bacteria | 717 |
| 721 | Ga0501317_110580 | 3300049533 | Bacteria | 504 |
| 722 | Ga0501318_055940 | 3300049534 | Bacteria | 596 |
| 723 | Ga0501325_048641 | 3300049541 | Bacteria | 535 |
| 724 | Ga0501031_0003150 | 3300049568 | Bacteria | 10580 |
| 725 | Ga0501032_0001503 | 3300049569 | Bacteria | 18641 |
| 726 | Ga0501032_0556670 | 3300049569 | Bacteria | 731 |
| 727 | Ga0501033_0004824 | 3300049570 | Bacteria | 10762 |
| 728 | Ga0501034_0007306 | 3300049571 | Bacteria | 11773 |
| 729 | Ga0501034_0013330 | 3300049571 | Bacteria | 8466 |
| 730 | Ga0501034_0999368 | 3300049571 | Bacteria | 721 |
| 731 | Ga0501036_0004677 | 3300049572 | Bacteria | 11055 |
| 732 | Ga0501037_0003839 | 3300049573 | Bacteria | 10912 |
| 733 | Ga0501038_0006610 | 3300049574 | Bacteria | 10726 |
| 734 | Ga0501039_0004345 | 3300049575 | Bacteria | 10689 |
| 735 | Ga0501040_0005368 | 3300049576 | Bacteria | 8288 |
| 736 | Ga0501042_0012040 | 3300049578 | Bacteria | 5850 |
| 737 | Ga0501043_0001223 | 3300049579 | Bacteria | 22647 |
| 738 | Ga0501046_0006075 | 3300049580 | Bacteria | 10745 |
| 739 | Ga0501047_0006595 | 3300049581 | Bacteria | 10924 |
| 740 | Ga0501048_0004454 | 3300049582 | Bacteria | 10658 |
| 741 | Ga0501068_0035333 | 3300049584 | Bacteria | 2982 |
| 742 | Ga0501068_0175128 | 3300049584 | Bacteria | 1355 |
| 743 | Ga0501068_0497168 | 3300049584 | Bacteria | 791 |
| 744 | Ga0501069_0030901 | 3300049585 | Bacteria | 2943 |
| 745 | Ga0501069_0176141 | 3300049585 | Bacteria | 1235 |
| 746 | Ga0501070_0000793 | 3300049586 | Bacteria | 28685 |
| 747 | Ga0501070_0005358 | 3300049586 | Bacteria | 10945 |
| 748 | Ga0501070_1150317 | 3300049586 | Bacteria | 597 |
| 749 | Ga0501071_0650785 | 3300049587 | Bacteria | 811 |
| 750 | Ga0501071_1080935 | 3300049587 | Bacteria | 620 |
| 751 | Ga0501073_0051019 | 3300049589 | Bacteria | 2898 |
| 752 | Ga0501074_0003906 | 3300049590 | Bacteria | 10615 |
| 753 | Ga0501075_0481561 | 3300049591 | Bacteria | 947 |
| 754 | Ga0501076_0836129 | 3300049592 | Bacteria | 759 |
| 755 | Ga0501209_191789 | 3300049656 | Bacteria | 627 |
| 756 | Ga0501079_0052396 | 3300049741 | Bacteria | 3149 |
| 757 | Ga0501080_0073910 | 3300049742 | Bacteria | 3171 |
| 758 | Ga0501080_0469572 | 3300049742 | Bacteria | 1126 |
| 759 | Ga0501080_0475256 | 3300049742 | Bacteria | 1119 |
| 760 | Ga0501083_0044176 | 3300049744 | Bacteria | 3016 |
| 761 | Ga0501035_0006695 | 3300049822 | Bacteria | 10768 |
| 762 | Ga0501044_0009251 | 3300049823 | Bacteria | 10759 |
| 763 | Ga0501045_0125907 | 3300049824 | Bacteria | 1903 |
| 764 | nmdc:mga03n38_588012_c1 | 3300050490 | Bacteria | 633 |
| 765 | nmdc:mga00v17_996262_c1 | 3300050491 | Bacteria | 528 |
| 766 | nmdc:mga0yw44_1098678_c1 | 3300050492 | Bacteria | 537 |
| 767 | nmdc:mga0yw44_488469_c1 | 3300050492 | Bacteria | 835 |
| 768 | nmdc:mga0yw44_882158_c1 | 3300050492 | Bacteria | 607 |
| 769 | nmdc:mga05p37_929068_c1 | 3300050507 | Bacteria | 934 |
| 770 | nmdc:mga09592_734563_c1 | 3300050508 | Bacteria | 838 |
| 771 | nmdc:mga0qj67_161644_c1 | 3300050509 | Bacteria | 1818 |
| 772 | nmdc:mga06r32_366023_c1 | 3300050510 | Bacteria | 1425 |
| 773 | nmdc:mga06r32_580029_c1 | 3300050510 | Bacteria | 1094 |
| 774 | nmdc:mga08y16_1090195_c1 | 3300050511 | Bacteria | 774 |
| 775 | nmdc:mga08y16_1636592_c1 | 3300050511 | Unclassified | 601 |
| 776 | nmdc:mga08y16_405079_c1 | 3300050511 | Bacteria | 1395 |
| 777 | nmdc:mga08y16_552639_c1 | 3300050511 | Bacteria | 1165 |
| 778 | nmdc:mga08y16_839682_c1 | 3300050511 | Bacteria | 909 |
| 779 | nmdc:mga0n895_1496674_c1 | 3300050512 | Bacteria | 641 |
| 780 | nmdc:mga0n895_901426_c1 | 3300050512 | Bacteria | 870 |
| 781 | nmdc:mga0rr50_1664719_c1 | 3300050513 | Bacteria | 538 |
| 782 | nmdc:mga0a205_1095873_c1 | 3300050515 | Bacteria | 644 |
| 783 | nmdc:mga0a205_1498269_c1 | 3300050515 | Bacteria | 523 |
| 784 | nmdc:mga0a205_44804_c2 | 3300050515 | Bacteria | 3523 |
| 785 | nmdc:mga0a205_861382_c1 | 3300050515 | Bacteria | 753 |
| 786 | Ga0495601_0321107 | 3300053077 | Bacteria | 1008 |
| 787 | Ga0495601_0520981 | 3300053077 | Bacteria | 766 |
| 788 | Ga0495655_0054357 | 3300053083 | Bacteria | 1071 |
| 789 | Ga0495655_0086265 | 3300053083 | Bacteria | 907 |
| 790 | Ga0495655_0122737 | 3300053083 | Bacteria | 792 |
| 791 | Ga0495655_0166949 | 3300053083 | Bacteria | 702 |
| 792 | Ga0495595_0000236 | 3300053084 | Bacteria | 21890 |
| 793 | Ga0495619_0176001 | 3300053085 | Bacteria | 1480 |
| 794 | Ga0500595_121452 | 3300053119 | Bacteria | 738 |
| 795 | Ga0500616_0005157 | 3300053153 | Bacteria | 8970 |
| 796 | Ga0500633_0385797 | 3300053160 | Bacteria | 507 |
| 797 | Ga0501084_0912227 | 3300054114 | Bacteria | 739 |
| 798 | Ga0587070_182123 | 3300059491 | Bacteria | 547 |
| 799 | Ga0587073_0285125 | 3300059492 | Bacteria | 531 |
| 800 | Ga0587083_0262879 | 3300059505 | Bacteria | 519 |
| 801 | Ga0587088_162535 | 3300059508 | Bacteria | 548 |
| 802 | Ga0587088_167909 | 3300059508 | Bacteria | 542 |
| 803 | Ga0587089_103946 | 3300059509 | Bacteria | 518 |
| 804 | Ga0587128_041580 | 3300059630 | Bacteria | 806 |
| 805 | Ga0587067_202510 | 3300059640 | Bacteria | 528 |
| 806 | Ga0587079_150043 | 3300059647 | Bacteria | 602 |
| 807 | Ga0587114_041631 | 3300059655 | Bacteria | 746 |
| 808 | Ga0587114_133851 | 3300059655 | Bacteria | 513 |
| 809 | Ga0587111_0229322 | 3300060346 | Bacteria | 540 |
| 810 | Ga0466962_0493019 | 3300061719 | Bacteria | 619 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047318 | Ga0495636_0009435 | Ga0495636_0009435_1206_1388 | 60 |
| 2 | 3300005468 | Ga0070707_101753927 | Ga0070707_1017539271 | 62 |
| 3 | 3300014497 | Ga0182008_10205933 | Ga0182008_102059331 | 62 |
| 4 | 3300041463 | Ga0451804_1154896 | Ga0451804_1154896_211_399 | 62 |
| 5 | iso_pu_bacteria | 2740891818 | 2740992345 | 62 |
| 6 | 3300006852 | Ga0075433_11575123 | Ga0075433_115751231 | 64 |
| 7 | 3300050515 | nmdc:mga0a205_1498269_c1 | nmdc:mga0a205_1498269_c1_178_372 | 64 |
| 8 | 3300005366 | Ga0070659_101934497 | Ga0070659_1019344971 | 65 |
| 9 | 3300005549 | Ga0070704_100943971 | Ga0070704_1009439712 | 65 |
| 10 | 3300005937 | Ga0081455_10062009 | Ga0081455_100620093 | 65 |
| 11 | 3300005937 | Ga0081455_10229457 | Ga0081455_102294573 | 65 |
| 12 | 3300006038 | Ga0075365_10874710 | Ga0075365_108747102 | 65 |
| 13 | 3300006844 | Ga0075428_100007826 | Ga0075428_1000078267 | 65 |
| 14 | 3300006846 | Ga0075430_100686870 | Ga0075430_1006868702 | 65 |
| 15 | 3300006847 | Ga0075431_100914499 | Ga0075431_1009144992 | 65 |
| 16 | 3300013307 | Ga0157372_12082466 | Ga0157372_120824662 | 65 |
| 17 | 3300037853 | Ga0436364_1172050 | Ga0436364_1172050_765_962 | 65 |
| 18 | 3300039437 | Ga0436365_1252474 | Ga0436365_1252474_201_398 | 65 |
| 19 | 3300041916 | Ga0452271_38374 | Ga0452271_38374_58_279 | 65 |
| 20 | 3300049584 | Ga0501068_0175128 | Ga0501068_0175128_316_513 | 65 |
| 21 | 3300049586 | Ga0501070_1150317 | Ga0501070_1150317_119_316 | 65 |
| 22 | 3300049587 | Ga0501071_0650785 | Ga0501071_0650785_71_268 | 65 |
| 23 | 3300049587 | Ga0501071_1080935 | Ga0501071_1080935_207_404 | 65 |
| 24 | 3300049591 | Ga0501075_0481561 | Ga0501075_0481561_219_416 | 65 |
| 25 | 3300049742 | Ga0501080_0475256 | Ga0501080_0475256_174_371 | 65 |
| 26 | 3300050492 | nmdc:mga0yw44_488469_c1 | nmdc:mga0yw44_488469_c1_600_797 | 65 |
| 27 | 3300050508 | nmdc:mga09592_734563_c1 | nmdc:mga09592_734563_c1_552_749 | 65 |
| 28 | 3300050509 | nmdc:mga0qj67_161644_c1 | nmdc:mga0qj67_161644_c1_245_442 | 65 |
| 29 | 3300050510 | nmdc:mga06r32_580029_c1 | nmdc:mga06r32_580029_c1_577_774 | 65 |
| 30 | 3300054114 | Ga0501084_0912227 | Ga0501084_0912227_154_351 | 65 |
| 31 | 3300025938 | Ga0207704_11325229 | Ga0207704_113252291 | 66 |
| 32 | 3300031727 | Ga0316576_10499256 | Ga0316576_104992561 | 66 |
| 33 | 3300038741 | Ga0400488_07726 | Ga0400488_07726_977_1177 | 66 |
| 34 | 3300039062 | Ga0400483_071288 | Ga0400483_071288_344_544 | 66 |
| 35 | 3300039062 | Ga0400483_245707 | Ga0400483_245707_701_901 | 66 |
| 36 | 3300042876 | Ga0451577_0002384 | Ga0451577_0002384_5204_5404 | 66 |
| 37 | 3300044712 | Ga0453684_0006354 | Ga0453684_0006354_5225_5425 | 66 |
| 38 | 3300001976 | JGI24752J21851_1039726 | JGI24752J21851_10397261 | 67 |
| 39 | 3300001989 | JGI24739J22299_10176951 | JGI24739J22299_101769512 | 67 |
| 40 | 3300001990 | JGI24737J22298_10120012 | JGI24737J22298_101200121 | 67 |
| 41 | 3300001991 | JGI24743J22301_10111487 | JGI24743J22301_101114871 | 67 |
| 42 | 3300002067 | JGI24735J21928_10146789 | JGI24735J21928_101467892 | 67 |
| 43 | 3300002070 | JGI24750J21931_1032661 | JGI24750J21931_10326611 | 67 |
| 44 | 3300002075 | JGI24738J21930_10043036 | JGI24738J21930_100430363 | 67 |
| 45 | 3300002077 | JGI24744J21845_10088344 | JGI24744J21845_100883441 | 67 |
| 46 | 3300003163 | Ga0006759J45824_1009337 | Ga0006759J45824_10093371 | 67 |
| 47 | 3300003305 | Ga0006770J48903_1015579 | Ga0006770J48903_10155791 | 67 |
| 48 | 3300003308 | Ga0006777J48905_1007156 | Ga0006777J48905_10071561 | 67 |
| 49 | 3300003320 | rootH2_10173644 | rootH2_101736441 | 67 |
| 50 | 3300003568 | Ga0006781J51513_1005727 | Ga0006781J51513_10057271 | 67 |
| 51 | 3300003574 | Ga0007410J51695_1007933 | Ga0007410J51695_10079331 | 67 |
| 52 | 3300003574 | Ga0007410J51695_1070413 | Ga0007410J51695_10704131 | 67 |
| 53 | 3300003575 | Ga0007409J51694_1008940 | Ga0007409J51694_10089401 | 67 |
| 54 | 3300003577 | Ga0007416J51690_1009552 | Ga0007416J51690_10095521 | 67 |
| 55 | 3300003579 | Ga0007429J51699_1005706 | Ga0007429J51699_10057061 | 67 |
| 56 | 3300003693 | Ga0032354_1006874 | Ga0032354_10068741 | 67 |
| 57 | 3300003693 | Ga0032354_1021963 | Ga0032354_10219631 | 67 |
| 58 | 3300003735 | Ga0006780_1007240 | Ga0006780_10072401 | 67 |
| 59 | 3300004799 | Ga0058863_10086156 | Ga0058863_100861562 | 67 |
| 60 | 3300004800 | Ga0058861_10024356 | Ga0058861_100243562 | 67 |
| 61 | 3300004800 | Ga0058861_11947429 | Ga0058861_119474291 | 67 |
| 62 | 3300004800 | Ga0058861_12055410 | Ga0058861_120554101 | 67 |
| 63 | 3300004803 | Ga0058862_12747784 | Ga0058862_127477841 | 67 |
| 64 | 3300005327 | Ga0070658_10103253 | Ga0070658_101032536 | 67 |
| 65 | 3300005327 | Ga0070658_11101661 | Ga0070658_111016611 | 67 |
| 66 | 3300005329 | Ga0070683_100025174 | Ga0070683_1000251747 | 67 |
| 67 | 3300005329 | Ga0070683_100029003 | Ga0070683_1000290037 | 67 |
| 68 | 3300005329 | Ga0070683_100946691 | Ga0070683_1009466913 | 67 |
| 69 | 3300005329 | Ga0070683_101255292 | Ga0070683_1012552922 | 67 |
| 70 | 3300005330 | Ga0070690_100209619 | Ga0070690_1002096192 | 67 |
| 71 | 3300005330 | Ga0070690_100740480 | Ga0070690_1007404802 | 67 |
| 72 | 3300005331 | Ga0070670_100491451 | Ga0070670_1004914511 | 67 |
| 73 | 3300005334 | Ga0068869_100131270 | Ga0068869_1001312701 | 67 |
| 74 | 3300005334 | Ga0068869_101925432 | Ga0068869_1019254322 | 67 |
| 75 | 3300005334 | Ga0068869_102089018 | Ga0068869_1020890181 | 67 |
| 76 | 3300005335 | Ga0070666_10284923 | Ga0070666_102849231 | 67 |
| 77 | 3300005336 | Ga0070680_100009178 | Ga0070680_10000917810 | 67 |
| 78 | 3300005336 | Ga0070680_100404398 | Ga0070680_1004043982 | 67 |
| 79 | 3300005336 | Ga0070680_101121810 | Ga0070680_1011218101 | 67 |
| 80 | 3300005336 | Ga0070680_101571737 | Ga0070680_1015717371 | 67 |
| 81 | 3300005337 | Ga0070682_100013435 | Ga0070682_1000134355 | 67 |
| 82 | 3300005337 | Ga0070682_100046836 | Ga0070682_1000468361 | 67 |
| 83 | 3300005337 | Ga0070682_100047953 | Ga0070682_1000479534 | 67 |
| 84 | 3300005338 | Ga0068868_100741762 | Ga0068868_1007417621 | 67 |
| 85 | 3300005339 | Ga0070660_100062151 | Ga0070660_1000621513 | 67 |
| 86 | 3300005340 | Ga0070689_100419091 | Ga0070689_1004190912 | 67 |
| 87 | 3300005343 | Ga0070687_100050577 | Ga0070687_1000505772 | 67 |
| 88 | 3300005344 | Ga0070661_100029696 | Ga0070661_1000296966 | 67 |
| 89 | 3300005344 | Ga0070661_100458772 | Ga0070661_1004587722 | 67 |
| 90 | 3300005344 | Ga0070661_100658155 | Ga0070661_1006581552 | 67 |
| 91 | 3300005344 | Ga0070661_100754912 | Ga0070661_1007549122 | 67 |
| 92 | 3300005345 | Ga0070692_10053130 | Ga0070692_100531304 | 67 |
| 93 | 3300005345 | Ga0070692_10065551 | Ga0070692_100655511 | 67 |
| 94 | 3300005345 | Ga0070692_10088816 | Ga0070692_100888162 | 67 |
| 95 | 3300005347 | Ga0070668_100148388 | Ga0070668_1001483882 | 67 |
| 96 | 3300005353 | Ga0070669_100939135 | Ga0070669_1009391352 | 67 |
| 97 | 3300005354 | Ga0070675_100419253 | Ga0070675_1004192532 | 67 |
| 98 | 3300005355 | Ga0070671_100234697 | Ga0070671_1002346972 | 67 |
| 99 | 3300005355 | Ga0070671_101120267 | Ga0070671_1011202671 | 67 |
| 100 | 3300005356 | Ga0070674_101242586 | Ga0070674_1012425861 | 67 |
| 101 | 3300005364 | Ga0070673_100210805 | Ga0070673_1002108052 | 67 |
| 102 | 3300005365 | Ga0070688_100081477 | Ga0070688_1000814774 | 67 |
| 103 | 3300005366 | Ga0070659_100005205 | Ga0070659_1000052057 | 67 |
| 104 | 3300005366 | Ga0070659_100062916 | Ga0070659_1000629162 | 67 |
| 105 | 3300005366 | Ga0070659_100078511 | Ga0070659_1000785114 | 67 |
| 106 | 3300005366 | Ga0070659_101540249 | Ga0070659_1015402491 | 67 |
| 107 | 3300005367 | Ga0070667_100289316 | Ga0070667_1002893161 | 67 |
| 108 | 3300005367 | Ga0070667_101024455 | Ga0070667_1010244551 | 67 |
| 109 | 3300005435 | Ga0070714_100002604 | Ga0070714_1000026044 | 67 |
| 110 | 3300005435 | Ga0070714_101415437 | Ga0070714_1014154372 | 67 |
| 111 | 3300005436 | Ga0070713_100330367 | Ga0070713_1003303673 | 67 |
| 112 | 3300005437 | Ga0070710_10654659 | Ga0070710_106546592 | 67 |
| 113 | 3300005438 | Ga0070701_10275998 | Ga0070701_102759981 | 67 |
| 114 | 3300005438 | Ga0070701_10406431 | Ga0070701_104064312 | 67 |
| 115 | 3300005439 | Ga0070711_100079542 | Ga0070711_1000795425 | 67 |
| 116 | 3300005439 | Ga0070711_100853051 | Ga0070711_1008530512 | 67 |
| 117 | 3300005439 | Ga0070711_101297161 | Ga0070711_1012971612 | 67 |
| 118 | 3300005440 | Ga0070705_101553901 | Ga0070705_1015539011 | 67 |
| 119 | 3300005441 | Ga0070700_100375649 | Ga0070700_1003756492 | 67 |
| 120 | 3300005441 | Ga0070700_100478003 | Ga0070700_1004780032 | 67 |
| 121 | 3300005441 | Ga0070700_100539675 | Ga0070700_1005396752 | 67 |
| 122 | 3300005441 | Ga0070700_100742285 | Ga0070700_1007422851 | 67 |
| 123 | 3300005455 | Ga0070663_100006400 | Ga0070663_1000064007 | 67 |
| 124 | 3300005455 | Ga0070663_100851541 | Ga0070663_1008515411 | 67 |
| 125 | 3300005455 | Ga0070663_101167101 | Ga0070663_1011671011 | 67 |
| 126 | 3300005456 | Ga0070678_100511701 | Ga0070678_1005117012 | 67 |
| 127 | 3300005456 | Ga0070678_101842352 | Ga0070678_1018423521 | 67 |
| 128 | 3300005457 | Ga0070662_101084174 | Ga0070662_1010841742 | 67 |
| 129 | 3300005457 | Ga0070662_101166461 | Ga0070662_1011664612 | 67 |
| 130 | 3300005458 | Ga0070681_10145576 | Ga0070681_101455765 | 67 |
| 131 | 3300005458 | Ga0070681_10560106 | Ga0070681_105601063 | 67 |
| 132 | 3300005458 | Ga0070681_11270119 | Ga0070681_112701192 | 67 |
| 133 | 3300005459 | Ga0068867_100118120 | Ga0068867_1001181204 | 67 |
| 134 | 3300005466 | Ga0070685_10185385 | Ga0070685_101853852 | 67 |
| 135 | 3300005467 | Ga0070706_100348118 | Ga0070706_1003481182 | 67 |
| 136 | 3300005530 | Ga0070679_100026157 | Ga0070679_1000261577 | 67 |
| 137 | 3300005530 | Ga0070679_100056108 | Ga0070679_1000561082 | 67 |
| 138 | 3300005530 | Ga0070679_100402260 | Ga0070679_1004022603 | 67 |
| 139 | 3300005535 | Ga0070684_100026063 | Ga0070684_1000260639 | 67 |
| 140 | 3300005535 | Ga0070684_100075858 | Ga0070684_1000758584 | 67 |
| 141 | 3300005536 | Ga0070697_101401191 | Ga0070697_1014011911 | 67 |
| 142 | 3300005539 | Ga0068853_100064592 | Ga0068853_1000645925 | 67 |
| 143 | 3300005543 | Ga0070672_100040675 | Ga0070672_1000406756 | 67 |
| 144 | 3300005543 | Ga0070672_100311846 | Ga0070672_1003118462 | 67 |
| 145 | 3300005544 | Ga0070686_100048872 | Ga0070686_1000488723 | 67 |
| 146 | 3300005544 | Ga0070686_100533548 | Ga0070686_1005335482 | 67 |
| 147 | 3300005546 | Ga0070696_100341795 | Ga0070696_1003417952 | 67 |
| 148 | 3300005546 | Ga0070696_101011553 | Ga0070696_1010115532 | 67 |
| 149 | 3300005546 | Ga0070696_101378053 | Ga0070696_1013780531 | 67 |
| 150 | 3300005547 | Ga0070693_100762898 | Ga0070693_1007628982 | 67 |
| 151 | 3300005547 | Ga0070693_100925773 | Ga0070693_1009257732 | 67 |
| 152 | 3300005548 | Ga0070665_100005382 | Ga0070665_1000053828 | 67 |
| 153 | 3300005548 | Ga0070665_100164791 | Ga0070665_1001647913 | 67 |
| 154 | 3300005548 | Ga0070665_101171359 | Ga0070665_1011713591 | 67 |
| 155 | 3300005549 | Ga0070704_100079527 | Ga0070704_1000795273 | 67 |
| 156 | 3300005549 | Ga0070704_100259039 | Ga0070704_1002590393 | 67 |
| 157 | 3300005563 | Ga0068855_100317450 | Ga0068855_1003174503 | 67 |
| 158 | 3300005563 | Ga0068855_100739311 | Ga0068855_1007393112 | 67 |
| 159 | 3300005564 | Ga0070664_100032412 | Ga0070664_1000324126 | 67 |
| 160 | 3300005564 | Ga0070664_100506038 | Ga0070664_1005060383 | 67 |
| 161 | 3300005564 | Ga0070664_100525023 | Ga0070664_1005250232 | 67 |
| 162 | 3300005577 | Ga0068857_100073194 | Ga0068857_1000731944 | 67 |
| 163 | 3300005577 | Ga0068857_101346251 | Ga0068857_1013462512 | 67 |
| 164 | 3300005577 | Ga0068857_102437117 | Ga0068857_1024371171 | 67 |
| 165 | 3300005578 | Ga0068854_100054326 | Ga0068854_1000543262 | 67 |
| 166 | 3300005578 | Ga0068854_100197169 | Ga0068854_1001971695 | 67 |
| 167 | 3300005578 | Ga0068854_100376455 | Ga0068854_1003764552 | 67 |
| 168 | 3300005578 | Ga0068854_100485582 | Ga0068854_1004855822 | 67 |
| 169 | 3300005614 | Ga0068856_100040528 | Ga0068856_1000405284 | 67 |
| 170 | 3300005614 | Ga0068856_100054050 | Ga0068856_1000540509 | 67 |
| 171 | 3300005614 | Ga0068856_100161677 | Ga0068856_1001616772 | 67 |
| 172 | 3300005615 | Ga0070702_100005543 | Ga0070702_1000055437 | 67 |
| 173 | 3300005615 | Ga0070702_100199352 | Ga0070702_1001993522 | 67 |
| 174 | 3300005616 | Ga0068852_100002528 | Ga0068852_1000025284 | 67 |
| 175 | 3300005616 | Ga0068852_100240582 | Ga0068852_1002405822 | 67 |
| 176 | 3300005616 | Ga0068852_102411380 | Ga0068852_1024113801 | 67 |
| 177 | 3300005617 | Ga0068859_100722984 | Ga0068859_1007229843 | 67 |
| 178 | 3300005618 | Ga0068864_100151139 | Ga0068864_1001511391 | 67 |
| 179 | 3300005618 | Ga0068864_100907898 | Ga0068864_1009078981 | 67 |
| 180 | 3300005718 | Ga0068866_10103734 | Ga0068866_101037341 | 67 |
| 181 | 3300005718 | Ga0068866_10773972 | Ga0068866_107739722 | 67 |
| 182 | 3300005718 | Ga0068866_11348211 | Ga0068866_113482112 | 67 |
| 183 | 3300005719 | Ga0068861_100435847 | Ga0068861_1004358472 | 67 |
| 184 | 3300005834 | Ga0068851_10314571 | Ga0068851_103145712 | 67 |
| 185 | 3300005834 | Ga0068851_11066196 | Ga0068851_110661962 | 67 |
| 186 | 3300005840 | Ga0068870_10084559 | Ga0068870_100845592 | 67 |
| 187 | 3300005841 | Ga0068863_101659012 | Ga0068863_1016590122 | 67 |
| 188 | 3300005842 | Ga0068858_100042042 | Ga0068858_1000420423 | 67 |
| 189 | 3300005842 | Ga0068858_100490229 | Ga0068858_1004902291 | 67 |
| 190 | 3300005843 | Ga0068860_101062020 | Ga0068860_1010620203 | 67 |
| 191 | 3300005843 | Ga0068860_101248419 | Ga0068860_1012484192 | 67 |
| 192 | 3300005843 | Ga0068860_101901347 | Ga0068860_1019013472 | 67 |
| 193 | 3300005844 | Ga0068862_100036198 | Ga0068862_10003619811 | 67 |
| 194 | 3300005937 | Ga0081455_10220635 | Ga0081455_102206352 | 67 |
| 195 | 3300005937 | Ga0081455_10513489 | Ga0081455_105134891 | 67 |
| 196 | 3300005981 | Ga0081538_10002285 | Ga0081538_1000228515 | 67 |
| 197 | 3300005985 | Ga0081539_10009105 | Ga0081539_100091056 | 67 |
| 198 | 3300005985 | Ga0081539_10020386 | Ga0081539_1002038612 | 67 |
| 199 | 3300005985 | Ga0081539_10218691 | Ga0081539_102186911 | 67 |
| 200 | 3300005985 | Ga0081539_10435876 | Ga0081539_104358762 | 67 |
| 201 | 3300006028 | Ga0070717_10013602 | Ga0070717_100136024 | 67 |
| 202 | 3300006028 | Ga0070717_10264087 | Ga0070717_102640873 | 67 |
| 203 | 3300006028 | Ga0070717_10364462 | Ga0070717_103644624 | 67 |
| 204 | 3300006048 | Ga0075363_100393107 | Ga0075363_1003931072 | 67 |
| 205 | 3300006051 | Ga0075364_10279860 | Ga0075364_102798602 | 67 |
| 206 | 3300006058 | Ga0075432_10348788 | Ga0075432_103487882 | 67 |
| 207 | 3300006163 | Ga0070715_10234547 | Ga0070715_102345472 | 67 |
| 208 | 3300006175 | Ga0070712_100040365 | Ga0070712_1000403652 | 67 |
| 209 | 3300006175 | Ga0070712_100090701 | Ga0070712_1000907013 | 67 |
| 210 | 3300006175 | Ga0070712_100207020 | Ga0070712_1002070202 | 67 |
| 211 | 3300006175 | Ga0070712_100552258 | Ga0070712_1005522582 | 67 |
| 212 | 3300006175 | Ga0070712_100873284 | Ga0070712_1008732842 | 67 |
| 213 | 3300006175 | Ga0070712_101875812 | Ga0070712_1018758122 | 67 |
| 214 | 3300006237 | Ga0097621_102050385 | Ga0097621_1020503851 | 67 |
| 215 | 3300006358 | Ga0068871_100301781 | Ga0068871_1003017812 | 67 |
| 216 | 3300006844 | Ga0075428_101404487 | Ga0075428_1014044872 | 67 |
| 217 | 3300006852 | Ga0075433_10926550 | Ga0075433_109265502 | 67 |
| 218 | 3300006852 | Ga0075433_11451899 | Ga0075433_114518992 | 67 |
| 219 | 3300006871 | Ga0075434_100905870 | Ga0075434_1009058702 | 67 |
| 220 | 3300006881 | Ga0068865_100144646 | Ga0068865_1001446466 | 67 |
| 221 | 3300006931 | Ga0097620_100723026 | Ga0097620_1007230263 | 67 |
| 222 | 3300009092 | Ga0105250_10296314 | Ga0105250_102963142 | 67 |
| 223 | 3300009093 | Ga0105240_10065467 | Ga0105240_100654674 | 67 |
| 224 | 3300009093 | Ga0105240_10542921 | Ga0105240_105429212 | 67 |
| 225 | 3300009093 | Ga0105240_10931442 | Ga0105240_109314421 | 67 |
| 226 | 3300009093 | Ga0105240_11674293 | Ga0105240_116742931 | 67 |
| 227 | 3300009094 | Ga0111539_10184773 | Ga0111539_101847734 | 67 |
| 228 | 3300009094 | Ga0111539_10217989 | Ga0111539_102179895 | 67 |
| 229 | 3300009094 | Ga0111539_10402244 | Ga0111539_104022444 | 67 |
| 230 | 3300009098 | Ga0105245_10560527 | Ga0105245_105605272 | 67 |
| 231 | 3300009098 | Ga0105245_10585998 | Ga0105245_105859983 | 67 |
| 232 | 3300009098 | Ga0105245_10625767 | Ga0105245_106257672 | 67 |
| 233 | 3300009098 | Ga0105245_11703325 | Ga0105245_117033252 | 67 |
| 234 | 3300009098 | Ga0105245_12045100 | Ga0105245_120451002 | 67 |
| 235 | 3300009101 | Ga0105247_10214320 | Ga0105247_102143202 | 67 |
| 236 | 3300009148 | Ga0105243_10044918 | Ga0105243_100449182 | 67 |
| 237 | 3300009148 | Ga0105243_10174824 | Ga0105243_101748242 | 67 |
| 238 | 3300009148 | Ga0105243_10418111 | Ga0105243_104181114 | 67 |
| 239 | 3300009174 | Ga0105241_10917104 | Ga0105241_109171042 | 67 |
| 240 | 3300009176 | Ga0105242_10210140 | Ga0105242_102101402 | 67 |
| 241 | 3300009176 | Ga0105242_10998434 | Ga0105242_109984342 | 67 |
| 242 | 3300009176 | Ga0105242_11686467 | Ga0105242_116864671 | 67 |
| 243 | 3300009177 | Ga0105248_10684395 | Ga0105248_106843952 | 67 |
| 244 | 3300009177 | Ga0105248_12048594 | Ga0105248_120485941 | 67 |
| 245 | 3300009177 | Ga0105248_12233806 | Ga0105248_122338061 | 67 |
| 246 | 3300009545 | Ga0105237_10088308 | Ga0105237_100883083 | 67 |
| 247 | 3300009545 | Ga0105237_10120564 | Ga0105237_101205642 | 67 |
| 248 | 3300009545 | Ga0105237_10736282 | Ga0105237_107362823 | 67 |
| 249 | 3300009551 | Ga0105238_10020827 | Ga0105238_100208277 | 67 |
| 250 | 3300009551 | Ga0105238_10781069 | Ga0105238_107810692 | 67 |
| 251 | 3300009551 | Ga0105238_10819065 | Ga0105238_108190651 | 67 |
| 252 | 3300009553 | Ga0105249_10203210 | Ga0105249_102032102 | 67 |
| 253 | 3300009553 | Ga0105249_10211432 | Ga0105249_102114322 | 67 |
| 254 | 3300009553 | Ga0105249_11702719 | Ga0105249_117027191 | 67 |
| 255 | 3300009553 | Ga0105249_12101419 | Ga0105249_121014191 | 67 |
| 256 | 3300009553 | Ga0105249_12983364 | Ga0105249_129833641 | 67 |
| 257 | 3300010375 | Ga0105239_10111552 | Ga0105239_101115524 | 67 |
| 258 | 3300010375 | Ga0105239_10621559 | Ga0105239_106215592 | 67 |
| 259 | 3300010375 | Ga0105239_11167630 | Ga0105239_111676302 | 67 |
| 260 | 3300010375 | Ga0105239_13482531 | Ga0105239_134825311 | 67 |
| 261 | 3300011119 | Ga0105246_10027459 | Ga0105246_100274593 | 67 |
| 262 | 3300011119 | Ga0105246_10170182 | Ga0105246_101701822 | 67 |
| 263 | 3300011119 | Ga0105246_10753653 | Ga0105246_107536531 | 67 |
| 264 | 3300011119 | Ga0105246_11772598 | Ga0105246_117725982 | 67 |
| 265 | 3300013102 | Ga0157371_10190198 | Ga0157371_101901983 | 67 |
| 266 | 3300013102 | Ga0157371_11182057 | Ga0157371_111820571 | 67 |
| 267 | 3300013104 | Ga0157370_10212012 | Ga0157370_102120124 | 67 |
| 268 | 3300013296 | Ga0157374_10808412 | Ga0157374_108084121 | 67 |
| 269 | 3300013306 | Ga0163162_10097041 | Ga0163162_100970413 | 67 |
| 270 | 3300013306 | Ga0163162_10766286 | Ga0163162_107662862 | 67 |
| 271 | 3300013306 | Ga0163162_10862717 | Ga0163162_108627172 | 67 |
| 272 | 3300013306 | Ga0163162_11343259 | Ga0163162_113432592 | 67 |
| 273 | 3300013306 | Ga0163162_11383608 | Ga0163162_113836081 | 67 |
| 274 | 3300013306 | Ga0163162_11478242 | Ga0163162_114782422 | 67 |
| 275 | 3300013307 | Ga0157372_10040300 | Ga0157372_100403001 | 67 |
| 276 | 3300013307 | Ga0157372_10569961 | Ga0157372_105699613 | 67 |
| 277 | 3300013307 | Ga0157372_12314821 | Ga0157372_123148212 | 67 |
| 278 | 3300013307 | Ga0157372_12971660 | Ga0157372_129716602 | 67 |
| 279 | 3300013308 | Ga0157375_10461886 | Ga0157375_104618862 | 67 |
| 280 | 3300013308 | Ga0157375_10850104 | Ga0157375_108501042 | 67 |
| 281 | 3300013308 | Ga0157375_12108423 | Ga0157375_121084232 | 67 |
| 282 | 3300013308 | Ga0157375_13590201 | Ga0157375_135902012 | 67 |
| 283 | 3300014325 | Ga0163163_10043188 | Ga0163163_100431886 | 67 |
| 284 | 3300014325 | Ga0163163_10078878 | Ga0163163_100788785 | 67 |
| 285 | 3300014325 | Ga0163163_10858482 | Ga0163163_108584821 | 67 |
| 286 | 3300014325 | Ga0163163_11059568 | Ga0163163_110595682 | 67 |
| 287 | 3300014326 | Ga0157380_10596324 | Ga0157380_105963243 | 67 |
| 288 | 3300014326 | Ga0157380_10745133 | Ga0157380_107451333 | 67 |
| 289 | 3300014326 | Ga0157380_13474691 | Ga0157380_134746912 | 67 |
| 290 | 3300014497 | Ga0182008_10161540 | Ga0182008_101615401 | 67 |
| 291 | 3300014497 | Ga0182008_10414837 | Ga0182008_104148371 | 67 |
| 292 | 3300014968 | Ga0157379_10005028 | Ga0157379_100050287 | 67 |
| 293 | 3300014968 | Ga0157379_10010528 | Ga0157379_100105289 | 67 |
| 294 | 3300014968 | Ga0157379_10260678 | Ga0157379_102606783 | 67 |
| 295 | 3300014968 | Ga0157379_10324024 | Ga0157379_103240242 | 67 |
| 296 | 3300014969 | Ga0157376_10478734 | Ga0157376_104787342 | 67 |
| 297 | 3300015261 | Ga0182006_1232934 | Ga0182006_12329342 | 67 |
| 298 | 3300020069 | Ga0197907_10092187 | Ga0197907_100921871 | 67 |
| 299 | 3300020069 | Ga0197907_10239788 | Ga0197907_102397881 | 67 |
| 300 | 3300020069 | Ga0197907_10973848 | Ga0197907_109738481 | 67 |
| 301 | 3300020069 | Ga0197907_11102414 | Ga0197907_111024141 | 67 |
| 302 | 3300020070 | Ga0206356_11646062 | Ga0206356_116460624 | 67 |
| 303 | 3300020076 | Ga0206355_1123530 | Ga0206355_11235301 | 67 |
| 304 | 3300020076 | Ga0206355_1688314 | Ga0206355_16883141 | 67 |
| 305 | 3300020078 | Ga0206352_10274325 | Ga0206352_102743251 | 67 |
| 306 | 3300020080 | Ga0206350_11398817 | Ga0206350_113988172 | 67 |
| 307 | 3300020081 | Ga0206354_10523478 | Ga0206354_105234782 | 67 |
| 308 | 3300020081 | Ga0206354_11018118 | Ga0206354_110181181 | 67 |
| 309 | 3300020081 | Ga0206354_11697946 | Ga0206354_116979462 | 67 |
| 310 | 3300020082 | Ga0206353_10172718 | Ga0206353_101727183 | 67 |
| 311 | 3300020082 | Ga0206353_11084932 | Ga0206353_110849321 | 67 |
| 312 | 3300020082 | Ga0206353_11499693 | Ga0206353_114996931 | 67 |
| 313 | 3300020082 | Ga0206353_11826723 | Ga0206353_118267233 | 67 |
| 314 | 3300020610 | Ga0154015_1534401 | Ga0154015_15344011 | 67 |
| 315 | 3300021384 | Ga0213876_10031767 | Ga0213876_100317673 | 67 |
| 316 | 3300021384 | Ga0213876_10037964 | Ga0213876_100379644 | 67 |
| 317 | 3300021384 | Ga0213876_10145291 | Ga0213876_101452913 | 67 |
| 318 | 3300021384 | Ga0213876_10230597 | Ga0213876_102305972 | 67 |
| 319 | 3300021388 | Ga0213875_10394599 | Ga0213875_103945991 | 67 |
| 320 | 3300021388 | Ga0213875_10433333 | Ga0213875_104333331 | 67 |
| 321 | 3300021388 | Ga0213875_10627677 | Ga0213875_106276771 | 67 |
| 322 | 3300022467 | Ga0224712_10076530 | Ga0224712_100765303 | 67 |
| 323 | 3300022467 | Ga0224712_10449919 | Ga0224712_104499192 | 67 |
| 324 | 3300022467 | Ga0224712_10667780 | Ga0224712_106677801 | 67 |
| 325 | 3300023672 | Ga0247553_110050 | Ga0247553_1100501 | 67 |
| 326 | 3300024225 | Ga0224572_1019933 | Ga0224572_10199331 | 67 |
| 327 | 3300025898 | Ga0207692_10011924 | Ga0207692_100119242 | 67 |
| 328 | 3300025898 | Ga0207692_11013671 | Ga0207692_110136711 | 67 |
| 329 | 3300025899 | Ga0207642_10172657 | Ga0207642_101726572 | 67 |
| 330 | 3300025899 | Ga0207642_10537377 | Ga0207642_105373771 | 67 |
| 331 | 3300025900 | Ga0207710_10124959 | Ga0207710_101249592 | 67 |
| 332 | 3300025901 | Ga0207688_10003660 | Ga0207688_1000366011 | 67 |
| 333 | 3300025903 | Ga0207680_10032628 | Ga0207680_100326282 | 67 |
| 334 | 3300025903 | Ga0207680_10138418 | Ga0207680_101384182 | 67 |
| 335 | 3300025903 | Ga0207680_10858332 | Ga0207680_108583321 | 67 |
| 336 | 3300025904 | Ga0207647_10242412 | Ga0207647_102424122 | 67 |
| 337 | 3300025906 | Ga0207699_11457374 | Ga0207699_114573741 | 67 |
| 338 | 3300025908 | Ga0207643_10019178 | Ga0207643_1001917810 | 67 |
| 339 | 3300025908 | Ga0207643_10290889 | Ga0207643_102908892 | 67 |
| 340 | 3300025909 | Ga0207705_10610596 | Ga0207705_106105963 | 67 |
| 341 | 3300025909 | Ga0207705_10647338 | Ga0207705_106473382 | 67 |
| 342 | 3300025909 | Ga0207705_10891066 | Ga0207705_108910662 | 67 |
| 343 | 3300025911 | Ga0207654_10415930 | Ga0207654_104159302 | 67 |
| 344 | 3300025912 | Ga0207707_10032934 | Ga0207707_100329345 | 67 |
| 345 | 3300025912 | Ga0207707_10444550 | Ga0207707_104445501 | 67 |
| 346 | 3300025912 | Ga0207707_11056780 | Ga0207707_110567801 | 67 |
| 347 | 3300025913 | Ga0207695_10158233 | Ga0207695_101582333 | 67 |
| 348 | 3300025913 | Ga0207695_11227611 | Ga0207695_112276111 | 67 |
| 349 | 3300025914 | Ga0207671_10056406 | Ga0207671_100564062 | 67 |
| 350 | 3300025914 | Ga0207671_10578605 | Ga0207671_105786051 | 67 |
| 351 | 3300025914 | Ga0207671_10634694 | Ga0207671_106346941 | 67 |
| 352 | 3300025914 | Ga0207671_10757848 | Ga0207671_107578481 | 67 |
| 353 | 3300025915 | Ga0207693_10109594 | Ga0207693_101095941 | 67 |
| 354 | 3300025915 | Ga0207693_10127483 | Ga0207693_101274833 | 67 |
| 355 | 3300025915 | Ga0207693_10248343 | Ga0207693_102483433 | 67 |
| 356 | 3300025915 | Ga0207693_10314872 | Ga0207693_103148723 | 67 |
| 357 | 3300025915 | Ga0207693_11075797 | Ga0207693_110757971 | 67 |
| 358 | 3300025916 | Ga0207663_10857561 | Ga0207663_108575611 | 67 |
| 359 | 3300025916 | Ga0207663_11363796 | Ga0207663_113637961 | 67 |
| 360 | 3300025917 | Ga0207660_10007525 | Ga0207660_100075259 | 67 |
| 361 | 3300025917 | Ga0207660_10158944 | Ga0207660_101589441 | 67 |
| 362 | 3300025917 | Ga0207660_10944957 | Ga0207660_109449572 | 67 |
| 363 | 3300025917 | Ga0207660_11372464 | Ga0207660_113724641 | 67 |
| 364 | 3300025918 | Ga0207662_10146599 | Ga0207662_101465991 | 67 |
| 365 | 3300025919 | Ga0207657_10027381 | Ga0207657_100273815 | 67 |
| 366 | 3300025919 | Ga0207657_10134714 | Ga0207657_101347145 | 67 |
| 367 | 3300025920 | Ga0207649_10029488 | Ga0207649_100294885 | 67 |
| 368 | 3300025920 | Ga0207649_10419488 | Ga0207649_104194881 | 67 |
| 369 | 3300025920 | Ga0207649_10505660 | Ga0207649_105056602 | 67 |
| 370 | 3300025920 | Ga0207649_11284417 | Ga0207649_112844172 | 67 |
| 371 | 3300025921 | Ga0207652_10003131 | Ga0207652_1000313112 | 67 |
| 372 | 3300025921 | Ga0207652_10032286 | Ga0207652_100322864 | 67 |
| 373 | 3300025921 | Ga0207652_10762269 | Ga0207652_107622691 | 67 |
| 374 | 3300025923 | Ga0207681_10249412 | Ga0207681_102494121 | 67 |
| 375 | 3300025923 | Ga0207681_10813039 | Ga0207681_108130392 | 67 |
| 376 | 3300025924 | Ga0207694_10042276 | Ga0207694_100422765 | 67 |
| 377 | 3300025924 | Ga0207694_10485036 | Ga0207694_104850362 | 67 |
| 378 | 3300025925 | Ga0207650_10658635 | Ga0207650_106586352 | 67 |
| 379 | 3300025926 | Ga0207659_10902917 | Ga0207659_109029171 | 67 |
| 380 | 3300025927 | Ga0207687_10571439 | Ga0207687_105714393 | 67 |
| 381 | 3300025927 | Ga0207687_11262171 | Ga0207687_112621711 | 67 |
| 382 | 3300025927 | Ga0207687_11658149 | Ga0207687_116581492 | 67 |
| 383 | 3300025928 | Ga0207700_10904365 | Ga0207700_109043651 | 67 |
| 384 | 3300025928 | Ga0207700_11007578 | Ga0207700_110075782 | 67 |
| 385 | 3300025928 | Ga0207700_11029220 | Ga0207700_110292202 | 67 |
| 386 | 3300025928 | Ga0207700_11486110 | Ga0207700_114861101 | 67 |
| 387 | 3300025929 | Ga0207664_10006553 | Ga0207664_100065536 | 67 |
| 388 | 3300025929 | Ga0207664_10323760 | Ga0207664_103237602 | 67 |
| 389 | 3300025929 | Ga0207664_11084752 | Ga0207664_110847522 | 67 |
| 390 | 3300025931 | Ga0207644_10154217 | Ga0207644_101542172 | 67 |
| 391 | 3300025931 | Ga0207644_10924766 | Ga0207644_109247662 | 67 |
| 392 | 3300025932 | Ga0207690_10041521 | Ga0207690_100415213 | 67 |
| 393 | 3300025932 | Ga0207690_10120307 | Ga0207690_101203073 | 67 |
| 394 | 3300025932 | Ga0207690_10123871 | Ga0207690_101238713 | 67 |
| 395 | 3300025933 | Ga0207706_10320690 | Ga0207706_103206902 | 67 |
| 396 | 3300025933 | Ga0207706_10386689 | Ga0207706_103866892 | 67 |
| 397 | 3300025934 | Ga0207686_10313043 | Ga0207686_103130432 | 67 |
| 398 | 3300025934 | Ga0207686_10599848 | Ga0207686_105998482 | 67 |
| 399 | 3300025934 | Ga0207686_10855341 | Ga0207686_108553412 | 67 |
| 400 | 3300025934 | Ga0207686_10872660 | Ga0207686_108726601 | 67 |
| 401 | 3300025935 | Ga0207709_10053930 | Ga0207709_100539302 | 67 |
| 402 | 3300025935 | Ga0207709_10068603 | Ga0207709_100686032 | 67 |
| 403 | 3300025935 | Ga0207709_10389008 | Ga0207709_103890084 | 67 |
| 404 | 3300025935 | Ga0207709_10671910 | Ga0207709_106719101 | 67 |
| 405 | 3300025936 | Ga0207670_10036264 | Ga0207670_100362646 | 67 |
| 406 | 3300025938 | Ga0207704_10856106 | Ga0207704_108561061 | 67 |
| 407 | 3300025940 | Ga0207691_10052766 | Ga0207691_100527662 | 67 |
| 408 | 3300025940 | Ga0207691_10919030 | Ga0207691_109190301 | 67 |
| 409 | 3300025941 | Ga0207711_11824410 | Ga0207711_118244101 | 67 |
| 410 | 3300025941 | Ga0207711_12051244 | Ga0207711_120512442 | 67 |
| 411 | 3300025942 | Ga0207689_10025277 | Ga0207689_100252776 | 67 |
| 412 | 3300025942 | Ga0207689_10547656 | Ga0207689_105476561 | 67 |
| 413 | 3300025944 | Ga0207661_10025325 | Ga0207661_100253255 | 67 |
| 414 | 3300025944 | Ga0207661_10313609 | Ga0207661_103136093 | 67 |
| 415 | 3300025944 | Ga0207661_11673634 | Ga0207661_116736341 | 67 |
| 416 | 3300025945 | Ga0207679_10552579 | Ga0207679_105525791 | 67 |
| 417 | 3300025945 | Ga0207679_10778668 | Ga0207679_107786681 | 67 |
| 418 | 3300025945 | Ga0207679_12153407 | Ga0207679_121534071 | 67 |
| 419 | 3300025949 | Ga0207667_10742754 | Ga0207667_107427542 | 67 |
| 420 | 3300025949 | Ga0207667_10834386 | Ga0207667_108343862 | 67 |
| 421 | 3300025960 | Ga0207651_10275786 | Ga0207651_102757861 | 67 |
| 422 | 3300025961 | Ga0207712_10174163 | Ga0207712_101741632 | 67 |
| 423 | 3300025961 | Ga0207712_10982705 | Ga0207712_109827052 | 67 |
| 424 | 3300025961 | Ga0207712_11004610 | Ga0207712_110046102 | 67 |
| 425 | 3300025972 | Ga0207668_10788565 | Ga0207668_107885652 | 67 |
| 426 | 3300025981 | Ga0207640_10741274 | Ga0207640_107412742 | 67 |
| 427 | 3300025981 | Ga0207640_10750854 | Ga0207640_107508541 | 67 |
| 428 | 3300025986 | Ga0207658_10024718 | Ga0207658_100247181 | 67 |
| 429 | 3300025986 | Ga0207658_11562399 | Ga0207658_115623991 | 67 |
| 430 | 3300026023 | Ga0207677_10190089 | Ga0207677_101900892 | 67 |
| 431 | 3300026035 | Ga0207703_10116619 | Ga0207703_101166193 | 67 |
| 432 | 3300026035 | Ga0207703_11152083 | Ga0207703_111520832 | 67 |
| 433 | 3300026041 | Ga0207639_11072401 | Ga0207639_110724011 | 67 |
| 434 | 3300026067 | Ga0207678_10460419 | Ga0207678_104604191 | 67 |
| 435 | 3300026067 | Ga0207678_10817585 | Ga0207678_108175852 | 67 |
| 436 | 3300026067 | Ga0207678_11323441 | Ga0207678_113234412 | 67 |
| 437 | 3300026075 | Ga0207708_10160247 | Ga0207708_101602472 | 67 |
| 438 | 3300026075 | Ga0207708_11049557 | Ga0207708_110495572 | 67 |
| 439 | 3300026078 | Ga0207702_10014101 | Ga0207702_100141012 | 67 |
| 440 | 3300026078 | Ga0207702_10901435 | Ga0207702_109014351 | 67 |
| 441 | 3300026078 | Ga0207702_11241220 | Ga0207702_112412201 | 67 |
| 442 | 3300026088 | Ga0207641_11386158 | Ga0207641_113861582 | 67 |
| 443 | 3300026088 | Ga0207641_12607761 | Ga0207641_126077611 | 67 |
| 444 | 3300026089 | Ga0207648_10092311 | Ga0207648_100923112 | 67 |
| 445 | 3300026089 | Ga0207648_10313114 | Ga0207648_103131143 | 67 |
| 446 | 3300026089 | Ga0207648_11014940 | Ga0207648_110149402 | 67 |
| 447 | 3300026095 | Ga0207676_10032636 | Ga0207676_100326369 | 67 |
| 448 | 3300026095 | Ga0207676_11485874 | Ga0207676_114858741 | 67 |
| 449 | 3300026116 | Ga0207674_10040431 | Ga0207674_100404316 | 67 |
| 450 | 3300026116 | Ga0207674_10489005 | Ga0207674_104890051 | 67 |
| 451 | 3300026116 | Ga0207674_10614215 | Ga0207674_106142151 | 67 |
| 452 | 3300026116 | Ga0207674_10945240 | Ga0207674_109452403 | 67 |
| 453 | 3300026116 | Ga0207674_11671768 | Ga0207674_116717681 | 67 |
| 454 | 3300026118 | Ga0207675_100276286 | Ga0207675_1002762862 | 67 |
| 455 | 3300026118 | Ga0207675_100986012 | Ga0207675_1009860122 | 67 |
| 456 | 3300026118 | Ga0207675_102447775 | Ga0207675_1024477752 | 67 |
| 457 | 3300026121 | Ga0207683_10413477 | Ga0207683_104134772 | 67 |
| 458 | 3300026121 | Ga0207683_11521360 | Ga0207683_115213601 | 67 |
| 459 | 3300026142 | Ga0207698_10028653 | Ga0207698_100286535 | 67 |
| 460 | 3300026142 | Ga0207698_10324984 | Ga0207698_103249841 | 67 |
| 461 | 3300027876 | Ga0209974_10241200 | Ga0209974_102412001 | 67 |
| 462 | 3300027907 | Ga0207428_10111641 | Ga0207428_101116412 | 67 |
| 463 | 3300027907 | Ga0207428_10284171 | Ga0207428_102841712 | 67 |
| 464 | 3300028379 | Ga0268266_10000715 | Ga0268266_1000071521 | 67 |
| 465 | 3300028379 | Ga0268266_10130480 | Ga0268266_101304802 | 67 |
| 466 | 3300028380 | Ga0268265_10052448 | Ga0268265_100524482 | 67 |
| 467 | 3300028381 | Ga0268264_10953111 | Ga0268264_109531112 | 67 |
| 468 | 3300028381 | Ga0268264_11516921 | Ga0268264_115169212 | 67 |
| 469 | 3300028800 | Ga0265338_10327162 | Ga0265338_103271621 | 67 |
| 470 | 3300028800 | Ga0265338_10441942 | Ga0265338_104419421 | 67 |
| 471 | 3300030760 | Ga0265762_1162632 | Ga0265762_11626322 | 67 |
| 472 | 3300030836 | Ga0265767_106388 | Ga0265767_1063882 | 67 |
| 473 | 3300030863 | Ga0265766_1007124 | Ga0265766_10071241 | 67 |
| 474 | 3300031548 | Ga0307408_102524544 | Ga0307408_1025245441 | 67 |
| 475 | 3300031727 | Ga0316576_10025487 | Ga0316576_100254872 | 67 |
| 476 | 3300031901 | Ga0307406_10338782 | Ga0307406_103387821 | 67 |
| 477 | 3300031901 | Ga0307406_11625360 | Ga0307406_116253601 | 67 |
| 478 | 3300031995 | Ga0307409_100615760 | Ga0307409_1006157604 | 67 |
| 479 | 3300031995 | Ga0307409_100749340 | Ga0307409_1007493402 | 67 |
| 480 | 3300032002 | Ga0307416_101191273 | Ga0307416_1011912731 | 67 |
| 481 | 3300032002 | Ga0307416_101278187 | Ga0307416_1012781872 | 67 |
| 482 | 3300032004 | Ga0307414_10567494 | Ga0307414_105674942 | 67 |
| 483 | 3300034820 | Ga0373959_0167033 | Ga0373959_0167033_99_302 | 67 |
| 484 | 3300035084 | Ga0373928_0114961 | Ga0373928_0114961_345_548 | 67 |
| 485 | 3300035086 | Ga0373934_0000135 | Ga0373934_0000135_26460_26663 | 67 |
| 486 | 3300035117 | Ga0373953_0000554 | Ga0373953_0000554_1785_1988 | 67 |
| 487 | 3300035118 | Ga0373954_0072834 | Ga0373954_0072834_898_1101 | 67 |
| 488 | 3300035119 | Ga0373956_0000989 | Ga0373956_0000989_7140_7343 | 67 |
| 489 | 3300035120 | Ga0373957_0002047 | Ga0373957_0002047_1960_2163 | 67 |
| 490 | 3300035170 | Ga0373943_0039967 | Ga0373943_0039967_1882_2085 | 67 |
| 491 | 3300035172 | Ga0373955_0000137 | Ga0373955_0000137_28356_28559 | 67 |
| 492 | 3300035207 | Ga0373942_0143643 | Ga0373942_0143643_523_726 | 67 |
| 493 | 3300035241 | Ga0373961_0221272 | Ga0373961_0221272_391_594 | 67 |
| 494 | 3300035410 | Ga0373924_0003189 | Ga0373924_0003189_3429_3632 | 67 |
| 495 | 3300035691 | Ga0373931_0351334 | Ga0373931_0351334_597_800 | 67 |
| 496 | 3300035692 | Ga0373935_0536195 | Ga0373935_0536195_517_720 | 67 |
| 497 | 3300035724 | Ga0373933_0000015 | Ga0373933_0000015_73829_74032 | 67 |
| 498 | 3300035725 | Ga0373947_0701654 | Ga0373947_0701654_302_505 | 67 |
| 499 | 3300036401 | Ga0373937_0000053 | Ga0373937_0000053_73829_74032 | 67 |
| 500 | 3300037068 | Ga0373925_0474514 | Ga0373925_0474514_335_538 | 67 |
| 501 | 3300037312 | Ga0395899_0297731 | Ga0395899_0297731_644_847 | 67 |
| 502 | 3300037418 | Ga0395900_0055408 | Ga0395900_0055408_861_1064 | 67 |
| 503 | 3300037418 | Ga0395900_0377548 | Ga0395900_0377548_415_618 | 67 |
| 504 | 3300037418 | Ga0395900_0455918 | Ga0395900_0455918_678_881 | 67 |
| 505 | 3300037418 | Ga0395900_0653451 | Ga0395900_0653451_176_379 | 67 |
| 506 | 3300037418 | Ga0395900_0802922 | Ga0395900_0802922_298_501 | 67 |
| 507 | 3300037418 | Ga0395900_0886005 | Ga0395900_0886005_209_412 | 67 |
| 508 | 3300037418 | Ga0395900_1147943 | Ga0395900_1147943_99_302 | 67 |
| 509 | 3300037418 | Ga0395900_1426799 | Ga0395900_1426799_276_479 | 67 |
| 510 | 3300037418 | Ga0395900_1681068 | Ga0395900_1681068_22_225 | 67 |
| 511 | 3300037466 | Ga0395898_0004284 | Ga0395898_0004284_7183_7386 | 67 |
| 512 | 3300037466 | Ga0395898_0043019 | Ga0395898_0043019_2466_2669 | 67 |
| 513 | 3300037466 | Ga0395898_0047366 | Ga0395898_0047366_1727_1930 | 67 |
| 514 | 3300037466 | Ga0395898_0085742 | Ga0395898_0085742_959_1162 | 67 |
| 515 | 3300037466 | Ga0395898_0177753 | Ga0395898_0177753_1027_1230 | 67 |
| 516 | 3300037466 | Ga0395898_0293392 | Ga0395898_0293392_1070_1273 | 67 |
| 517 | 3300037466 | Ga0395898_0386924 | Ga0395898_0386924_920_1123 | 67 |
| 518 | 3300037466 | Ga0395898_0427378 | Ga0395898_0427378_482_685 | 67 |
| 519 | 3300037471 | Ga0395905_0484277 | Ga0395905_0484277_877_1080 | 67 |
| 520 | 3300037471 | Ga0395905_0896645 | Ga0395905_0896645_558_761 | 67 |
| 521 | 3300037471 | Ga0395905_0964298 | Ga0395905_0964298_30_233 | 67 |
| 522 | 3300037471 | Ga0395905_1317433 | Ga0395905_1317433_59_262 | 67 |
| 523 | 3300037853 | Ga0436364_0034070 | Ga0436364_0034070_2054_2257 | 67 |
| 524 | 3300037853 | Ga0436364_0372858 | Ga0436364_0372858_210_413 | 67 |
| 525 | 3300037853 | Ga0436364_0893802 | Ga0436364_0893802_3577_3780 | 67 |
| 526 | 3300037853 | Ga0436364_0985211 | Ga0436364_0985211_410_613 | 67 |
| 527 | 3300037853 | Ga0436364_1286757 | Ga0436364_1286757_805_1008 | 67 |
| 528 | 3300037853 | Ga0436364_1422689 | Ga0436364_1422689_25_228 | 67 |
| 529 | 3300038443 | Ga0395901_0042302 | Ga0395901_0042302_913_1116 | 67 |
| 530 | 3300038443 | Ga0395901_0057070 | Ga0395901_0057070_1982_2185 | 67 |
| 531 | 3300038443 | Ga0395901_0101268 | Ga0395901_0101268_2788_2991 | 67 |
| 532 | 3300038443 | Ga0395901_0150453 | Ga0395901_0150453_800_1003 | 67 |
| 533 | 3300038443 | Ga0395901_0242629 | Ga0395901_0242629_644_847 | 67 |
| 534 | 3300038443 | Ga0395901_0346873 | Ga0395901_0346873_618_821 | 67 |
| 535 | 3300038443 | Ga0395901_0428782 | Ga0395901_0428782_692_895 | 67 |
| 536 | 3300038443 | Ga0395901_0508238 | Ga0395901_0508238_565_768 | 67 |
| 537 | 3300038443 | Ga0395901_0510228 | Ga0395901_0510228_129_332 | 67 |
| 538 | 3300038443 | Ga0395901_0703250 | Ga0395901_0703250_490_693 | 67 |
| 539 | 3300038443 | Ga0395901_0726759 | Ga0395901_0726759_754_957 | 67 |
| 540 | 3300038443 | Ga0395901_1290437 | Ga0395901_1290437_151_354 | 67 |
| 541 | 3300038996 | Ga0242420_114517 | Ga0242420_114517_160_363 | 67 |
| 542 | 3300039437 | Ga0436365_0254787 | Ga0436365_0254787_506_709 | 67 |
| 543 | 3300039437 | Ga0436365_0860754 | Ga0436365_0860754_954_1157 | 67 |
| 544 | 3300039437 | Ga0436365_1156917 | Ga0436365_1156917_845_1048 | 67 |
| 545 | 3300039437 | Ga0436365_1357803 | Ga0436365_1357803_660_863 | 67 |
| 546 | 3300039450 | Ga0436363_0314174 | Ga0436363_0314174_56_259 | 67 |
| 547 | 3300039450 | Ga0436363_0436762 | Ga0436363_0436762_677_880 | 67 |
| 548 | 3300039450 | Ga0436363_0753556 | Ga0436363_0753556_189_392 | 67 |
| 549 | 3300039450 | Ga0436363_0814925 | Ga0436363_0814925_831_1034 | 67 |
| 550 | 3300039450 | Ga0436363_1693937 | Ga0436363_1693937_704_907 | 67 |
| 551 | 3300039453 | Ga0436362_0074627 | Ga0436362_0074627_193_396 | 67 |
| 552 | 3300039453 | Ga0436362_0990170 | Ga0436362_0990170_268_471 | 67 |
| 553 | 3300041443 | Ga0451789_1165134 | Ga0451789_1165134_278_481 | 67 |
| 554 | 3300041452 | Ga0451793_1298945 | Ga0451793_1298945_356_559 | 67 |
| 555 | 3300041456 | Ga0451795_0263037 | Ga0451795_0263037_408_611 | 67 |
| 556 | 3300041459 | Ga0451800_1364612 | Ga0451800_1364612_283_486 | 67 |
| 557 | 3300041460 | Ga0451802_1226528 | Ga0451802_1226528_474_677 | 67 |
| 558 | 3300041463 | Ga0451804_0044416 | Ga0451804_0044416_441_644 | 67 |
| 559 | 3300041507 | Ga0451851_0708761 | Ga0451851_0708761_443_646 | 67 |
| 560 | 3300041511 | Ga0451855_1796818 | Ga0451855_1796818_422_625 | 67 |
| 561 | 3300042013 | Ga0439456_097264 | Ga0439456_097264_86_289 | 67 |
| 562 | 3300042461 | Ga0439460_0226174 | Ga0439460_0226174_18_221 | 67 |
| 563 | 3300044683 | Ga0466965_0720345 | Ga0466965_0720345_192_395 | 67 |
| 564 | 3300044684 | Ga0466966_0112099 | Ga0466966_0112099_1339_1542 | 67 |
| 565 | 3300044693 | Ga0466961_0099779 | Ga0466961_0099779_349_552 | 67 |
| 566 | 3300044693 | Ga0466961_0670796 | Ga0466961_0670796_319_522 | 67 |
| 567 | 3300044694 | Ga0466963_0001854 | Ga0466963_0001854_7301_7504 | 67 |
| 568 | 3300044694 | Ga0466963_0040517 | Ga0466963_0040517_1487_1690 | 67 |
| 569 | 3300044694 | Ga0466963_0178057 | Ga0466963_0178057_1181_1384 | 67 |
| 570 | 3300044719 | Ga0466971_0181606 | Ga0466971_0181606_572_775 | 67 |
| 571 | 3300044719 | Ga0466971_0329889 | Ga0466971_0329889_11_214 | 67 |
| 572 | 3300044735 | Ga0466968_0166505 | Ga0466968_0166505_328_531 | 67 |
| 573 | 3300044735 | Ga0466968_0199083 | Ga0466968_0199083_196_399 | 67 |
| 574 | 3300044735 | Ga0466968_0359354 | Ga0466968_0359354_219_422 | 67 |
| 575 | 3300044765 | Ga0466970_0137838 | Ga0466970_0137838_874_1077 | 67 |
| 576 | 3300044842 | Ga0466957_0457415 | Ga0466957_0457415_158_361 | 67 |
| 577 | 3300044901 | Ga0466960_0342783 | Ga0466960_0342783_296_499 | 67 |
| 578 | 3300044901 | Ga0466960_0413950 | Ga0466960_0413950_52_255 | 67 |
| 579 | 3300045049 | Ga0466959_0214896 | Ga0466959_0214896_1089_1292 | 67 |
| 580 | 3300045049 | Ga0466959_0248475 | Ga0466959_0248475_940_1143 | 67 |
| 581 | 3300045049 | Ga0466959_0332664 | Ga0466959_0332664_181_384 | 67 |
| 582 | 3300045836 | Ga0466958_0003571 | Ga0466958_0003571_1160_1363 | 67 |
| 583 | 3300045976 | Ga0466967_0020832 | Ga0466967_0020832_853_1056 | 67 |
| 584 | 3300045976 | Ga0466967_0170345 | Ga0466967_0170345_559_762 | 67 |
| 585 | 3300045976 | Ga0466967_0177322 | Ga0466967_0177322_1780_1983 | 67 |
| 586 | 3300045976 | Ga0466967_0533052 | Ga0466967_0533052_816_1019 | 67 |
| 587 | 3300045976 | Ga0466967_0812872 | Ga0466967_0812872_455_658 | 67 |
| 588 | 3300045976 | Ga0466967_0994020 | Ga0466967_0994020_267_470 | 67 |
| 589 | 3300045976 | Ga0466967_2207433 | Ga0466967_2207433_94_297 | 67 |
| 590 | 3300046454 | Ga0495592_0000057 | Ga0495592_0000057_73829_74032 | 67 |
| 591 | 3300046462 | Ga0495651_0000032 | Ga0495651_0000032_73829_74032 | 67 |
| 592 | 3300046463 | Ga0495653_0002066 | Ga0495653_0002066_1352_1555 | 67 |
| 593 | 3300046463 | Ga0495653_0904477 | Ga0495653_0904477_25_228 | 67 |
| 594 | 3300046471 | Ga0495650_0000054 | Ga0495650_0000054_248121_248324 | 67 |
| 595 | 3300046477 | Ga0495664_0740530 | Ga0495664_0740530_30_233 | 67 |
| 596 | 3300046511 | Ga0495608_0000045 | Ga0495608_0000045_29662_29865 | 67 |
| 597 | 3300046514 | Ga0495618_0918626 | Ga0495618_0918626_159_362 | 67 |
| 598 | 3300046516 | Ga0495628_0000063 | Ga0495628_0000063_28896_29099 | 67 |
| 599 | 3300046518 | Ga0495631_0179580 | Ga0495631_0179580_287_490 | 67 |
| 600 | 3300046518 | Ga0495631_0421932 | Ga0495631_0421932_61_264 | 67 |
| 601 | 3300046525 | Ga0495663_0143722 | Ga0495663_0143722_275_478 | 67 |
| 602 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_105309_105512 | 67 |
| 603 | 3300046529 | Ga0495652_0000078 | Ga0495652_0000078_29057_29260 | 67 |
| 604 | 3300046536 | Ga0495587_0000050 | Ga0495587_0000050_73829_74032 | 67 |
| 605 | 3300046543 | Ga0495645_0070538 | Ga0495645_0070538_2057_2260 | 67 |
| 606 | 3300046543 | Ga0495645_0099480 | Ga0495645_0099480_1695_1898 | 67 |
| 607 | 3300046559 | Ga0495667_0000055 | Ga0495667_0000055_73829_74032 | 67 |
| 608 | 3300046616 | Ga0495668_0687304 | Ga0495668_0687304_203_406 | 67 |
| 609 | 3300046663 | Ga0495635_0936874 | Ga0495635_0936874_144_347 | 67 |
| 610 | 3300046663 | Ga0495635_0979017 | Ga0495635_0979017_282_485 | 67 |
| 611 | 3300046664 | Ga0495659_0518246 | Ga0495659_0518246_52_261 | 67 |
| 612 | 3300046674 | Ga0495588_0334251 | Ga0495588_0334251_318_521 | 67 |
| 613 | 3300046675 | Ga0495657_0000009 | Ga0495657_0000009_29080_29283 | 67 |
| 614 | 3300046678 | Ga0495599_0000033 | Ga0495599_0000033_77171_77374 | 67 |
| 615 | 3300046678 | Ga0495599_0079939 | Ga0495599_0079939_1458_1661 | 67 |
| 616 | 3300046679 | Ga0495623_0000423 | Ga0495623_0000423_7330_7533 | 67 |
| 617 | 3300046680 | Ga0495646_0008673 | Ga0495646_0008673_3497_3700 | 67 |
| 618 | 3300046680 | Ga0495646_0660734 | Ga0495646_0660734_314_517 | 67 |
| 619 | 3300046809 | Ga0495600_0001649 | Ga0495600_0001649_11824_12027 | 67 |
| 620 | 3300047317 | Ga0495604_0000052 | Ga0495604_0000052_73829_74032 | 67 |
| 621 | 3300047320 | Ga0495672_0012173 | Ga0495672_0012173_3233_3439 | 67 |
| 622 | 3300047320 | Ga0495672_0118602 | Ga0495672_0118602_549_752 | 67 |
| 623 | 3300047321 | Ga0495676_1032985 | Ga0495676_1032985_268_471 | 67 |
| 624 | 3300047322 | Ga0495680_0000027 | Ga0495680_0000027_62002_62205 | 67 |
| 625 | 3300047444 | Ga0495675_0000399 | Ga0495675_0000399_18989_19192 | 67 |
| 626 | 3300047471 | Ga0495684_0923875 | Ga0495684_0923875_162_365 | 67 |
| 627 | 3300048088 | Ga0495602_0000236 | Ga0495602_0000236_39185_39388 | 67 |
| 628 | 3300048089 | Ga0495614_0600091 | Ga0495614_0600091_158_361 | 67 |
| 629 | 3300048903 | Ga0496100_0068291 | Ga0496100_0068291_143_346 | 67 |
| 630 | 3300048903 | Ga0496100_0120824 | Ga0496100_0120824_69_272 | 67 |
| 631 | 3300048903 | Ga0496100_0122062 | Ga0496100_0122062_886_1089 | 67 |
| 632 | 3300048903 | Ga0496100_0241510 | Ga0496100_0241510_1035_1253 | 67 |
| 633 | 3300048904 | Ga0496101_0006828 | Ga0496101_0006828_4882_5085 | 67 |
| 634 | 3300048904 | Ga0496101_0016994 | Ga0496101_0016994_3023_3226 | 67 |
| 635 | 3300048904 | Ga0496101_0068115 | Ga0496101_0068115_1268_1471 | 67 |
| 636 | 3300048904 | Ga0496101_0129260 | Ga0496101_0129260_84_302 | 67 |
| 637 | 3300048905 | Ga0496102_0034938 | Ga0496102_0034938_2871_3074 | 67 |
| 638 | 3300048905 | Ga0496102_0424111 | Ga0496102_0424111_444_662 | 67 |
| 639 | 3300048905 | Ga0496102_1463731 | Ga0496102_1463731_316_519 | 67 |
| 640 | 3300048905 | Ga0496102_1477980 | Ga0496102_1477980_218_421 | 67 |
| 641 | 3300048906 | Ga0496103_0250179 | Ga0496103_0250179_775_978 | 67 |
| 642 | 3300048907 | Ga0496104_0047023 | Ga0496104_0047023_2156_2359 | 67 |
| 643 | 3300048907 | Ga0496104_0166197 | Ga0496104_0166197_487_690 | 67 |
| 644 | 3300048908 | Ga0496105_0066026 | Ga0496105_0066026_798_1001 | 67 |
| 645 | 3300048908 | Ga0496105_0520850 | Ga0496105_0520850_558_761 | 67 |
| 646 | 3300048908 | Ga0496105_1029712 | Ga0496105_1029712_122_325 | 67 |
| 647 | 3300048909 | Ga0496106_0004461 | Ga0496106_0004461_9748_9951 | 67 |
| 648 | 3300048909 | Ga0496106_0382104 | Ga0496106_0382104_495_698 | 67 |
| 649 | 3300048909 | Ga0496106_0569430 | Ga0496106_0569430_225_428 | 67 |
| 650 | 3300048909 | Ga0496106_0573584 | Ga0496106_0573584_427_630 | 67 |
| 651 | 3300048909 | Ga0496106_1458149 | Ga0496106_1458149_120_323 | 67 |
| 652 | 3300048910 | Ga0496107_0008235 | Ga0496107_0008235_941_1144 | 67 |
| 653 | 3300048910 | Ga0496107_0141702 | Ga0496107_0141702_757_960 | 67 |
| 654 | 3300048910 | Ga0496107_0176240 | Ga0496107_0176240_965_1168 | 67 |
| 655 | 3300048910 | Ga0496107_0320390 | Ga0496107_0320390_227_430 | 67 |
| 656 | 3300048911 | Ga0496108_0146980 | Ga0496108_0146980_1613_1816 | 67 |
| 657 | 3300048911 | Ga0496108_0790283 | Ga0496108_0790283_377_580 | 67 |
| 658 | 3300048911 | Ga0496108_1527511 | Ga0496108_1527511_263_466 | 67 |
| 659 | 3300048912 | Ga0496109_0237577 | Ga0496109_0237577_411_614 | 67 |
| 660 | 3300048912 | Ga0496109_1068438 | Ga0496109_1068438_523_726 | 67 |
| 661 | 3300048913 | Ga0496110_0214905 | Ga0496110_0214905_443_646 | 67 |
| 662 | 3300048913 | Ga0496110_0325196 | Ga0496110_0325196_982_1185 | 67 |
| 663 | 3300048913 | Ga0496110_0368370 | Ga0496110_0368370_796_999 | 67 |
| 664 | 3300048913 | Ga0496110_0833710 | Ga0496110_0833710_506_709 | 67 |
| 665 | 3300048913 | Ga0496110_1488204 | Ga0496110_1488204_103_306 | 67 |
| 666 | 3300048914 | Ga0496111_0079671 | Ga0496111_0079671_353_556 | 67 |
| 667 | 3300048914 | Ga0496111_0108417 | Ga0496111_0108417_862_1065 | 67 |
| 668 | 3300048914 | Ga0496111_0251187 | Ga0496111_0251187_461_664 | 67 |
| 669 | 3300048914 | Ga0496111_0313845 | Ga0496111_0313845_519_722 | 67 |
| 670 | 3300048915 | Ga0496112_0041797 | Ga0496112_0041797_2361_2564 | 67 |
| 671 | 3300048915 | Ga0496112_0476225 | Ga0496112_0476225_842_1045 | 67 |
| 672 | 3300048915 | Ga0496112_0504950 | Ga0496112_0504950_454_657 | 67 |
| 673 | 3300048915 | Ga0496112_1191869 | Ga0496112_1191869_115_318 | 67 |
| 674 | 3300048916 | Ga0496113_0147470 | Ga0496113_0147470_285_488 | 67 |
| 675 | 3300048917 | Ga0496114_0234038 | Ga0496114_0234038_1258_1461 | 67 |
| 676 | 3300048918 | Ga0496115_0043427 | Ga0496115_0043427_1618_1821 | 67 |
| 677 | 3300048918 | Ga0496115_0163769 | Ga0496115_0163769_660_863 | 67 |
| 678 | 3300048919 | Ga0496116_0001112 | Ga0496116_0001112_10894_11097 | 67 |
| 679 | 3300048921 | Ga0496118_0023973 | Ga0496118_0023973_3698_3901 | 67 |
| 680 | 3300048922 | Ga0496119_0001214 | Ga0496119_0001214_10903_11106 | 67 |
| 681 | 3300048922 | Ga0496119_0014838 | Ga0496119_0014838_3789_3992 | 67 |
| 682 | 3300048922 | Ga0496119_0134046 | Ga0496119_0134046_378_581 | 67 |
| 683 | 3300048924 | Ga0496121_0067583 | Ga0496121_0067583_527_730 | 67 |
| 684 | 3300048924 | Ga0496121_0287381 | Ga0496121_0287381_136_339 | 67 |
| 685 | 3300048927 | Ga0496124_0021502 | Ga0496124_0021502_5510_5713 | 67 |
| 686 | 3300048927 | Ga0496124_0683608 | Ga0496124_0683608_179_382 | 67 |
| 687 | 3300048928 | Ga0496125_0559540 | Ga0496125_0559540_403_606 | 67 |
| 688 | 3300048929 | Ga0496126_0019663 | Ga0496126_0019663_5553_5756 | 67 |
| 689 | 3300048929 | Ga0496126_0032528 | Ga0496126_0032528_4350_4553 | 67 |
| 690 | 3300048929 | Ga0496126_0695093 | Ga0496126_0695093_477_680 | 67 |
| 691 | 3300048929 | Ga0496126_0811277 | Ga0496126_0811277_409_612 | 67 |
| 692 | 3300049533 | Ga0501317_110580 | Ga0501317_110580_202_405 | 67 |
| 693 | 3300049534 | Ga0501318_055940 | Ga0501318_055940_224_427 | 67 |
| 694 | 3300049541 | Ga0501325_048641 | Ga0501325_048641_205_408 | 67 |
| 695 | 3300049568 | Ga0501031_0003150 | Ga0501031_0003150_8616_8819 | 67 |
| 696 | 3300049569 | Ga0501032_0001503 | Ga0501032_0001503_9616_9819 | 67 |
| 697 | 3300049569 | Ga0501032_0556670 | Ga0501032_0556670_373_576 | 67 |
| 698 | 3300049570 | Ga0501033_0004824 | Ga0501033_0004824_1770_1973 | 67 |
| 699 | 3300049571 | Ga0501034_0007306 | Ga0501034_0007306_41_244 | 67 |
| 700 | 3300049571 | Ga0501034_0013330 | Ga0501034_0013330_6494_6697 | 67 |
| 701 | 3300049571 | Ga0501034_0999368 | Ga0501034_0999368_58_261 | 67 |
| 702 | 3300049572 | Ga0501036_0004677 | Ga0501036_0004677_1063_1266 | 67 |
| 703 | 3300049573 | Ga0501037_0003839 | Ga0501037_0003839_8790_8993 | 67 |
| 704 | 3300049574 | Ga0501038_0006610 | Ga0501038_0006610_8762_8965 | 67 |
| 705 | 3300049575 | Ga0501039_0004345 | Ga0501039_0004345_8775_8978 | 67 |
| 706 | 3300049576 | Ga0501040_0005368 | Ga0501040_0005368_6387_6590 | 67 |
| 707 | 3300049578 | Ga0501042_0012040 | Ga0501042_0012040_4646_4849 | 67 |
| 708 | 3300049579 | Ga0501043_0001223 | Ga0501043_0001223_21416_21619 | 67 |
| 709 | 3300049580 | Ga0501046_0006075 | Ga0501046_0006075_1766_1969 | 67 |
| 710 | 3300049581 | Ga0501047_0006595 | Ga0501047_0006595_8783_8986 | 67 |
| 711 | 3300049582 | Ga0501048_0004454 | Ga0501048_0004454_8698_8901 | 67 |
| 712 | 3300049584 | Ga0501068_0035333 | Ga0501068_0035333_1698_1901 | 67 |
| 713 | 3300049584 | Ga0501068_0497168 | Ga0501068_0497168_87_290 | 67 |
| 714 | 3300049585 | Ga0501069_0030901 | Ga0501069_0030901_943_1146 | 67 |
| 715 | 3300049585 | Ga0501069_0176141 | Ga0501069_0176141_768_971 | 67 |
| 716 | 3300049586 | Ga0501070_0000793 | Ga0501070_0000793_6061_6264 | 67 |
| 717 | 3300049586 | Ga0501070_0005358 | Ga0501070_0005358_1770_1973 | 67 |
| 718 | 3300049589 | Ga0501073_0051019 | Ga0501073_0051019_926_1129 | 67 |
| 719 | 3300049590 | Ga0501074_0003906 | Ga0501074_0003906_1643_1846 | 67 |
| 720 | 3300049592 | Ga0501076_0836129 | Ga0501076_0836129_379_582 | 67 |
| 721 | 3300049656 | Ga0501209_191789 | Ga0501209_191789_251_454 | 67 |
| 722 | 3300049741 | Ga0501079_0052396 | Ga0501079_0052396_1056_1259 | 67 |
| 723 | 3300049742 | Ga0501080_0073910 | Ga0501080_0073910_1878_2081 | 67 |
| 724 | 3300049742 | Ga0501080_0469572 | Ga0501080_0469572_90_293 | 67 |
| 725 | 3300049744 | Ga0501083_0044176 | Ga0501083_0044176_1756_1959 | 67 |
| 726 | 3300049822 | Ga0501035_0006695 | Ga0501035_0006695_8796_8999 | 67 |
| 727 | 3300049823 | Ga0501044_0009251 | Ga0501044_0009251_1770_1973 | 67 |
| 728 | 3300049824 | Ga0501045_0125907 | Ga0501045_0125907_979_1182 | 67 |
| 729 | 3300050490 | nmdc:mga03n38_588012_c1 | nmdc:mga03n38_588012_c1_259_462 | 67 |
| 730 | 3300050491 | nmdc:mga00v17_996262_c1 | nmdc:mga00v17_996262_c1_48_251 | 67 |
| 731 | 3300050492 | nmdc:mga0yw44_1098678_c1 | nmdc:mga0yw44_1098678_c1_179_382 | 67 |
| 732 | 3300050492 | nmdc:mga0yw44_882158_c1 | nmdc:mga0yw44_882158_c1_34_237 | 67 |
| 733 | 3300050510 | nmdc:mga06r32_366023_c1 | nmdc:mga06r32_366023_c1_955_1158 | 67 |
| 734 | 3300050511 | nmdc:mga08y16_1090195_c1 | nmdc:mga08y16_1090195_c1_508_711 | 67 |
| 735 | 3300050511 | nmdc:mga08y16_552639_c1 | nmdc:mga08y16_552639_c1_68_271 | 67 |
| 736 | 3300050511 | nmdc:mga08y16_839682_c1 | nmdc:mga08y16_839682_c1_473_676 | 67 |
| 737 | 3300050512 | nmdc:mga0n895_901426_c1 | nmdc:mga0n895_901426_c1_446_649 | 67 |
| 738 | 3300050515 | nmdc:mga0a205_1095873_c1 | nmdc:mga0a205_1095873_c1_246_449 | 67 |
| 739 | 3300050515 | nmdc:mga0a205_861382_c1 | nmdc:mga0a205_861382_c1_249_452 | 67 |
| 740 | 3300053077 | Ga0495601_0321107 | Ga0495601_0321107_45_248 | 67 |
| 741 | 3300053077 | Ga0495601_0520981 | Ga0495601_0520981_248_451 | 67 |
| 742 | 3300053083 | Ga0495655_0054357 | Ga0495655_0054357_418_627 | 67 |
| 743 | 3300053083 | Ga0495655_0086265 | Ga0495655_0086265_459_662 | 67 |
| 744 | 3300053083 | Ga0495655_0122737 | Ga0495655_0122737_92_295 | 67 |
| 745 | 3300053083 | Ga0495655_0166949 | Ga0495655_0166949_433_636 | 67 |
| 746 | 3300053084 | Ga0495595_0000236 | Ga0495595_0000236_19339_19542 | 67 |
| 747 | 3300053085 | Ga0495619_0176001 | Ga0495619_0176001_662_865 | 67 |
| 748 | 3300053119 | Ga0500595_121452 | Ga0500595_121452_390_593 | 67 |
| 749 | 3300053153 | Ga0500616_0005157 | Ga0500616_0005157_4264_4467 | 67 |
| 750 | 3300053160 | Ga0500633_0385797 | Ga0500633_0385797_72_275 | 67 |
| 751 | 3300059491 | Ga0587070_182123 | Ga0587070_182123_263_466 | 67 |
| 752 | 3300059492 | Ga0587073_0285125 | Ga0587073_0285125_91_294 | 67 |
| 753 | 3300059505 | Ga0587083_0262879 | Ga0587083_0262879_152_355 | 67 |
| 754 | 3300059508 | Ga0587088_162535 | Ga0587088_162535_276_479 | 67 |
| 755 | 3300059508 | Ga0587088_167909 | Ga0587088_167909_151_354 | 67 |
| 756 | 3300059509 | Ga0587089_103946 | Ga0587089_103946_284_493 | 67 |
| 757 | 3300059630 | Ga0587128_041580 | Ga0587128_041580_92_295 | 67 |
| 758 | 3300059640 | Ga0587067_202510 | Ga0587067_202510_233_436 | 67 |
| 759 | 3300059647 | Ga0587079_150043 | Ga0587079_150043_268_471 | 67 |
| 760 | 3300059655 | Ga0587114_041631 | Ga0587114_041631_241_444 | 67 |
| 761 | 3300059655 | Ga0587114_133851 | Ga0587114_133851_87_290 | 67 |
| 762 | 3300060346 | Ga0587111_0229322 | Ga0587111_0229322_103_306 | 67 |
| 763 | 3300061719 | Ga0466962_0493019 | Ga0466962_0493019_307_510 | 67 |
| 764 | 3300005329 | Ga0070683_100366571 | Ga0070683_1003665713 | 68 |
| 765 | 3300005329 | Ga0070683_102220985 | Ga0070683_1022209852 | 68 |
| 766 | 3300005338 | Ga0068868_100313688 | Ga0068868_1003136882 | 68 |
| 767 | 3300005439 | Ga0070711_100322223 | Ga0070711_1003222232 | 68 |
| 768 | 3300005440 | Ga0070705_100434784 | Ga0070705_1004347842 | 68 |
| 769 | 3300005459 | Ga0068867_101653153 | Ga0068867_1016531531 | 68 |
| 770 | 3300005535 | Ga0070684_100419587 | Ga0070684_1004195872 | 68 |
| 771 | 3300005844 | Ga0068862_101270586 | Ga0068862_1012705862 | 68 |
| 772 | 3300006175 | Ga0070712_100152915 | Ga0070712_1001529153 | 68 |
| 773 | 3300009098 | Ga0105245_10495140 | Ga0105245_104951402 | 68 |
| 774 | 3300013105 | Ga0157369_12503444 | Ga0157369_125034441 | 68 |
| 775 | 3300013297 | Ga0157378_10452082 | Ga0157378_104520823 | 68 |
| 776 | 3300020082 | Ga0206353_10378576 | Ga0206353_103785762 | 68 |
| 777 | 3300025915 | Ga0207693_10323124 | Ga0207693_103231242 | 68 |
| 778 | 3300025916 | Ga0207663_10305387 | Ga0207663_103053872 | 68 |
| 779 | 3300025921 | Ga0207652_10058819 | Ga0207652_100588192 | 68 |
| 780 | 3300025927 | Ga0207687_11263772 | Ga0207687_112637722 | 68 |
| 781 | 3300025934 | Ga0207686_10489907 | Ga0207686_104899071 | 68 |
| 782 | 3300025944 | Ga0207661_10322800 | Ga0207661_103228003 | 68 |
| 783 | 3300025944 | Ga0207661_11862409 | Ga0207661_118624091 | 68 |
| 784 | 3300026023 | Ga0207677_10301622 | Ga0207677_103016222 | 68 |
| 785 | 3300026089 | Ga0207648_10369901 | Ga0207648_103699013 | 68 |
| 786 | 3300028380 | Ga0268265_10518935 | Ga0268265_105189352 | 68 |
| 787 | 3300031548 | Ga0307408_101303121 | Ga0307408_1013031211 | 68 |
| 788 | 3300041443 | Ga0451789_0651530 | Ga0451789_0651530_524_730 | 68 |
| 789 | 3300046525 | Ga0495663_0174304 | Ga0495663_0174304_408_614 | 68 |
| 790 | 3300046690 | Ga0495624_0927104 | Ga0495624_0927104_141_347 | 68 |
| 791 | 3300047320 | Ga0495672_0224915 | Ga0495672_0224915_588_794 | 68 |
| 792 | 3300000041 | ARcpr5oldR_c028004 | ARcpr5oldR_0280042 | 69 |
| 793 | 3300000652 | ARCol0yngRDRAFT_1005103 | ARCol0yngRDRAFT_10051032 | 69 |
| 794 | 3300006844 | Ga0075428_102103825 | Ga0075428_1021038252 | 69 |
| 795 | 3300006852 | Ga0075433_10267077 | Ga0075433_102670772 | 69 |
| 796 | 3300007076 | Ga0075435_101076346 | Ga0075435_1010763462 | 69 |
| 797 | 3300009094 | Ga0111539_10552617 | Ga0111539_105526174 | 69 |
| 798 | 3300009147 | Ga0114129_10381103 | Ga0114129_103811035 | 69 |
| 799 | 3300012481 | Ga0157320_1007222 | Ga0157320_10072222 | 69 |
| 800 | 3300012483 | Ga0157337_1033561 | Ga0157337_10335612 | 69 |
| 801 | 3300012487 | Ga0157321_1001289 | Ga0157321_10012892 | 69 |
| 802 | 3300012494 | Ga0157341_1014435 | Ga0157341_10144352 | 69 |
| 803 | 3300012500 | Ga0157314_1005879 | Ga0157314_10058792 | 69 |
| 804 | 3300012510 | Ga0157316_1001102 | Ga0157316_10011025 | 69 |
| 805 | 3300027907 | Ga0207428_10727435 | Ga0207428_107274352 | 69 |
| 806 | 3300050507 | nmdc:mga05p37_929068_c1 | nmdc:mga05p37_929068_c1_246_455 | 69 |
| 807 | 3300050511 | nmdc:mga08y16_1636592_c1 | nmdc:mga08y16_1636592_c1_86_295 | 69 |
| 808 | 3300050511 | nmdc:mga08y16_405079_c1 | nmdc:mga08y16_405079_c1_242_451 | 69 |
| 809 | 3300050512 | nmdc:mga0n895_1496674_c1 | nmdc:mga0n895_1496674_c1_20_229 | 69 |
| 810 | 3300050513 | nmdc:mga0rr50_1664719_c1 | nmdc:mga0rr50_1664719_c1_276_485 | 69 |
| 811 | 3300050515 | nmdc:mga0a205_44804_c2 | nmdc:mga0a205_44804_c2_414_623 | 69 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.978 | 2 | 67 |
| 8h1i-assembly1.cif.gz_B | crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c | 0.9701 | 2 | 67 |
| 3i2z-assembly2.cif.gz_B | structure of cold shock protein e from salmonella typhimurium | 0.9679 | 1 | 67 |
| 1hza-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.9669 | 1 | 68 |
| 1c9o-assembly1.cif.gz_B | crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp | 0.9619 | 1 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9691 | 2 | 64 | 2.40.50.140 |
| af_P92186_48_133_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9601 | 2 | 64 | 2.40.50.140 |
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9593 | 2 | 64 | 2.40.50.140 |
| af_Q9VRN5_36_116_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9499 | 2 | 67 | 2.40.50.140 |
| 5o6fA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9304 | 1 | 69 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0C223-F1-model_v4 | Cold shock protein CapB | 1.004 | 2 | 67 |
GO:0003676
GO:0005737 |
| AF-A0A7V9UEA4-F1-model_v4 | DEAD/DEAH box helicase | 1.003 | 1 | 67 |
GO:0003676
GO:0003724 GO:0005524 GO:0005829 GO:0016787 |
| AF-A0A3B8Y5C0-F1-model_v4 | Cold-shock protein | 1.003 | 2 | 67 |
GO:0003676
GO:0005737 |
| AF-A0A7X8IDF8-F1-model_v4 | Cold shock domain-containing protein | 1.002 | 2 | 67 |
GO:0003676
GO:0005737 |
| AF-A0A381X0R8-F1-model_v4 | CSD domain-containing protein | 1.002 | 2 | 67 |
GO:0003676
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar