F481841
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 811 | 421 | 801 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10252125|Ga0105242_102521252 |
| Length | 262 |
| Sequence | VNARPEFWPLPNPIIINPTRREAMSYVEGFVVAVPAANKETFRKHAADAAPMFKEFGATRMVEAWGDDVPDGKLTDFKGAVKAKPDEVVVFSWFEYPDKAARDAANEKMMSDPRMKQMGVNMPFDGQRMIFGGFAPIVEEGAGGKMGYADGYLVPVPAANKDAYRAMAAKAAAVFKEYGATRVVEAWGDDVPDGKVTDFKGAVKATGDEKIVYSWIEWPSKQARDAAWPKIMQDGRMKPDHANMPFDGKRMIYGGFTPIVDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 7 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 8 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 9 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 10 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 14 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 235 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 238 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 239 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 240 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 241 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 242 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 243 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 244 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 329 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 330 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 356 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 357 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 358 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 361 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 364 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 365 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 367 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 369 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 370 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 374 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 375 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 376 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 377 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 382 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 399 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 401 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 402 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 404 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 405 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 409 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 412 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 416 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 418 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 420 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 0.12 |
| Isolates | 1.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.85 |
| Nodule | 0.12 |
| Rhizoplane | 4.44 |
| Rhizosphere | 79.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1936816 | 2162886007 | Bacteria | 923 |
| 2 | SwRhRL2b_contig_2489364 | 2162886007 | Bacteria | 1248 |
| 3 | JGI24736J21556_1000009 | 3300001904 | Bacteria | 35855 |
| 4 | JGI24741J21665_1006527 | 3300001915 | Bacteria | 2338 |
| 5 | JGI24752J21851_1000169 | 3300001976 | Bacteria | 8974 |
| 6 | JGI24746J21847_1013136 | 3300001977 | Bacteria | 1207 |
| 7 | JGI24740J21852_10014316 | 3300001979 | Bacteria | 2929 |
| 8 | JGI24739J22299_10008729 | 3300001989 | Bacteria | 3780 |
| 9 | JGI24737J22298_10003516 | 3300001990 | Bacteria | 5526 |
| 10 | JGI24737J22298_10023018 | 3300001990 | Bacteria | 1977 |
| 11 | JGI24737J22298_10027045 | 3300001990 | Bacteria | 1811 |
| 12 | JGI24737J22298_10055691 | 3300001990 | Bacteria | 1195 |
| 13 | JGI24735J21928_10005493 | 3300002067 | Bacteria | 4205 |
| 14 | JGI24750J21931_1006614 | 3300002070 | Bacteria | 1446 |
| 15 | JGI24748J21848_1000026 | 3300002074 | Bacteria | 101640 |
| 16 | JGI24738J21930_10001213 | 3300002075 | Bacteria | 7231 |
| 17 | JGI24749J21850_1000317 | 3300002076 | Bacteria | 7403 |
| 18 | JGI24034J26672_10000015 | 3300002239 | Bacteria | 137655 |
| 19 | JGI24034J26672_10009293 | 3300002239 | Bacteria | 1448 |
| 20 | JGI24742J22300_10010745 | 3300002244 | Bacteria | 1516 |
| 21 | JGI25151J46595_10000040 | 3300003187 | Bacteria | 176750 |
| 22 | rootH2_10196163 | 3300003320 | Bacteria | 1592 |
| 23 | JGI25404J52841_10000309 | 3300003659 | Bacteria | 6427 |
| 24 | Ga0055526_1001693 | 3300003771 | Bacteria | 15409 |
| 25 | Ga0055524_1000023 | 3300003775 | Bacteria | 221408 |
| 26 | Ga0055530_10000197 | 3300003791 | Bacteria | 54281 |
| 27 | Ga0055531_10000292 | 3300003794 | Bacteria | 50059 |
| 28 | Ga0065165_1003945 | 3300005262 | Bacteria | 9759 |
| 29 | Ga0065704_10077931 | 3300005289 | Bacteria | 4579 |
| 30 | Ga0065704_10101397 | 3300005289 | Bacteria | 2239 |
| 31 | Ga0065704_10153660 | 3300005289 | Bacteria | 1409 |
| 32 | Ga0065707_10081800 | 3300005295 | Bacteria | 39313 |
| 33 | Ga0065707_10082647 | 3300005295 | Bacteria | 13064 |
| 34 | Ga0065707_10090060 | 3300005295 | Bacteria | 4220 |
| 35 | Ga0070658_10003103 | 3300005327 | Bacteria | 13704 |
| 36 | Ga0070658_10019332 | 3300005327 | Bacteria | 5455 |
| 37 | Ga0070658_10122733 | 3300005327 | Bacteria | 2160 |
| 38 | Ga0070658_10350252 | 3300005327 | Bacteria | 1264 |
| 39 | Ga0070676_10016652 | 3300005328 | Bacteria | 4065 |
| 40 | Ga0070676_10036119 | 3300005328 | Bacteria | 2845 |
| 41 | Ga0070676_10082648 | 3300005328 | Bacteria | 1952 |
| 42 | Ga0070676_10246759 | 3300005328 | Bacteria | 1190 |
| 43 | Ga0070683_100834785 | 3300005329 | Bacteria | 884 |
| 44 | Ga0070690_100000025 | 3300005330 | Bacteria | 69409 |
| 45 | Ga0070690_100000857 | 3300005330 | Bacteria | 15440 |
| 46 | Ga0070670_100000014 | 3300005331 | Bacteria | 234648 |
| 47 | Ga0070670_100276851 | 3300005331 | Bacteria | 1465 |
| 48 | Ga0070677_10000102 | 3300005333 | Bacteria | 28071 |
| 49 | Ga0070666_10000015 | 3300005335 | Bacteria | 208372 |
| 50 | Ga0068868_100000162 | 3300005338 | Bacteria | 43570 |
| 51 | Ga0068868_100063449 | 3300005338 | Bacteria | 2930 |
| 52 | Ga0068868_100262021 | 3300005338 | Bacteria | 1458 |
| 53 | Ga0070660_100000258 | 3300005339 | Bacteria | 34973 |
| 54 | Ga0070689_100026195 | 3300005340 | Bacteria | 4389 |
| 55 | Ga0070661_100010594 | 3300005344 | Bacteria | 6413 |
| 56 | Ga0070661_100078990 | 3300005344 | Bacteria | 2427 |
| 57 | Ga0070668_100072852 | 3300005347 | Bacteria | 2677 |
| 58 | Ga0070668_100109463 | 3300005347 | Bacteria | 2198 |
| 59 | Ga0070668_100118867 | 3300005347 | Bacteria | 2110 |
| 60 | Ga0070668_100355482 | 3300005347 | Bacteria | 1241 |
| 61 | Ga0070668_100487648 | 3300005347 | Bacteria | 1065 |
| 62 | Ga0070669_100000059 | 3300005353 | Bacteria | 108504 |
| 63 | Ga0070669_100068580 | 3300005353 | Bacteria | 2618 |
| 64 | Ga0070669_100319693 | 3300005353 | Bacteria | 1253 |
| 65 | Ga0070675_100035554 | 3300005354 | Bacteria | 4049 |
| 66 | Ga0070675_100080959 | 3300005354 | Bacteria | 2707 |
| 67 | Ga0070675_100251712 | 3300005354 | Bacteria | 1546 |
| 68 | Ga0070675_100334862 | 3300005354 | Bacteria | 1339 |
| 69 | Ga0070675_100381273 | 3300005354 | Bacteria | 1255 |
| 70 | Ga0070671_100009469 | 3300005355 | Bacteria | 7820 |
| 71 | Ga0070671_100081004 | 3300005355 | Bacteria | 2714 |
| 72 | Ga0070671_100085184 | 3300005355 | Bacteria | 2644 |
| 73 | Ga0070671_100197249 | 3300005355 | Bacteria | 1707 |
| 74 | Ga0070671_100455515 | 3300005355 | Bacteria | 1098 |
| 75 | Ga0070673_100090420 | 3300005364 | Bacteria | 2501 |
| 76 | Ga0070688_100013459 | 3300005365 | Bacteria | 4613 |
| 77 | Ga0070688_100045193 | 3300005365 | Bacteria | 2720 |
| 78 | Ga0070659_100000022 | 3300005366 | Bacteria | 154091 |
| 79 | Ga0070659_100098281 | 3300005366 | Bacteria | 2354 |
| 80 | Ga0070659_100166761 | 3300005366 | Bacteria | 1802 |
| 81 | Ga0070667_100000144 | 3300005367 | Bacteria | 89681 |
| 82 | Ga0070667_100017737 | 3300005367 | Bacteria | 5900 |
| 83 | Ga0070667_100025515 | 3300005367 | Bacteria | 4913 |
| 84 | Ga0070667_100333577 | 3300005367 | Bacteria | 1371 |
| 85 | Ga0070700_100025029 | 3300005441 | Bacteria | 3511 |
| 86 | Ga0070700_100085949 | 3300005441 | Bacteria | 2041 |
| 87 | Ga0070700_100110172 | 3300005441 | Bacteria | 1829 |
| 88 | Ga0070694_100404932 | 3300005444 | Bacteria | 1069 |
| 89 | Ga0070663_100009775 | 3300005455 | Bacteria | 5956 |
| 90 | Ga0070663_100268519 | 3300005455 | Bacteria | 1355 |
| 91 | Ga0070678_100019428 | 3300005456 | Bacteria | 4429 |
| 92 | Ga0070678_100657701 | 3300005456 | Bacteria | 940 |
| 93 | Ga0070662_100074410 | 3300005457 | Bacteria | 2512 |
| 94 | Ga0070662_100104860 | 3300005457 | Bacteria | 2146 |
| 95 | Ga0070662_100209315 | 3300005457 | Bacteria | 1551 |
| 96 | Ga0070662_100319550 | 3300005457 | Bacteria | 1266 |
| 97 | Ga0070662_100392312 | 3300005457 | Bacteria | 1144 |
| 98 | Ga0068867_100040588 | 3300005459 | Bacteria | 3398 |
| 99 | Ga0068867_100068904 | 3300005459 | Bacteria | 2641 |
| 100 | Ga0070685_10000247 | 3300005466 | Bacteria | 35364 |
| 101 | Ga0070679_100543504 | 3300005530 | Bacteria | 1105 |
| 102 | Ga0070679_100615694 | 3300005530 | Bacteria | 1029 |
| 103 | Ga0070684_100048210 | 3300005535 | Bacteria | 3695 |
| 104 | Ga0068853_100006432 | 3300005539 | Bacteria | 9335 |
| 105 | Ga0068853_100139015 | 3300005539 | Bacteria | 2180 |
| 106 | Ga0068853_100982694 | 3300005539 | Unclassified | 812 |
| 107 | Ga0070672_100038046 | 3300005543 | Bacteria | 3674 |
| 108 | Ga0070672_100059603 | 3300005543 | Bacteria | 3004 |
| 109 | Ga0070672_100304381 | 3300005543 | Bacteria | 1352 |
| 110 | Ga0070672_100466143 | 3300005543 | Bacteria | 1089 |
| 111 | Ga0070686_100000006 | 3300005544 | Bacteria | 243316 |
| 112 | Ga0070686_100000071 | 3300005544 | Bacteria | 76738 |
| 113 | Ga0070686_100100933 | 3300005544 | Bacteria | 1950 |
| 114 | Ga0070665_100000217 | 3300005548 | Bacteria | 97947 |
| 115 | Ga0070665_100003467 | 3300005548 | Bacteria | 16809 |
| 116 | Ga0070665_100032170 | 3300005548 | Bacteria | 5279 |
| 117 | Ga0070665_100056643 | 3300005548 | Bacteria | 3930 |
| 118 | Ga0070665_100060021 | 3300005548 | Bacteria | 3812 |
| 119 | Ga0070665_100819222 | 3300005548 | Bacteria | 944 |
| 120 | Ga0070704_100405218 | 3300005549 | Bacteria | 1165 |
| 121 | Ga0068855_101011226 | 3300005563 | Bacteria | 873 |
| 122 | Ga0070664_100108890 | 3300005564 | Bacteria | 2416 |
| 123 | Ga0070664_100267134 | 3300005564 | Bacteria | 1540 |
| 124 | Ga0068857_100080184 | 3300005577 | Bacteria | 2915 |
| 125 | Ga0068857_100208552 | 3300005577 | Bacteria | 1782 |
| 126 | Ga0068857_100269993 | 3300005577 | Bacteria | 1563 |
| 127 | Ga0068857_100759170 | 3300005577 | Bacteria | 924 |
| 128 | Ga0068856_100169667 | 3300005614 | Bacteria | 2194 |
| 129 | Ga0068856_100279622 | 3300005614 | Bacteria | 1686 |
| 130 | Ga0068852_100026293 | 3300005616 | Bacteria | 4729 |
| 131 | Ga0068859_100000937 | 3300005617 | Bacteria | 29957 |
| 132 | Ga0068859_100031726 | 3300005617 | Bacteria | 5306 |
| 133 | Ga0068859_100053773 | 3300005617 | Bacteria | 4050 |
| 134 | Ga0068859_100286615 | 3300005617 | Bacteria | 1740 |
| 135 | Ga0068859_100532863 | 3300005617 | Bacteria | 1269 |
| 136 | Ga0068859_100575925 | 3300005617 | Bacteria | 1219 |
| 137 | Ga0068864_100000021 | 3300005618 | Bacteria | 262378 |
| 138 | Ga0068864_100009352 | 3300005618 | Bacteria | 8085 |
| 139 | Ga0068864_100017721 | 3300005618 | Bacteria | 5941 |
| 140 | Ga0068866_10266255 | 3300005718 | Bacteria | 1055 |
| 141 | Ga0068861_100006465 | 3300005719 | Bacteria | 7984 |
| 142 | Ga0068861_100164541 | 3300005719 | Bacteria | 1833 |
| 143 | Ga0068851_10072312 | 3300005834 | Bacteria | 1786 |
| 144 | Ga0068863_100000009 | 3300005841 | Bacteria | 250538 |
| 145 | Ga0068863_100000108 | 3300005841 | Bacteria | 87921 |
| 146 | Ga0068863_100001030 | 3300005841 | Bacteria | 27842 |
| 147 | Ga0068863_100029844 | 3300005841 | Bacteria | 5208 |
| 148 | Ga0068863_100045028 | 3300005841 | Bacteria | 4187 |
| 149 | Ga0068863_100460005 | 3300005841 | Bacteria | 1249 |
| 150 | Ga0068858_100000318 | 3300005842 | Bacteria | 51170 |
| 151 | Ga0068858_100002534 | 3300005842 | Bacteria | 18415 |
| 152 | Ga0068858_100023685 | 3300005842 | Bacteria | 5719 |
| 153 | Ga0068858_100061649 | 3300005842 | Bacteria | 3467 |
| 154 | Ga0068858_100103238 | 3300005842 | Bacteria | 2659 |
| 155 | Ga0068860_100000050 | 3300005843 | Bacteria | 208372 |
| 156 | Ga0068860_100000554 | 3300005843 | Bacteria | 45461 |
| 157 | Ga0068860_100005428 | 3300005843 | Bacteria | 12929 |
| 158 | Ga0068860_100031734 | 3300005843 | Bacteria | 5079 |
| 159 | Ga0068860_100053433 | 3300005843 | Bacteria | 3841 |
| 160 | Ga0068862_100000017 | 3300005844 | Bacteria | 247616 |
| 161 | Ga0068862_100000059 | 3300005844 | Bacteria | 136840 |
| 162 | Ga0068862_100000062 | 3300005844 | Bacteria | 126792 |
| 163 | Ga0068862_100019112 | 3300005844 | Bacteria | 5713 |
| 164 | Ga0068862_100274922 | 3300005844 | Bacteria | 1542 |
| 165 | Ga0081455_10000097 | 3300005937 | Bacteria | 96027 |
| 166 | Ga0081455_10315218 | 3300005937 | Bacteria | 1116 |
| 167 | Ga0081540_1000022 | 3300005983 | Bacteria | 161205 |
| 168 | Ga0075365_10269779 | 3300006038 | Bacteria | 1197 |
| 169 | Ga0075368_10000156 | 3300006042 | Bacteria | 18343 |
| 170 | Ga0075368_10149628 | 3300006042 | Bacteria | 975 |
| 171 | Ga0075364_10007044 | 3300006051 | Bacteria | 6646 |
| 172 | Ga0075364_10149717 | 3300006051 | Bacteria | 1572 |
| 173 | Ga0075364_10167736 | 3300006051 | Bacteria | 1483 |
| 174 | Ga0075364_10191021 | 3300006051 | Bacteria | 1387 |
| 175 | Ga0075364_10238658 | 3300006051 | Bacteria | 1234 |
| 176 | Ga0075364_10314550 | 3300006051 | Bacteria | 1066 |
| 177 | Ga0075362_10004105 | 3300006177 | Bacteria | 5192 |
| 178 | Ga0075362_10029630 | 3300006177 | Bacteria | 2360 |
| 179 | Ga0075362_10030432 | 3300006177 | Bacteria | 2331 |
| 180 | Ga0075362_10155918 | 3300006177 | Bacteria | 1097 |
| 181 | Ga0075367_10015975 | 3300006178 | Bacteria | 4093 |
| 182 | Ga0075367_10115586 | 3300006178 | Bacteria | 1650 |
| 183 | Ga0075367_10216224 | 3300006178 | Bacteria | 1199 |
| 184 | Ga0075369_10002148 | 3300006186 | Bacteria | 6961 |
| 185 | Ga0075366_10001024 | 3300006195 | Bacteria | 13705 |
| 186 | Ga0075366_10003581 | 3300006195 | Bacteria | 8221 |
| 187 | Ga0075366_10030386 | 3300006195 | Bacteria | 3176 |
| 188 | Ga0075366_10152908 | 3300006195 | Bacteria | 1398 |
| 189 | Ga0097621_100002041 | 3300006237 | Bacteria | 13816 |
| 190 | Ga0097621_100338866 | 3300006237 | Bacteria | 1335 |
| 191 | Ga0075370_10002971 | 3300006353 | Bacteria | 7967 |
| 192 | Ga0075370_10115248 | 3300006353 | Bacteria | 1562 |
| 193 | Ga0068871_100002322 | 3300006358 | Bacteria | 12954 |
| 194 | Ga0075428_100091137 | 3300006844 | Bacteria | 3325 |
| 195 | Ga0075428_100206495 | 3300006844 | Bacteria | 2123 |
| 196 | Ga0075430_100007463 | 3300006846 | Bacteria | 9229 |
| 197 | Ga0075431_100042139 | 3300006847 | Bacteria | 4708 |
| 198 | Ga0075433_10000419 | 3300006852 | Bacteria | 27125 |
| 199 | Ga0075434_100030445 | 3300006871 | Bacteria | 5314 |
| 200 | Ga0075434_100120245 | 3300006871 | Bacteria | 2641 |
| 201 | Ga0068865_100093229 | 3300006881 | Bacteria | 2189 |
| 202 | Ga0068865_100128545 | 3300006881 | Bacteria | 1895 |
| 203 | Ga0068865_100138221 | 3300006881 | Bacteria | 1834 |
| 204 | Ga0097620_100000937 | 3300006931 | Bacteria | 29957 |
| 205 | Ga0097620_100031725 | 3300006931 | Bacteria | 5306 |
| 206 | Ga0097620_100053773 | 3300006931 | Bacteria | 4050 |
| 207 | Ga0097620_100286581 | 3300006931 | Bacteria | 1740 |
| 208 | Ga0097620_100532981 | 3300006931 | Bacteria | 1269 |
| 209 | Ga0097620_100575915 | 3300006931 | Bacteria | 1219 |
| 210 | Ga0097620_100718397 | 3300006931 | Bacteria | 1089 |
| 211 | Ga0079104_1032956 | 3300006946 | Bacteria | 1272 |
| 212 | Ga0075435_100026131 | 3300007076 | Bacteria | 4552 |
| 213 | Ga0105251_10000079 | 3300009011 | Bacteria | 92478 |
| 214 | Ga0111539_10004649 | 3300009094 | Bacteria | 17936 |
| 215 | Ga0111539_10094756 | 3300009094 | Bacteria | 3507 |
| 216 | Ga0111539_10158167 | 3300009094 | Bacteria | 2651 |
| 217 | Ga0111539_10771889 | 3300009094 | Bacteria | 1119 |
| 218 | Ga0105245_10001471 | 3300009098 | Bacteria | 21285 |
| 219 | Ga0105245_10019787 | 3300009098 | Bacteria | 5900 |
| 220 | Ga0105245_10423399 | 3300009098 | Bacteria | 1335 |
| 221 | Ga0105247_10002556 | 3300009101 | Bacteria | 12342 |
| 222 | Ga0105247_10004620 | 3300009101 | Bacteria | 8777 |
| 223 | Ga0105247_10035281 | 3300009101 | Bacteria | 3048 |
| 224 | Ga0105247_10120649 | 3300009101 | Bacteria | 1698 |
| 225 | Ga0114129_10271306 | 3300009147 | Bacteria | 2269 |
| 226 | Ga0105243_10259015 | 3300009148 | Bacteria | 1557 |
| 227 | Ga0105243_10410560 | 3300009148 | Bacteria | 1260 |
| 228 | Ga0105243_10826364 | 3300009148 | Bacteria | 915 |
| 229 | Ga0105242_10252125 | 3300009176 | Bacteria | 1591 |
| 230 | Ga0105248_10000030 | 3300009177 | Bacteria | 206609 |
| 231 | Ga0105248_10021965 | 3300009177 | Bacteria | 7072 |
| 232 | Ga0105248_10141927 | 3300009177 | Bacteria | 2710 |
| 233 | Ga0105248_11009374 | 3300009177 | Bacteria | 940 |
| 234 | Ga0105237_10612819 | 3300009545 | Bacteria | 1095 |
| 235 | Ga0105238_10082901 | 3300009551 | Bacteria | 3196 |
| 236 | Ga0105238_10149933 | 3300009551 | Bacteria | 2307 |
| 237 | Ga0105238_10180155 | 3300009551 | Bacteria | 2090 |
| 238 | Ga0105249_10000034 | 3300009553 | Bacteria | 208378 |
| 239 | Ga0105249_10000065 | 3300009553 | Bacteria | 151159 |
| 240 | Ga0105249_10000625 | 3300009553 | Bacteria | 32214 |
| 241 | Ga0105249_10219888 | 3300009553 | Bacteria | 1868 |
| 242 | Ga0105239_10002028 | 3300010375 | Bacteria | 26278 |
| 243 | Ga0105239_10494856 | 3300010375 | Bacteria | 1390 |
| 244 | Ga0105239_10597738 | 3300010375 | Bacteria | 1258 |
| 245 | Ga0105239_10606825 | 3300010375 | Bacteria | 1248 |
| 246 | Ga0105246_10389494 | 3300011119 | Bacteria | 1154 |
| 247 | Ga0157373_10026314 | 3300013100 | Bacteria | 4203 |
| 248 | Ga0157371_10109285 | 3300013102 | Bacteria | 1963 |
| 249 | Ga0157370_10075929 | 3300013104 | Bacteria | 3166 |
| 250 | Ga0157370_10330166 | 3300013104 | Bacteria | 1406 |
| 251 | Ga0157369_10085137 | 3300013105 | Bacteria | 3378 |
| 252 | Ga0171462_1045 | 3300013250 | Bacteria | 50984 |
| 253 | Ga0157374_10023048 | 3300013296 | Bacteria | 5563 |
| 254 | Ga0157374_10168565 | 3300013296 | Unclassified | 2135 |
| 255 | Ga0157374_11221556 | 3300013296 | Bacteria | 773 |
| 256 | Ga0157378_10277596 | 3300013297 | Bacteria | 1614 |
| 257 | Ga0163162_10046132 | 3300013306 | Bacteria | 4368 |
| 258 | Ga0163162_10091956 | 3300013306 | Bacteria | 3117 |
| 259 | Ga0163162_10106873 | 3300013306 | Bacteria | 2894 |
| 260 | Ga0163162_10109407 | 3300013306 | Bacteria | 2860 |
| 261 | Ga0163162_10560517 | 3300013306 | Bacteria | 1270 |
| 262 | Ga0157372_10305352 | 3300013307 | Bacteria | 1851 |
| 263 | Ga0157375_10039099 | 3300013308 | Bacteria | 4562 |
| 264 | Ga0163163_10024253 | 3300014325 | Bacteria | 5771 |
| 265 | Ga0163163_10041149 | 3300014325 | Bacteria | 4518 |
| 266 | Ga0157380_10000231 | 3300014326 | Bacteria | 33437 |
| 267 | Ga0157380_10000478 | 3300014326 | Bacteria | 24450 |
| 268 | Ga0157380_10011127 | 3300014326 | Bacteria | 6491 |
| 269 | Ga0157380_10022349 | 3300014326 | Bacteria | 4759 |
| 270 | Ga0157380_10053544 | 3300014326 | Bacteria | 3200 |
| 271 | Ga0157380_10077239 | 3300014326 | Bacteria | 2713 |
| 272 | Ga0157380_10281387 | 3300014326 | Bacteria | 1522 |
| 273 | Ga0157380_10288088 | 3300014326 | Bacteria | 1506 |
| 274 | Ga0157377_10035540 | 3300014745 | Bacteria | 2734 |
| 275 | Ga0157377_10151118 | 3300014745 | Bacteria | 1436 |
| 276 | Ga0157379_10005954 | 3300014968 | Bacteria | 10505 |
| 277 | Ga0157379_10098918 | 3300014968 | Bacteria | 2619 |
| 278 | Ga0157379_10145306 | 3300014968 | Bacteria | 2139 |
| 279 | Ga0157376_10361570 | 3300014969 | Bacteria | 1392 |
| 280 | Ga0163161_10000051 | 3300017792 | Bacteria | 122360 |
| 281 | Ga0163161_10387846 | 3300017792 | Bacteria | 1118 |
| 282 | Ga0163161_10566226 | 3300017792 | Bacteria | 933 |
| 283 | Ga0197907_10309105 | 3300020069 | Bacteria | 2120 |
| 284 | Ga0213876_10016920 | 3300021384 | Bacteria | 3853 |
| 285 | Ga0207672_1000434 | 3300025223 | Bacteria | 5298 |
| 286 | Ga0209675_1000162 | 3300025291 | Bacteria | 83810 |
| 287 | Ga0209676_1000113 | 3300025292 | Bacteria | 207931 |
| 288 | Ga0209676_1000146 | 3300025292 | Bacteria | 174095 |
| 289 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 290 | Ga0209025_1075336 | 3300025294 | Bacteria | 1174 |
| 291 | Ga0209564_1000076 | 3300025295 | Bacteria | 283602 |
| 292 | Ga0209050_1000126 | 3300025298 | Bacteria | 188438 |
| 293 | Ga0209256_1000083 | 3300025299 | Bacteria | 221460 |
| 294 | Ga0209256_1002896 | 3300025299 | Bacteria | 13002 |
| 295 | Ga0207426_1038778 | 3300025302 | Bacteria | 1498 |
| 296 | Ga0209257_1000256 | 3300025304 | Bacteria | 123057 |
| 297 | Ga0209257_1002163 | 3300025304 | Bacteria | 20403 |
| 298 | Ga0209257_1002727 | 3300025304 | Bacteria | 16784 |
| 299 | Ga0209257_1030993 | 3300025304 | Bacteria | 1717 |
| 300 | Ga0207697_10125308 | 3300025315 | Bacteria | 1107 |
| 301 | Ga0207656_10028118 | 3300025321 | Bacteria | 2305 |
| 302 | Ga0207713_1001353 | 3300025735 | Bacteria | 19979 |
| 303 | Ga0207682_10000779 | 3300025893 | Bacteria | 14728 |
| 304 | Ga0207642_10040935 | 3300025899 | Bacteria | 2025 |
| 305 | Ga0207710_10002558 | 3300025900 | Bacteria | 8406 |
| 306 | Ga0207710_10002920 | 3300025900 | Bacteria | 7769 |
| 307 | Ga0207710_10005791 | 3300025900 | Bacteria | 5303 |
| 308 | Ga0207710_10053912 | 3300025900 | Bacteria | 1810 |
| 309 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 310 | Ga0207647_10001146 | 3300025904 | Bacteria | 20388 |
| 311 | Ga0207647_10024093 | 3300025904 | Bacteria | 4015 |
| 312 | Ga0207645_10038121 | 3300025907 | Bacteria | 3083 |
| 313 | Ga0207645_10088731 | 3300025907 | Bacteria | 1988 |
| 314 | Ga0207645_10207518 | 3300025907 | Bacteria | 1290 |
| 315 | Ga0207643_10003813 | 3300025908 | Bacteria | 8107 |
| 316 | Ga0207705_10020786 | 3300025909 | Bacteria | 4684 |
| 317 | Ga0207705_10022866 | 3300025909 | Bacteria | 4457 |
| 318 | Ga0207654_10001455 | 3300025911 | Bacteria | 12563 |
| 319 | Ga0207695_10004741 | 3300025913 | Bacteria | 18408 |
| 320 | Ga0207695_10042299 | 3300025913 | Bacteria | 4868 |
| 321 | Ga0207671_10000658 | 3300025914 | Bacteria | 45037 |
| 322 | Ga0207663_10388710 | 3300025916 | Bacteria | 1064 |
| 323 | Ga0207657_10003941 | 3300025919 | Bacteria | 15762 |
| 324 | Ga0207657_10222114 | 3300025919 | Bacteria | 1513 |
| 325 | Ga0207657_10386687 | 3300025919 | Bacteria | 1101 |
| 326 | Ga0207649_10077647 | 3300025920 | Bacteria | 2140 |
| 327 | Ga0207652_10633583 | 3300025921 | Bacteria | 957 |
| 328 | Ga0207681_10000089 | 3300025923 | Bacteria | 79526 |
| 329 | Ga0207681_10351833 | 3300025923 | Bacteria | 1179 |
| 330 | Ga0207694_10008129 | 3300025924 | Bacteria | 7926 |
| 331 | Ga0207694_10042769 | 3300025924 | Bacteria | 3496 |
| 332 | Ga0207694_10136643 | 3300025924 | Bacteria | 1969 |
| 333 | Ga0207650_10000095 | 3300025925 | Bacteria | 116052 |
| 334 | Ga0207650_10101038 | 3300025925 | Bacteria | 2220 |
| 335 | Ga0207650_10126101 | 3300025925 | Bacteria | 1998 |
| 336 | Ga0207659_10074785 | 3300025926 | Bacteria | 2484 |
| 337 | Ga0207659_10186061 | 3300025926 | Bacteria | 1649 |
| 338 | Ga0207687_10001257 | 3300025927 | Bacteria | 17337 |
| 339 | Ga0207687_10307529 | 3300025927 | Bacteria | 1279 |
| 340 | Ga0207644_10004047 | 3300025931 | Bacteria | 9509 |
| 341 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 342 | Ga0207690_10136197 | 3300025932 | Bacteria | 1803 |
| 343 | Ga0207690_10250315 | 3300025932 | Bacteria | 1368 |
| 344 | Ga0207706_10012563 | 3300025933 | Bacteria | 7709 |
| 345 | Ga0207706_10074552 | 3300025933 | Bacteria | 2984 |
| 346 | Ga0207706_10176351 | 3300025933 | Bacteria | 1877 |
| 347 | Ga0207706_10435785 | 3300025933 | Bacteria | 1135 |
| 348 | Ga0207686_10412145 | 3300025934 | Bacteria | 1032 |
| 349 | Ga0207686_10582591 | 3300025934 | Bacteria | 878 |
| 350 | Ga0207670_10022662 | 3300025936 | Bacteria | 3896 |
| 351 | Ga0207669_10014205 | 3300025937 | Bacteria | 3985 |
| 352 | Ga0207704_10130501 | 3300025938 | Bacteria | 1739 |
| 353 | Ga0207704_10705897 | 3300025938 | Bacteria | 835 |
| 354 | Ga0207691_10002479 | 3300025940 | Bacteria | 18051 |
| 355 | Ga0207691_10030460 | 3300025940 | Bacteria | 5042 |
| 356 | Ga0207691_10240259 | 3300025940 | Bacteria | 1566 |
| 357 | Ga0207691_10270901 | 3300025940 | Bacteria | 1462 |
| 358 | Ga0207691_10328122 | 3300025940 | Bacteria | 1311 |
| 359 | Ga0207691_10627663 | 3300025940 | Bacteria | 909 |
| 360 | Ga0207711_10000029 | 3300025941 | Bacteria | 206826 |
| 361 | Ga0207711_10002957 | 3300025941 | Bacteria | 14862 |
| 362 | Ga0207711_10021097 | 3300025941 | Bacteria | 5441 |
| 363 | Ga0207711_10204548 | 3300025941 | Bacteria | 1802 |
| 364 | Ga0207689_10031380 | 3300025942 | Bacteria | 4424 |
| 365 | Ga0207661_10120168 | 3300025944 | Bacteria | 2236 |
| 366 | Ga0207661_10305856 | 3300025944 | Bacteria | 1426 |
| 367 | Ga0207679_10081988 | 3300025945 | Bacteria | 2468 |
| 368 | Ga0207679_10241829 | 3300025945 | Bacteria | 1530 |
| 369 | Ga0207667_10046245 | 3300025949 | Bacteria | 4608 |
| 370 | Ga0207667_10696873 | 3300025949 | Bacteria | 1018 |
| 371 | Ga0207651_10075202 | 3300025960 | Bacteria | 2409 |
| 372 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 373 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 374 | Ga0207712_10000268 | 3300025961 | Bacteria | 50603 |
| 375 | Ga0207712_10084392 | 3300025961 | Bacteria | 2321 |
| 376 | Ga0207712_10564608 | 3300025961 | Bacteria | 980 |
| 377 | Ga0207668_10030478 | 3300025972 | Bacteria | 3545 |
| 378 | Ga0207668_10196665 | 3300025972 | Bacteria | 1602 |
| 379 | Ga0207668_10292463 | 3300025972 | Bacteria | 1341 |
| 380 | Ga0207668_10298540 | 3300025972 | Bacteria | 1328 |
| 381 | Ga0207668_10425408 | 3300025972 | Bacteria | 1128 |
| 382 | Ga0207640_10203787 | 3300025981 | Bacteria | 1501 |
| 383 | Ga0207640_10229261 | 3300025981 | Bacteria | 1428 |
| 384 | Ga0207640_10682372 | 3300025981 | Bacteria | 879 |
| 385 | Ga0207658_10002005 | 3300025986 | Bacteria | 15177 |
| 386 | Ga0207658_10005485 | 3300025986 | Bacteria | 8698 |
| 387 | Ga0207658_10557606 | 3300025986 | Bacteria | 1026 |
| 388 | Ga0207677_10000154 | 3300026023 | Bacteria | 54637 |
| 389 | Ga0207677_10489542 | 3300026023 | Bacteria | 1061 |
| 390 | Ga0207703_10001286 | 3300026035 | Bacteria | 23270 |
| 391 | Ga0207703_10004368 | 3300026035 | Bacteria | 11617 |
| 392 | Ga0207703_10006943 | 3300026035 | Bacteria | 9011 |
| 393 | Ga0207703_10258552 | 3300026035 | Bacteria | 1573 |
| 394 | Ga0207703_10381902 | 3300026035 | Bacteria | 1303 |
| 395 | Ga0207639_10003651 | 3300026041 | Bacteria | 10345 |
| 396 | Ga0207639_10227605 | 3300026041 | Bacteria | 1614 |
| 397 | Ga0207639_10332244 | 3300026041 | Bacteria | 1353 |
| 398 | Ga0207678_10023624 | 3300026067 | Bacteria | 5375 |
| 399 | Ga0207678_10080714 | 3300026067 | Bacteria | 2784 |
| 400 | Ga0207678_10169135 | 3300026067 | Bacteria | 1866 |
| 401 | Ga0207708_10009902 | 3300026075 | Bacteria | 7077 |
| 402 | Ga0207708_10060007 | 3300026075 | Bacteria | 2904 |
| 403 | Ga0207702_10001915 | 3300026078 | Bacteria | 20339 |
| 404 | Ga0207641_10000017 | 3300026088 | Bacteria | 299119 |
| 405 | Ga0207641_10000209 | 3300026088 | Bacteria | 75878 |
| 406 | Ga0207641_10000428 | 3300026088 | Bacteria | 48639 |
| 407 | Ga0207641_10027160 | 3300026088 | Bacteria | 4726 |
| 408 | Ga0207641_10031322 | 3300026088 | Bacteria | 4411 |
| 409 | Ga0207641_10038679 | 3300026088 | Bacteria | 3988 |
| 410 | Ga0207641_10050427 | 3300026088 | Bacteria | 3521 |
| 411 | Ga0207641_10521385 | 3300026088 | Bacteria | 1156 |
| 412 | Ga0207648_10029171 | 3300026089 | Bacteria | 4893 |
| 413 | Ga0207648_10074433 | 3300026089 | Bacteria | 2960 |
| 414 | Ga0207676_10000037 | 3300026095 | Bacteria | 180826 |
| 415 | Ga0207676_10001679 | 3300026095 | Bacteria | 16324 |
| 416 | Ga0207676_10079562 | 3300026095 | Bacteria | 2658 |
| 417 | Ga0207674_10007684 | 3300026116 | Bacteria | 12551 |
| 418 | Ga0207674_10032587 | 3300026116 | Bacteria | 5464 |
| 419 | Ga0207675_100000449 | 3300026118 | Bacteria | 39979 |
| 420 | Ga0207675_100016886 | 3300026118 | Bacteria | 6820 |
| 421 | Ga0207675_100109265 | 3300026118 | Bacteria | 2609 |
| 422 | Ga0207675_100301892 | 3300026118 | Bacteria | 1560 |
| 423 | Ga0207683_10036842 | 3300026121 | Bacteria | 4259 |
| 424 | Ga0207698_10019699 | 3300026142 | Bacteria | 4625 |
| 425 | Ga0207698_10283261 | 3300026142 | Bacteria | 1534 |
| 426 | Ga0209967_1024052 | 3300027364 | Bacteria | 898 |
| 427 | Ga0209813_10045803 | 3300027866 | Bacteria | 1348 |
| 428 | Ga0207428_10030363 | 3300027907 | Bacteria | 4468 |
| 429 | Ga0268266_10000225 | 3300028379 | Bacteria | 98082 |
| 430 | Ga0268266_10002973 | 3300028379 | Bacteria | 17474 |
| 431 | Ga0268266_10009750 | 3300028379 | Bacteria | 8447 |
| 432 | Ga0268266_10138729 | 3300028379 | Bacteria | 2180 |
| 433 | Ga0268266_10282084 | 3300028379 | Bacteria | 1545 |
| 434 | Ga0268265_10000025 | 3300028380 | Bacteria | 250207 |
| 435 | Ga0268265_10000086 | 3300028380 | Bacteria | 119049 |
| 436 | Ga0268265_10000141 | 3300028380 | Bacteria | 91426 |
| 437 | Ga0268265_10033676 | 3300028380 | Unclassified | 3727 |
| 438 | Ga0268265_10936629 | 3300028380 | Bacteria | 852 |
| 439 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 440 | Ga0268264_10000044 | 3300028381 | Bacteria | 368079 |
| 441 | Ga0268264_10000788 | 3300028381 | Bacteria | 34588 |
| 442 | Ga0268264_10026990 | 3300028381 | Bacteria | 4691 |
| 443 | Ga0268264_11190785 | 3300028381 | Bacteria | 771 |
| 444 | Ga0307511_10013450 | 3300030521 | Bacteria | 7993 |
| 445 | Ga0307513_10034806 | 3300031456 | Bacteria | 5644 |
| 446 | Ga0307509_10000016 | 3300031507 | Bacteria | 266991 |
| 447 | Ga0307408_100024971 | 3300031548 | Bacteria | 4088 |
| 448 | Ga0307408_100157720 | 3300031548 | Bacteria | 1799 |
| 449 | Ga0307408_100207280 | 3300031548 | Bacteria | 1591 |
| 450 | Ga0307408_100668982 | 3300031548 | Bacteria | 930 |
| 451 | Ga0307508_10202239 | 3300031616 | Bacteria | 1587 |
| 452 | Ga0307405_10003561 | 3300031731 | Bacteria | 7185 |
| 453 | Ga0307405_10004054 | 3300031731 | Bacteria | 6878 |
| 454 | Ga0307405_10079796 | 3300031731 | Bacteria | 2134 |
| 455 | Ga0307405_10417888 | 3300031731 | Bacteria | 1054 |
| 456 | Ga0307413_10028415 | 3300031824 | Bacteria | 3114 |
| 457 | Ga0307413_10202997 | 3300031824 | Bacteria | 1433 |
| 458 | Ga0307413_10555109 | 3300031824 | Bacteria | 932 |
| 459 | Ga0307410_10066439 | 3300031852 | Bacteria | 2484 |
| 460 | Ga0307410_10144649 | 3300031852 | Bacteria | 1763 |
| 461 | Ga0307406_10031941 | 3300031901 | Bacteria | 3210 |
| 462 | Ga0307406_10062785 | 3300031901 | Bacteria | 2404 |
| 463 | Ga0307406_10205315 | 3300031901 | Bacteria | 1454 |
| 464 | Ga0307412_10046548 | 3300031911 | Bacteria | 2842 |
| 465 | Ga0307412_10189750 | 3300031911 | Bacteria | 1553 |
| 466 | Ga0307409_100080639 | 3300031995 | Bacteria | 2627 |
| 467 | Ga0307409_100097477 | 3300031995 | Bacteria | 2429 |
| 468 | Ga0307409_100332116 | 3300031995 | Bacteria | 1427 |
| 469 | Ga0307409_101227144 | 3300031995 | Bacteria | 774 |
| 470 | Ga0307416_100000441 | 3300032002 | Bacteria | 21217 |
| 471 | Ga0307416_100731774 | 3300032002 | Bacteria | 1081 |
| 472 | Ga0307414_10000607 | 3300032004 | Bacteria | 18398 |
| 473 | Ga0307414_10030871 | 3300032004 | Bacteria | 3506 |
| 474 | Ga0307414_10045555 | 3300032004 | Bacteria | 3005 |
| 475 | Ga0307414_10208914 | 3300032004 | Bacteria | 1594 |
| 476 | Ga0307414_10248475 | 3300032004 | Bacteria | 1477 |
| 477 | Ga0307414_10447535 | 3300032004 | Bacteria | 1132 |
| 478 | Ga0307414_10580403 | 3300032004 | Bacteria | 1003 |
| 479 | Ga0307411_10001164 | 3300032005 | Bacteria | 10335 |
| 480 | Ga0307411_10074810 | 3300032005 | Bacteria | 2310 |
| 481 | Ga0307411_10120380 | 3300032005 | Bacteria | 1898 |
| 482 | Ga0307411_10313672 | 3300032005 | Bacteria | 1263 |
| 483 | Ga0307415_100031322 | 3300032126 | Bacteria | 3425 |
| 484 | Ga0307415_100213342 | 3300032126 | Bacteria | 1542 |
| 485 | Ga0373953_0012233 | 3300035117 | Bacteria | 3035 |
| 486 | Ga0373954_0032919 | 3300035118 | Bacteria | 2398 |
| 487 | Ga0373946_0005530 | 3300035171 | Bacteria | 4559 |
| 488 | Ga0373955_0340095 | 3300035172 | Bacteria | 908 |
| 489 | Ga0373962_0033882 | 3300035242 | Bacteria | 1412 |
| 490 | Ga0373924_0005515 | 3300035410 | Bacteria | 4487 |
| 491 | Ga0373935_0373196 | 3300035692 | Bacteria | 1020 |
| 492 | Ga0373933_0053543 | 3300035724 | Bacteria | 2417 |
| 493 | Ga0373947_0082426 | 3300035725 | Bacteria | 1993 |
| 494 | Ga0373937_0261786 | 3300036401 | Bacteria | 1631 |
| 495 | Ga0373937_0294166 | 3300036401 | Bacteria | 1534 |
| 496 | Ga0373925_0077146 | 3300037068 | Bacteria | 2528 |
| 497 | Ga0395899_0032112 | 3300037312 | Bacteria | 3944 |
| 498 | Ga0395899_0122289 | 3300037312 | Bacteria | 1863 |
| 499 | Ga0395899_0243748 | 3300037312 | Bacteria | 1236 |
| 500 | Ga0395900_0056710 | 3300037418 | Bacteria | 4032 |
| 501 | Ga0395900_0167869 | 3300037418 | Bacteria | 2235 |
| 502 | Ga0395900_0192160 | 3300037418 | Bacteria | 2070 |
| 503 | Ga0395898_0220985 | 3300037466 | Bacteria | 1807 |
| 504 | Ga0395905_0034610 | 3300037471 | Bacteria | 4744 |
| 505 | Ga0395905_0100066 | 3300037471 | Bacteria | 2722 |
| 506 | Ga0395905_0562865 | 3300037471 | Bacteria | 1041 |
| 507 | Ga0395901_0010662 | 3300038443 | Bacteria | 9315 |
| 508 | Ga0395901_0046767 | 3300038443 | Bacteria | 4495 |
| 509 | Ga0395901_0076679 | 3300038443 | Bacteria | 3488 |
| 510 | Ga0395901_0120911 | 3300038443 | Bacteria | 2752 |
| 511 | Ga0237819_01311 | 3300038705 | Bacteria | 6665 |
| 512 | Ga0237816_01700 | 3300039145 | Bacteria | 1757 |
| 513 | Ga0436365_0211517 | 3300039437 | Bacteria | 10464 |
| 514 | Ga0436365_0587652 | 3300039437 | Bacteria | 4889 |
| 515 | Ga0439453_0013774 | 3300041408 | Bacteria | 1378 |
| 516 | Ga0450920_002276 | 3300042122 | Bacteria | 3253 |
| 517 | Ga0450923_008347 | 3300042125 | Bacteria | 1781 |
| 518 | Ga0450923_012749 | 3300042125 | Bacteria | 1534 |
| 519 | Ga0450894_002291 | 3300042131 | Bacteria | 2595 |
| 520 | Ga0450895_003276 | 3300042132 | Bacteria | 1241 |
| 521 | Ga0450906_032253 | 3300042145 | Bacteria | 926 |
| 522 | Ga0450910_014943 | 3300042147 | Bacteria | 1139 |
| 523 | Ga0439446_0003219 | 3300042156 | Bacteria | 4030 |
| 524 | Ga0439446_0006965 | 3300042156 | Bacteria | 2961 |
| 525 | Ga0439434_0000069 | 3300042435 | Bacteria | 25160 |
| 526 | Ga0439435_0002644 | 3300042436 | Bacteria | 3601 |
| 527 | Ga0450918_007305 | 3300042531 | Bacteria | 1958 |
| 528 | Ga0466970_0052642 | 3300044765 | Bacteria | 2173 |
| 529 | Ga0466970_0056532 | 3300044765 | Bacteria | 2097 |
| 530 | Ga0495617_063441 | 3300046452 | Bacteria | 1220 |
| 531 | Ga0495592_0038235 | 3300046454 | Bacteria | 3611 |
| 532 | Ga0495590_0124134 | 3300046457 | Bacteria | 926 |
| 533 | Ga0495629_0027980 | 3300046459 | Bacteria | 4004 |
| 534 | Ga0495638_0002975 | 3300046460 | Bacteria | 13525 |
| 535 | Ga0495638_0126205 | 3300046460 | Bacteria | 1508 |
| 536 | Ga0495641_0043345 | 3300046461 | Bacteria | 2081 |
| 537 | Ga0495653_0017397 | 3300046463 | Bacteria | 5847 |
| 538 | Ga0495582_0017692 | 3300046473 | Bacteria | 3898 |
| 539 | Ga0495639_0095079 | 3300046475 | Bacteria | 1402 |
| 540 | Ga0495662_0122445 | 3300046476 | Bacteria | 1277 |
| 541 | Ga0495664_0212688 | 3300046477 | Bacteria | 1171 |
| 542 | Ga0495584_0205700 | 3300046491 | Bacteria | 1000 |
| 543 | Ga0495585_0129286 | 3300046492 | Bacteria | 1330 |
| 544 | Ga0495607_0171300 | 3300046501 | Bacteria | 1096 |
| 545 | Ga0495606_0173926 | 3300046507 | Bacteria | 1247 |
| 546 | Ga0495606_0329864 | 3300046507 | Bacteria | 817 |
| 547 | Ga0495608_0016441 | 3300046511 | Bacteria | 5120 |
| 548 | Ga0495620_0040613 | 3300046515 | Bacteria | 2046 |
| 549 | Ga0495628_0110486 | 3300046516 | Bacteria | 2115 |
| 550 | Ga0495630_0036902 | 3300046517 | Bacteria | 3654 |
| 551 | Ga0495631_0121153 | 3300046518 | Bacteria | 1125 |
| 552 | Ga0495666_0114793 | 3300046526 | Bacteria | 1264 |
| 553 | Ga0495652_0156991 | 3300046529 | Bacteria | 1771 |
| 554 | Ga0495640_0003772 | 3300046533 | Bacteria | 12157 |
| 555 | Ga0495586_0267904 | 3300046535 | Bacteria | 976 |
| 556 | Ga0495621_0020218 | 3300046539 | Bacteria | 2183 |
| 557 | Ga0495645_0266154 | 3300046543 | Bacteria | 1133 |
| 558 | Ga0495667_0041413 | 3300046559 | Bacteria | 3055 |
| 559 | Ga0495667_0278014 | 3300046559 | Bacteria | 1063 |
| 560 | Ga0495634_0009029 | 3300046642 | Bacteria | 7375 |
| 561 | Ga0495634_0120963 | 3300046642 | Bacteria | 1677 |
| 562 | Ga0495611_0267748 | 3300046648 | Bacteria | 790 |
| 563 | Ga0495625_0031870 | 3300046660 | Bacteria | 3916 |
| 564 | Ga0495625_0139285 | 3300046660 | Bacteria | 1638 |
| 565 | Ga0495625_0217587 | 3300046660 | Bacteria | 1253 |
| 566 | Ga0495635_0005370 | 3300046663 | Bacteria | 8919 |
| 567 | Ga0495635_0415215 | 3300046663 | Bacteria | 893 |
| 568 | Ga0495659_0074038 | 3300046664 | Bacteria | 1281 |
| 569 | Ga0495661_0123239 | 3300046665 | Bacteria | 1429 |
| 570 | Ga0495599_0246029 | 3300046678 | Bacteria | 1089 |
| 571 | Ga0495599_0344597 | 3300046678 | Bacteria | 894 |
| 572 | Ga0495646_0015685 | 3300046680 | Bacteria | 4808 |
| 573 | Ga0495647_0136946 | 3300046681 | Bacteria | 1042 |
| 574 | Ga0495669_0000691 | 3300046684 | Bacteria | 14739 |
| 575 | Ga0495613_0042320 | 3300046689 | Bacteria | 3371 |
| 576 | Ga0495613_0190358 | 3300046689 | Bacteria | 1450 |
| 577 | Ga0495613_0266069 | 3300046689 | Bacteria | 1193 |
| 578 | Ga0495624_0065285 | 3300046690 | Bacteria | 2274 |
| 579 | Ga0495670_0018122 | 3300046691 | Bacteria | 3467 |
| 580 | Ga0495649_0148309 | 3300046694 | Bacteria | 1233 |
| 581 | Ga0495600_0050936 | 3300046809 | Bacteria | 2702 |
| 582 | Ga0495581_0093842 | 3300047315 | Bacteria | 1742 |
| 583 | Ga0495581_0309379 | 3300047315 | Bacteria | 923 |
| 584 | Ga0495604_0002468 | 3300047317 | Bacteria | 14761 |
| 585 | Ga0495674_0002597 | 3300047319 | Bacteria | 17589 |
| 586 | Ga0495680_0006886 | 3300047322 | Bacteria | 10493 |
| 587 | Ga0495675_0085415 | 3300047444 | Bacteria | 1984 |
| 588 | Ga0495684_0043679 | 3300047471 | Bacteria | 3432 |
| 589 | Ga0495684_0093022 | 3300047471 | Bacteria | 2284 |
| 590 | Ga0495686_0221284 | 3300047472 | Bacteria | 1076 |
| 591 | Ga0495593_0101065 | 3300047673 | Bacteria | 1479 |
| 592 | Ga0495602_0062499 | 3300048088 | Bacteria | 3230 |
| 593 | Ga0495615_0052262 | 3300048090 | Bacteria | 1055 |
| 594 | Ga0495626_0119582 | 3300048091 | Bacteria | 1134 |
| 595 | Ga0496101_0168156 | 3300048904 | Bacteria | 1684 |
| 596 | Ga0496101_0567664 | 3300048904 | Bacteria | 897 |
| 597 | Ga0496102_0029469 | 3300048905 | Bacteria | 4911 |
| 598 | Ga0496102_0035433 | 3300048905 | Bacteria | 4491 |
| 599 | Ga0496102_0065734 | 3300048905 | Bacteria | 3324 |
| 600 | Ga0496102_0158320 | 3300048905 | Bacteria | 2129 |
| 601 | Ga0496103_0007410 | 3300048906 | Bacteria | 6538 |
| 602 | Ga0496103_0015627 | 3300048906 | Bacteria | 4522 |
| 603 | Ga0496104_0044921 | 3300048907 | Bacteria | 4152 |
| 604 | Ga0496104_0113736 | 3300048907 | Bacteria | 2595 |
| 605 | Ga0496104_0212088 | 3300048907 | Unclassified | 1848 |
| 606 | Ga0496105_0025731 | 3300048908 | Bacteria | 4794 |
| 607 | Ga0496105_0137340 | 3300048908 | Bacteria | 2013 |
| 608 | Ga0496106_0033684 | 3300048909 | Bacteria | 3823 |
| 609 | Ga0496106_0036115 | 3300048909 | Bacteria | 3696 |
| 610 | Ga0496107_0056984 | 3300048910 | Bacteria | 2824 |
| 611 | Ga0496107_0469089 | 3300048910 | Bacteria | 934 |
| 612 | Ga0496108_0008694 | 3300048911 | Bacteria | 8234 |
| 613 | Ga0496108_0028422 | 3300048911 | Bacteria | 4626 |
| 614 | Ga0496109_0014437 | 3300048912 | Bacteria | 6872 |
| 615 | Ga0496109_0015956 | 3300048912 | Bacteria | 6561 |
| 616 | Ga0496109_0342971 | 3300048912 | Bacteria | 1411 |
| 617 | Ga0496110_0015800 | 3300048913 | Bacteria | 6293 |
| 618 | Ga0496110_0096335 | 3300048913 | Bacteria | 2651 |
| 619 | Ga0496110_0117673 | 3300048913 | Bacteria | 2393 |
| 620 | Ga0496111_0008197 | 3300048914 | Bacteria | 6905 |
| 621 | Ga0496111_0038006 | 3300048914 | Bacteria | 3447 |
| 622 | Ga0496111_0054703 | 3300048914 | Bacteria | 2886 |
| 623 | Ga0496112_0002369 | 3300048915 | Bacteria | 15145 |
| 624 | Ga0496112_0122707 | 3300048915 | Bacteria | 2568 |
| 625 | Ga0496113_0003688 | 3300048916 | Bacteria | 9224 |
| 626 | Ga0496113_0037136 | 3300048916 | Bacteria | 3572 |
| 627 | Ga0496114_0013568 | 3300048917 | Bacteria | 6536 |
| 628 | Ga0496114_0115522 | 3300048917 | Bacteria | 2303 |
| 629 | Ga0496115_0024390 | 3300048918 | Bacteria | 4699 |
| 630 | Ga0496115_0619335 | 3300048918 | Bacteria | 859 |
| 631 | Ga0496117_0000067 | 3300048920 | Bacteria | 249348 |
| 632 | Ga0496117_0008247 | 3300048920 | Bacteria | 9929 |
| 633 | Ga0496117_0038265 | 3300048920 | Bacteria | 3560 |
| 634 | Ga0496117_0052793 | 3300048920 | Bacteria | 2861 |
| 635 | Ga0496118_0000021 | 3300048921 | Bacteria | 444988 |
| 636 | Ga0496118_0000216 | 3300048921 | Bacteria | 100502 |
| 637 | Ga0496119_0000323 | 3300048922 | Bacteria | 67133 |
| 638 | Ga0496119_0017268 | 3300048922 | Bacteria | 5435 |
| 639 | Ga0496119_0280868 | 3300048922 | Bacteria | 828 |
| 640 | Ga0496120_0000042 | 3300048923 | Bacteria | 197055 |
| 641 | Ga0496120_0019318 | 3300048923 | Bacteria | 4361 |
| 642 | Ga0496121_0002128 | 3300048924 | Bacteria | 31122 |
| 643 | Ga0496121_0028474 | 3300048924 | Bacteria | 5199 |
| 644 | Ga0496121_0031827 | 3300048924 | Bacteria | 4810 |
| 645 | Ga0496121_0285638 | 3300048924 | Bacteria | 1126 |
| 646 | Ga0496122_0022949 | 3300048925 | Bacteria | 5523 |
| 647 | Ga0496122_0208254 | 3300048925 | Bacteria | 1135 |
| 648 | Ga0496123_0041927 | 3300048926 | Bacteria | 3166 |
| 649 | Ga0496123_0086227 | 3300048926 | Bacteria | 1885 |
| 650 | Ga0496124_0377854 | 3300048927 | Bacteria | 992 |
| 651 | Ga0496125_0000533 | 3300048928 | Bacteria | 65519 |
| 652 | Ga0496125_0032702 | 3300048928 | Unclassified | 4617 |
| 653 | Ga0496125_0087806 | 3300048928 | Bacteria | 2347 |
| 654 | Ga0496125_0154082 | 3300048928 | Bacteria | 1573 |
| 655 | Ga0496126_0041273 | 3300048929 | Bacteria | 4271 |
| 656 | Ga0501292_000003 | 3300049515 | Bacteria | 161908 |
| 657 | Ga0501294_000294 | 3300049517 | Bacteria | 6102 |
| 658 | Ga0501300_000197 | 3300049523 | Bacteria | 9234 |
| 659 | Ga0501031_0296295 | 3300049568 | Bacteria | 1048 |
| 660 | Ga0501032_0053949 | 3300049569 | Bacteria | 2706 |
| 661 | Ga0501032_0265464 | 3300049569 | Bacteria | 1113 |
| 662 | Ga0501033_0047333 | 3300049570 | Bacteria | 3197 |
| 663 | Ga0501033_0221451 | 3300049570 | Bacteria | 1347 |
| 664 | Ga0501033_0276579 | 3300049570 | Bacteria | 1186 |
| 665 | Ga0501034_0252078 | 3300049571 | Bacteria | 1709 |
| 666 | Ga0501036_0011042 | 3300049572 | Bacteria | 7468 |
| 667 | Ga0501036_0131748 | 3300049572 | Bacteria | 2111 |
| 668 | Ga0501037_0014087 | 3300049573 | Bacteria | 5890 |
| 669 | Ga0501037_0088088 | 3300049573 | Bacteria | 2247 |
| 670 | Ga0501038_0085233 | 3300049574 | Bacteria | 2657 |
| 671 | Ga0501039_0038875 | 3300049575 | Bacteria | 3674 |
| 672 | Ga0501039_0197728 | 3300049575 | Bacteria | 1581 |
| 673 | Ga0501041_0349067 | 3300049577 | Bacteria | 935 |
| 674 | Ga0501042_0089563 | 3300049578 | Bacteria | 2208 |
| 675 | Ga0501042_0295178 | 3300049578 | Bacteria | 1171 |
| 676 | Ga0501043_0016353 | 3300049579 | Bacteria | 5819 |
| 677 | Ga0501043_0207250 | 3300049579 | Bacteria | 1520 |
| 678 | Ga0501046_0151101 | 3300049580 | Bacteria | 1752 |
| 679 | Ga0501047_0161069 | 3300049581 | Bacteria | 2115 |
| 680 | Ga0501047_0324545 | 3300049581 | Bacteria | 1379 |
| 681 | Ga0501048_0610296 | 3300049582 | Bacteria | 783 |
| 682 | Ga0501067_0095853 | 3300049583 | Bacteria | 1647 |
| 683 | Ga0501068_0000308 | 3300049584 | Bacteria | 24470 |
| 684 | Ga0501068_0019639 | 3300049584 | Bacteria | 3927 |
| 685 | Ga0501068_0082502 | 3300049584 | Bacteria | 1975 |
| 686 | Ga0501069_0042863 | 3300049585 | Bacteria | 2504 |
| 687 | Ga0501070_0026692 | 3300049586 | Bacteria | 4845 |
| 688 | Ga0501070_0234987 | 3300049586 | Bacteria | 1501 |
| 689 | Ga0501071_0028442 | 3300049587 | Bacteria | 3940 |
| 690 | Ga0501071_0094772 | 3300049587 | Bacteria | 2196 |
| 691 | Ga0501071_0170166 | 3300049587 | Bacteria | 1631 |
| 692 | Ga0501071_0381232 | 3300049587 | Bacteria | 1075 |
| 693 | Ga0501072_0005081 | 3300049588 | Bacteria | 10018 |
| 694 | Ga0501072_0544800 | 3300049588 | Bacteria | 916 |
| 695 | Ga0501073_0000671 | 3300049589 | Bacteria | 24036 |
| 696 | Ga0501074_0000926 | 3300049590 | Bacteria | 18838 |
| 697 | Ga0501074_0300278 | 3300049590 | Bacteria | 1140 |
| 698 | Ga0501075_0027830 | 3300049591 | Bacteria | 4168 |
| 699 | Ga0501075_0165224 | 3300049591 | Bacteria | 1689 |
| 700 | Ga0501075_0392160 | 3300049591 | Bacteria | 1058 |
| 701 | Ga0501076_0173241 | 3300049592 | Bacteria | 1759 |
| 702 | Ga0501076_0192599 | 3300049592 | Bacteria | 1664 |
| 703 | Ga0501076_0318703 | 3300049592 | Bacteria | 1275 |
| 704 | Ga0501076_0580676 | 3300049592 | Bacteria | 924 |
| 705 | Ga0501077_0023354 | 3300049593 | Bacteria | 3921 |
| 706 | Ga0501077_0214446 | 3300049593 | Bacteria | 1223 |
| 707 | Ga0501202_036608 | 3300049652 | Bacteria | 1045 |
| 708 | Ga0501206_023323 | 3300049653 | Bacteria | 891 |
| 709 | Ga0501222_000197 | 3300049662 | Bacteria | 10844 |
| 710 | Ga0501224_003301 | 3300049664 | Bacteria | 2244 |
| 711 | Ga0501227_000365 | 3300049665 | Bacteria | 9527 |
| 712 | Ga0501233_002537 | 3300049668 | Bacteria | 3226 |
| 713 | Ga0501235_022492 | 3300049669 | Bacteria | 1401 |
| 714 | Ga0501236_004811 | 3300049670 | Bacteria | 1613 |
| 715 | Ga0501257_020481 | 3300049686 | Bacteria | 1553 |
| 716 | Ga0501259_000022 | 3300049688 | Bacteria | 22627 |
| 717 | Ga0501261_000007 | 3300049690 | Bacteria | 60773 |
| 718 | Ga0501221_007955 | 3300049704 | Bacteria | 1832 |
| 719 | Ga0501225_0003127 | 3300049705 | Bacteria | 5060 |
| 720 | Ga0501229_004563 | 3300049706 | Bacteria | 1685 |
| 721 | Ga0501245_000064 | 3300049708 | Bacteria | 10076 |
| 722 | Ga0501079_0011184 | 3300049741 | Bacteria | 6846 |
| 723 | Ga0501079_0013454 | 3300049741 | Bacteria | 6239 |
| 724 | Ga0501079_0262476 | 3300049741 | Bacteria | 1350 |
| 725 | Ga0501080_0002630 | 3300049742 | Bacteria | 15715 |
| 726 | Ga0501080_0016670 | 3300049742 | Bacteria | 6784 |
| 727 | Ga0501080_0374316 | 3300049742 | Bacteria | 1284 |
| 728 | Ga0501083_0059698 | 3300049744 | Bacteria | 2550 |
| 729 | Ga0501083_0143162 | 3300049744 | Bacteria | 1565 |
| 730 | Ga0501279_000009 | 3300049775 | Bacteria | 117146 |
| 731 | Ga0501280_000047 | 3300049776 | Bacteria | 35975 |
| 732 | Ga0501281_00349 | 3300049777 | Bacteria | 4713 |
| 733 | Ga0501282_000100 | 3300049778 | Bacteria | 9696 |
| 734 | Ga0501283_000412 | 3300049779 | Bacteria | 5689 |
| 735 | Ga0501035_0071455 | 3300049822 | Bacteria | 3072 |
| 736 | Ga0501044_0015007 | 3300049823 | Bacteria | 8351 |
| 737 | nmdc:mga03683_112313_c1 | 3300050489 | Bacteria | 1206 |
| 738 | nmdc:mga03683_20740_c1 | 3300050489 | Bacteria | 2525 |
| 739 | nmdc:mga03683_3715_c1 | 3300050489 | Bacteria | 4972 |
| 740 | nmdc:mga03683_90072_c1 | 3300050489 | Bacteria | 1336 |
| 741 | nmdc:mga0k408_137650_c1 | 3300050493 | Bacteria | 1451 |
| 742 | nmdc:mga0k408_25599_c1 | 3300050493 | Bacteria | 3342 |
| 743 | nmdc:mga0k408_25689_c1 | 3300050493 | Bacteria | 3337 |
| 744 | nmdc:mga0k408_6102_c1 | 3300050493 | Bacteria | 6419 |
| 745 | nmdc:mga06z11_122085_c1 | 3300050494 | Bacteria | 1454 |
| 746 | nmdc:mga07m45_14207_c1 | 3300050496 | Bacteria | 4236 |
| 747 | nmdc:mga07m45_63136_c2 | 3300050496 | Bacteria | 1634 |
| 748 | nmdc:mga07m45_80550_c1 | 3300050496 | Bacteria | 1859 |
| 749 | nmdc:mga07m45_886_c1 | 3300050496 | Bacteria | 12563 |
| 750 | nmdc:mga05p37_209805_c1 | 3300050507 | Bacteria | 2355 |
| 751 | nmdc:mga09592_128621_c1 | 3300050508 | Bacteria | 2178 |
| 752 | nmdc:mga0qj67_18511_c1 | 3300050509 | Bacteria | 5309 |
| 753 | nmdc:mga06r32_12838_c1 | 3300050510 | Bacteria | 7573 |
| 754 | nmdc:mga08y16_19864_c1 | 3300050511 | Bacteria | 7086 |
| 755 | nmdc:mga08y16_465329_c1 | 3300050511 | Bacteria | 1288 |
| 756 | nmdc:mga08y16_633237_c1 | 3300050511 | Bacteria | 1075 |
| 757 | nmdc:mga0n895_7477_c1 | 3300050512 | Bacteria | 9379 |
| 758 | nmdc:mga0rr50_6155_c1 | 3300050513 | Bacteria | 7265 |
| 759 | nmdc:mga0a205_2164_c1 | 3300050515 | Bacteria | 17268 |
| 760 | nmdc:mga0sz30_11926_c1 | 3300050516 | Bacteria | 3369 |
| 761 | nmdc:mga0sz30_4626_c1 | 3300050516 | Bacteria | 4983 |
| 762 | nmdc:mga0sz30_531_c2 | 3300050516 | Bacteria | 6733 |
| 763 | Ga0495601_0007858 | 3300053077 | Bacteria | 6278 |
| 764 | Ga0495612_0012043 | 3300053078 | Bacteria | 3484 |
| 765 | Ga0495655_0049749 | 3300053083 | Bacteria | 1105 |
| 766 | Ga0495595_0017419 | 3300053084 | Bacteria | 3090 |
| 767 | Ga0495619_0012574 | 3300053085 | Bacteria | 5330 |
| 768 | Ga0500643_000475 | 3300053087 | Bacteria | 29406 |
| 769 | Ga0500643_006666 | 3300053087 | Bacteria | 4788 |
| 770 | Ga0500643_015447 | 3300053087 | Bacteria | 2618 |
| 771 | Ga0500643_023162 | 3300053087 | Bacteria | 1987 |
| 772 | Ga0500644_0112384 | 3300053088 | Bacteria | 1051 |
| 773 | Ga0500566_0003208 | 3300053094 | Bacteria | 9779 |
| 774 | Ga0500592_000558 | 3300053116 | Bacteria | 6154 |
| 775 | Ga0500595_022667 | 3300053119 | Bacteria | 2218 |
| 776 | Ga0500607_000007 | 3300053121 | Bacteria | 134097 |
| 777 | Ga0500607_001592 | 3300053121 | Bacteria | 20060 |
| 778 | Ga0500608_204682 | 3300053122 | Bacteria | 812 |
| 779 | Ga0500658_0010929 | 3300053134 | Bacteria | 3348 |
| 780 | Ga0500658_0011943 | 3300053134 | Bacteria | 3203 |
| 781 | Ga0500559_0001181 | 3300053136 | Bacteria | 15619 |
| 782 | Ga0500568_0019617 | 3300053139 | Bacteria | 2935 |
| 783 | Ga0500568_0044871 | 3300053139 | Bacteria | 1760 |
| 784 | Ga0500573_0000022 | 3300053140 | Bacteria | 154562 |
| 785 | Ga0500604_0008236 | 3300053151 | Bacteria | 2763 |
| 786 | Ga0500616_0000123 | 3300053153 | Bacteria | 140214 |
| 787 | Ga0500622_0000145 | 3300053156 | Bacteria | 75417 |
| 788 | Ga0500627_0000028 | 3300053158 | Bacteria | 99118 |
| 789 | Ga0500627_0055583 | 3300053158 | Bacteria | 1733 |
| 790 | Ga0500636_0060568 | 3300053177 | Bacteria | 2210 |
| 791 | Ga0500637_0021059 | 3300053178 | Bacteria | 3539 |
| 792 | Ga0500637_0057396 | 3300053178 | Bacteria | 2225 |
| 793 | Ga0500611_021686 | 3300053727 | Bacteria | 1229 |
| 794 | Ga0500645_002010 | 3300053730 | Bacteria | 9526 |
| 795 | Ga0500552_000397 | 3300053733 | Bacteria | 3993 |
| 796 | Ga0501084_0010540 | 3300054114 | Bacteria | 7644 |
| 797 | Ga0590071_033434 | 3300059421 | Bacteria | 1229 |
| 798 | Ga0590077_007651 | 3300059426 | Bacteria | 2208 |
| 799 | Ga0501082_0014265 | 3300060353 | Bacteria | 6838 |
| 800 | Ga0501082_0014811 | 3300060353 | Bacteria | 6717 |
| 801 | Ga0501082_0540016 | 3300060353 | Bacteria | 1020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0221451 | Ga0501033_0221451_176_775 | 197 |
| 2 | 3300025940 | Ga0207691_10270901 | Ga0207691_102709012 | 205 |
| 3 | 3300046642 | Ga0495634_0120963 | Ga0495634_0120963_10_645 | 210 |
| 4 | 3300046678 | Ga0495599_0344597 | Ga0495599_0344597_239_874 | 210 |
| 5 | 3300053134 | Ga0500658_0011943 | Ga0500658_0011943_2268_2987 | 210 |
| 6 | 3300003791 | Ga0055530_10000197 | Ga0055530_1000019724 | 211 |
| 7 | 3300003794 | Ga0055531_10000292 | Ga0055531_1000029241 | 211 |
| 8 | 3300025291 | Ga0209675_1000162 | Ga0209675_100016267 | 211 |
| 9 | 3300025292 | Ga0209676_1000113 | Ga0209676_1000113102 | 211 |
| 10 | 3300025292 | Ga0209676_1000146 | Ga0209676_1000146139 | 211 |
| 11 | 3300025298 | Ga0209050_1000126 | Ga0209050_1000126102 | 211 |
| 12 | 3300025304 | Ga0209257_1000256 | Ga0209257_100025696 | 211 |
| 13 | 3300025304 | Ga0209257_1002727 | Ga0209257_10027271 | 212 |
| 14 | 3300049569 | Ga0501032_0265464 | Ga0501032_0265464_175_909 | 214 |
| 15 | 3300049573 | Ga0501037_0014087 | Ga0501037_0014087_4854_5588 | 214 |
| 16 | 3300009101 | Ga0105247_10120649 | Ga0105247_101206492 | 221 |
| 17 | 3300025940 | Ga0207691_10240259 | Ga0207691_102402592 | 221 |
| 18 | 3300027364 | Ga0209967_1024052 | Ga0209967_10240521 | 223 |
| 19 | 3300031548 | Ga0307408_100024971 | Ga0307408_1000249712 | 224 |
| 20 | 3300031731 | Ga0307405_10003561 | Ga0307405_100035612 | 224 |
| 21 | 3300032002 | Ga0307416_100000441 | Ga0307416_1000004413 | 224 |
| 22 | 3300032004 | Ga0307414_10208914 | Ga0307414_102089142 | 224 |
| 23 | 3300032005 | Ga0307411_10001164 | Ga0307411_100011641 | 224 |
| 24 | 3300041408 | Ga0439453_0013774 | Ga0439453_0013774_414_1133 | 224 |
| 25 | 3300042125 | Ga0450923_008347 | Ga0450923_008347_22_741 | 224 |
| 26 | 3300042156 | Ga0439446_0006965 | Ga0439446_0006965_852_1571 | 224 |
| 27 | 3300042435 | Ga0439434_0000069 | Ga0439434_0000069_8150_8869 | 224 |
| 28 | 3300042436 | Ga0439435_0002644 | Ga0439435_0002644_353_1072 | 224 |
| 29 | 3300046476 | Ga0495662_0122445 | Ga0495662_0122445_190_867 | 224 |
| 30 | 3300031995 | Ga0307409_100097477 | Ga0307409_1000974773 | 227 |
| 31 | iso_pu_bacteria | 2643221598 | 2644001505 | 230 |
| 32 | iso_pu_bacteria | 2939669807 | 2939673428 | 231 |
| 33 | iso_pu_bacteria | 2643221734 | 2644733455 | 232 |
| 34 | iso_pu_bacteria | 2818991467 | 2819717404 | 232 |
| 35 | iso_pu_bacteria | 2917699015 | 2917701041 | 232 |
| 36 | 3300049570 | Ga0501033_0276579 | Ga0501033_0276579_371_1081 | 234 |
| 37 | iso_pu_bacteria | 2643221560 | 2643820274 | 234 |
| 38 | iso_pu_bacteria | 2643221563 | 2643834590 | 234 |
| 39 | iso_pu_bacteria | 2643221608 | 2644055516 | 234 |
| 40 | iso_pu_bacteria | 2852680915 | 2852683335 | 234 |
| 41 | 3300001990 | JGI24737J22298_10055691 | JGI24737J22298_100556912 | 235 |
| 42 | 3300002067 | JGI24735J21928_10005493 | JGI24735J21928_100054935 | 235 |
| 43 | 3300005344 | Ga0070661_100010594 | Ga0070661_1000105947 | 235 |
| 44 | 3300005366 | Ga0070659_100166761 | Ga0070659_1001667612 | 235 |
| 45 | 3300005455 | Ga0070663_100268519 | Ga0070663_1002685192 | 235 |
| 46 | 3300005530 | Ga0070679_100543504 | Ga0070679_1005435042 | 235 |
| 47 | 3300013102 | Ga0157371_10109285 | Ga0157371_101092853 | 235 |
| 48 | 3300013296 | Ga0157374_10023048 | Ga0157374_100230486 | 235 |
| 49 | 3300025904 | Ga0207647_10024093 | Ga0207647_100240935 | 235 |
| 50 | 3300025909 | Ga0207705_10020786 | Ga0207705_100207865 | 235 |
| 51 | 3300025919 | Ga0207657_10386687 | Ga0207657_103866872 | 235 |
| 52 | 3300025932 | Ga0207690_10136197 | Ga0207690_101361972 | 235 |
| 53 | 3300025986 | Ga0207658_10557606 | Ga0207658_105576062 | 235 |
| 54 | 3300026067 | Ga0207678_10080714 | Ga0207678_100807142 | 235 |
| 55 | 3300032004 | Ga0307414_10447535 | Ga0307414_104475351 | 235 |
| 56 | 3300037312 | Ga0395899_0243748 | Ga0395899_0243748_119_847 | 235 |
| 57 | 3300039437 | Ga0436365_0587652 | Ga0436365_0587652_419_1132 | 235 |
| 58 | 3300044765 | Ga0466970_0052642 | Ga0466970_0052642_671_1423 | 235 |
| 59 | 3300044765 | Ga0466970_0056532 | Ga0466970_0056532_1163_1912 | 235 |
| 60 | 3300048928 | Ga0496125_0154082 | Ga0496125_0154082_379_1089 | 235 |
| 61 | 3300053122 | Ga0500608_204682 | Ga0500608_204682_66_776 | 235 |
| 62 | 3300053139 | Ga0500568_0019617 | Ga0500568_0019617_1280_1993 | 235 |
| 63 | 3300053177 | Ga0500636_0060568 | Ga0500636_0060568_1317_2027 | 235 |
| 64 | 3300003187 | JGI25151J46595_10000040 | JGI25151J46595_10000040107 | 236 |
| 65 | 3300003320 | rootH2_10196163 | rootH2_101961632 | 236 |
| 66 | 3300003771 | Ga0055526_1001693 | Ga0055526_100169313 | 236 |
| 67 | 3300003775 | Ga0055524_1000023 | Ga0055524_1000023132 | 236 |
| 68 | 3300005327 | Ga0070658_10003103 | Ga0070658_100031036 | 236 |
| 69 | 3300005327 | Ga0070658_10122733 | Ga0070658_101227333 | 236 |
| 70 | 3300005327 | Ga0070658_10350252 | Ga0070658_103502522 | 236 |
| 71 | 3300005328 | Ga0070676_10016652 | Ga0070676_100166523 | 236 |
| 72 | 3300005328 | Ga0070676_10036119 | Ga0070676_100361193 | 236 |
| 73 | 3300005328 | Ga0070676_10082648 | Ga0070676_100826482 | 236 |
| 74 | 3300005328 | Ga0070676_10246759 | Ga0070676_102467592 | 236 |
| 75 | 3300005330 | Ga0070690_100000857 | Ga0070690_1000008578 | 236 |
| 76 | 3300005331 | Ga0070670_100276851 | Ga0070670_1002768512 | 236 |
| 77 | 3300005347 | Ga0070668_100355482 | Ga0070668_1003554821 | 236 |
| 78 | 3300005347 | Ga0070668_100487648 | Ga0070668_1004876482 | 236 |
| 79 | 3300005353 | Ga0070669_100068580 | Ga0070669_1000685803 | 236 |
| 80 | 3300005353 | Ga0070669_100319693 | Ga0070669_1003196931 | 236 |
| 81 | 3300005354 | Ga0070675_100035554 | Ga0070675_1000355542 | 236 |
| 82 | 3300005354 | Ga0070675_100251712 | Ga0070675_1002517123 | 236 |
| 83 | 3300005354 | Ga0070675_100334862 | Ga0070675_1003348622 | 236 |
| 84 | 3300005355 | Ga0070671_100085184 | Ga0070671_1000851843 | 236 |
| 85 | 3300005355 | Ga0070671_100197249 | Ga0070671_1001972492 | 236 |
| 86 | 3300005364 | Ga0070673_100090420 | Ga0070673_1000904202 | 236 |
| 87 | 3300005367 | Ga0070667_100333577 | Ga0070667_1003335772 | 236 |
| 88 | 3300005441 | Ga0070700_100025029 | Ga0070700_1000250292 | 236 |
| 89 | 3300005441 | Ga0070700_100110172 | Ga0070700_1001101723 | 236 |
| 90 | 3300005444 | Ga0070694_100404932 | Ga0070694_1004049322 | 236 |
| 91 | 3300005457 | Ga0070662_100209315 | Ga0070662_1002093152 | 236 |
| 92 | 3300005457 | Ga0070662_100392312 | Ga0070662_1003923122 | 236 |
| 93 | 3300005459 | Ga0068867_100040588 | Ga0068867_1000405884 | 236 |
| 94 | 3300005459 | Ga0068867_100068904 | Ga0068867_1000689042 | 236 |
| 95 | 3300005530 | Ga0070679_100615694 | Ga0070679_1006156941 | 236 |
| 96 | 3300005539 | Ga0068853_100139015 | Ga0068853_1001390152 | 236 |
| 97 | 3300005543 | Ga0070672_100038046 | Ga0070672_1000380464 | 236 |
| 98 | 3300005543 | Ga0070672_100304381 | Ga0070672_1003043812 | 236 |
| 99 | 3300005563 | Ga0068855_101011226 | Ga0068855_1010112261 | 236 |
| 100 | 3300005577 | Ga0068857_100269993 | Ga0068857_1002699932 | 236 |
| 101 | 3300005577 | Ga0068857_100759170 | Ga0068857_1007591701 | 236 |
| 102 | 3300005719 | Ga0068861_100164541 | Ga0068861_1001645413 | 236 |
| 103 | 3300005841 | Ga0068863_100460005 | Ga0068863_1004600052 | 236 |
| 104 | 3300005842 | Ga0068858_100000318 | Ga0068858_10000031827 | 236 |
| 105 | 3300005844 | Ga0068862_100274922 | Ga0068862_1002749222 | 236 |
| 106 | 3300005937 | Ga0081455_10315218 | Ga0081455_103152182 | 236 |
| 107 | 3300006038 | Ga0075365_10269779 | Ga0075365_102697791 | 236 |
| 108 | 3300006051 | Ga0075364_10149717 | Ga0075364_101497172 | 236 |
| 109 | 3300006051 | Ga0075364_10238658 | Ga0075364_102386582 | 236 |
| 110 | 3300006051 | Ga0075364_10314550 | Ga0075364_103145502 | 236 |
| 111 | 3300006177 | Ga0075362_10029630 | Ga0075362_100296302 | 236 |
| 112 | 3300006177 | Ga0075362_10030432 | Ga0075362_100304324 | 236 |
| 113 | 3300006178 | Ga0075367_10115586 | Ga0075367_101155862 | 236 |
| 114 | 3300006178 | Ga0075367_10216224 | Ga0075367_102162242 | 236 |
| 115 | 3300006195 | Ga0075366_10030386 | Ga0075366_100303862 | 236 |
| 116 | 3300006195 | Ga0075366_10152908 | Ga0075366_101529082 | 236 |
| 117 | 3300006237 | Ga0097621_100002041 | Ga0097621_1000020414 | 236 |
| 118 | 3300006237 | Ga0097621_100338866 | Ga0097621_1003388661 | 236 |
| 119 | 3300006358 | Ga0068871_100002322 | Ga0068871_1000023223 | 236 |
| 120 | 3300006881 | Ga0068865_100128545 | Ga0068865_1001285452 | 236 |
| 121 | 3300006881 | Ga0068865_100138221 | Ga0068865_1001382212 | 236 |
| 122 | 3300006931 | Ga0097620_100718397 | Ga0097620_1007183971 | 236 |
| 123 | 3300009094 | Ga0111539_10158167 | Ga0111539_101581673 | 236 |
| 124 | 3300009094 | Ga0111539_10771889 | Ga0111539_107718892 | 236 |
| 125 | 3300009098 | Ga0105245_10001471 | Ga0105245_1000147115 | 236 |
| 126 | 3300009148 | Ga0105243_10410560 | Ga0105243_104105602 | 236 |
| 127 | 3300009148 | Ga0105243_10826364 | Ga0105243_108263641 | 236 |
| 128 | 3300010375 | Ga0105239_10597738 | Ga0105239_105977381 | 236 |
| 129 | 3300013250 | Ga0171462_1045 | Ga0171462_104536 | 236 |
| 130 | 3300013297 | Ga0157378_10277596 | Ga0157378_102775962 | 236 |
| 131 | 3300013306 | Ga0163162_10560517 | Ga0163162_105605172 | 236 |
| 132 | 3300013308 | Ga0157375_10039099 | Ga0157375_100390993 | 236 |
| 133 | 3300014326 | Ga0157380_10022349 | Ga0157380_100223494 | 236 |
| 134 | 3300014326 | Ga0157380_10053544 | Ga0157380_100535444 | 236 |
| 135 | 3300014326 | Ga0157380_10281387 | Ga0157380_102813872 | 236 |
| 136 | 3300017792 | Ga0163161_10387846 | Ga0163161_103878462 | 236 |
| 137 | 3300025294 | Ga0209025_1000016 | Ga0209025_1000016444 | 236 |
| 138 | 3300025294 | Ga0209025_1075336 | Ga0209025_10753362 | 236 |
| 139 | 3300025295 | Ga0209564_1000076 | Ga0209564_100007685 | 236 |
| 140 | 3300025299 | Ga0209256_1000083 | Ga0209256_100008385 | 236 |
| 141 | 3300025299 | Ga0209256_1002896 | Ga0209256_10028966 | 236 |
| 142 | 3300025907 | Ga0207645_10038121 | Ga0207645_100381213 | 236 |
| 143 | 3300025907 | Ga0207645_10088731 | Ga0207645_100887312 | 236 |
| 144 | 3300025907 | Ga0207645_10207518 | Ga0207645_102075182 | 236 |
| 145 | 3300025921 | Ga0207652_10633583 | Ga0207652_106335831 | 236 |
| 146 | 3300025926 | Ga0207659_10074785 | Ga0207659_100747853 | 236 |
| 147 | 3300025927 | Ga0207687_10001257 | Ga0207687_1000125712 | 236 |
| 148 | 3300025933 | Ga0207706_10176351 | Ga0207706_101763512 | 236 |
| 149 | 3300025933 | Ga0207706_10435785 | Ga0207706_104357852 | 236 |
| 150 | 3300025938 | Ga0207704_10130501 | Ga0207704_101305012 | 236 |
| 151 | 3300025938 | Ga0207704_10705897 | Ga0207704_107058971 | 236 |
| 152 | 3300025940 | Ga0207691_10002479 | Ga0207691_100024793 | 236 |
| 153 | 3300025940 | Ga0207691_10627663 | Ga0207691_106276631 | 236 |
| 154 | 3300025945 | Ga0207679_10241829 | Ga0207679_102418292 | 236 |
| 155 | 3300025960 | Ga0207651_10075202 | Ga0207651_100752023 | 236 |
| 156 | 3300025972 | Ga0207668_10292463 | Ga0207668_102924632 | 236 |
| 157 | 3300025972 | Ga0207668_10425408 | Ga0207668_104254081 | 236 |
| 158 | 3300025981 | Ga0207640_10682372 | Ga0207640_106823721 | 236 |
| 159 | 3300026035 | Ga0207703_10004368 | Ga0207703_100043687 | 236 |
| 160 | 3300026075 | Ga0207708_10009902 | Ga0207708_100099025 | 236 |
| 161 | 3300026088 | Ga0207641_10031322 | Ga0207641_100313223 | 236 |
| 162 | 3300026089 | Ga0207648_10074433 | Ga0207648_100744332 | 236 |
| 163 | 3300026118 | Ga0207675_100109265 | Ga0207675_1001092652 | 236 |
| 164 | 3300026118 | Ga0207675_100301892 | Ga0207675_1003018922 | 236 |
| 165 | 3300031731 | Ga0307405_10004054 | Ga0307405_100040548 | 236 |
| 166 | 3300031824 | Ga0307413_10028415 | Ga0307413_100284155 | 236 |
| 167 | 3300031824 | Ga0307413_10555109 | Ga0307413_105551092 | 236 |
| 168 | 3300032002 | Ga0307416_100731774 | Ga0307416_1007317741 | 236 |
| 169 | 3300035117 | Ga0373953_0012233 | Ga0373953_0012233_470_1183 | 236 |
| 170 | 3300035118 | Ga0373954_0032919 | Ga0373954_0032919_1407_2120 | 236 |
| 171 | 3300035410 | Ga0373924_0005515 | Ga0373924_0005515_576_1289 | 236 |
| 172 | 3300035692 | Ga0373935_0373196 | Ga0373935_0373196_60_773 | 236 |
| 173 | 3300035724 | Ga0373933_0053543 | Ga0373933_0053543_474_1187 | 236 |
| 174 | 3300036401 | Ga0373937_0261786 | Ga0373937_0261786_884_1597 | 236 |
| 175 | 3300036401 | Ga0373937_0294166 | Ga0373937_0294166_246_959 | 236 |
| 176 | 3300037312 | Ga0395899_0032112 | Ga0395899_0032112_385_1119 | 236 |
| 177 | 3300037312 | Ga0395899_0122289 | Ga0395899_0122289_140_898 | 236 |
| 178 | 3300037418 | Ga0395900_0056710 | Ga0395900_0056710_1521_2279 | 236 |
| 179 | 3300037418 | Ga0395900_0167869 | Ga0395900_0167869_694_1428 | 236 |
| 180 | 3300037418 | Ga0395900_0192160 | Ga0395900_0192160_164_898 | 236 |
| 181 | 3300037466 | Ga0395898_0220985 | Ga0395898_0220985_451_1185 | 236 |
| 182 | 3300037471 | Ga0395905_0034610 | Ga0395905_0034610_1441_2175 | 236 |
| 183 | 3300037471 | Ga0395905_0100066 | Ga0395905_0100066_516_1274 | 236 |
| 184 | 3300037471 | Ga0395905_0562865 | Ga0395905_0562865_58_816 | 236 |
| 185 | 3300038443 | Ga0395901_0010662 | Ga0395901_0010662_3229_3987 | 236 |
| 186 | 3300038443 | Ga0395901_0046767 | Ga0395901_0046767_126_860 | 236 |
| 187 | 3300038443 | Ga0395901_0076679 | Ga0395901_0076679_369_1127 | 236 |
| 188 | 3300038443 | Ga0395901_0120911 | Ga0395901_0120911_1525_2256 | 236 |
| 189 | 3300039145 | Ga0237816_01700 | Ga0237816_01700_324_1037 | 236 |
| 190 | 3300046454 | Ga0495592_0038235 | Ga0495592_0038235_2616_3329 | 236 |
| 191 | 3300046459 | Ga0495629_0027980 | Ga0495629_0027980_861_1574 | 236 |
| 192 | 3300046463 | Ga0495653_0017397 | Ga0495653_0017397_539_1252 | 236 |
| 193 | 3300046477 | Ga0495664_0212688 | Ga0495664_0212688_124_837 | 236 |
| 194 | 3300046511 | Ga0495608_0016441 | Ga0495608_0016441_2082_2795 | 236 |
| 195 | 3300046517 | Ga0495630_0036902 | Ga0495630_0036902_1460_2173 | 236 |
| 196 | 3300046529 | Ga0495652_0156991 | Ga0495652_0156991_839_1552 | 236 |
| 197 | 3300046533 | Ga0495640_0003772 | Ga0495640_0003772_9565_10278 | 236 |
| 198 | 3300046535 | Ga0495586_0267904 | Ga0495586_0267904_164_877 | 236 |
| 199 | 3300046543 | Ga0495645_0266154 | Ga0495645_0266154_66_779 | 236 |
| 200 | 3300046559 | Ga0495667_0041413 | Ga0495667_0041413_1584_2297 | 236 |
| 201 | 3300046642 | Ga0495634_0009029 | Ga0495634_0009029_2110_2823 | 236 |
| 202 | 3300046660 | Ga0495625_0031870 | Ga0495625_0031870_3181_3894 | 236 |
| 203 | 3300046660 | Ga0495625_0217587 | Ga0495625_0217587_396_1136 | 236 |
| 204 | 3300046663 | Ga0495635_0005370 | Ga0495635_0005370_7480_8193 | 236 |
| 205 | 3300046678 | Ga0495599_0246029 | Ga0495599_0246029_158_871 | 236 |
| 206 | 3300046680 | Ga0495646_0015685 | Ga0495646_0015685_470_1183 | 236 |
| 207 | 3300046681 | Ga0495647_0136946 | Ga0495647_0136946_251_964 | 236 |
| 208 | 3300046684 | Ga0495669_0000691 | Ga0495669_0000691_12557_13297 | 236 |
| 209 | 3300046689 | Ga0495613_0266069 | Ga0495613_0266069_470_1183 | 236 |
| 210 | 3300046690 | Ga0495624_0065285 | Ga0495624_0065285_140_853 | 236 |
| 211 | 3300046809 | Ga0495600_0050936 | Ga0495600_0050936_1293_2006 | 236 |
| 212 | 3300047315 | Ga0495581_0093842 | Ga0495581_0093842_843_1556 | 236 |
| 213 | 3300047317 | Ga0495604_0002468 | Ga0495604_0002468_13185_13898 | 236 |
| 214 | 3300047319 | Ga0495674_0002597 | Ga0495674_0002597_15329_16042 | 236 |
| 215 | 3300047322 | Ga0495680_0006886 | Ga0495680_0006886_8050_8763 | 236 |
| 216 | 3300047444 | Ga0495675_0085415 | Ga0495675_0085415_1064_1777 | 236 |
| 217 | 3300047471 | Ga0495684_0043679 | Ga0495684_0043679_938_1651 | 236 |
| 218 | 3300048088 | Ga0495602_0062499 | Ga0495602_0062499_555_1268 | 236 |
| 219 | 3300048912 | Ga0496109_0342971 | Ga0496109_0342971_79_792 | 236 |
| 220 | 3300048913 | Ga0496110_0117673 | Ga0496110_0117673_1200_1940 | 236 |
| 221 | 3300048917 | Ga0496114_0115522 | Ga0496114_0115522_961_1674 | 236 |
| 222 | 3300048918 | Ga0496115_0619335 | Ga0496115_0619335_13_726 | 236 |
| 223 | 3300048920 | Ga0496117_0052793 | Ga0496117_0052793_1517_2230 | 236 |
| 224 | 3300048925 | Ga0496122_0022949 | Ga0496122_0022949_231_944 | 236 |
| 225 | 3300048925 | Ga0496122_0208254 | Ga0496122_0208254_154_867 | 236 |
| 226 | 3300048926 | Ga0496123_0041927 | Ga0496123_0041927_2135_2848 | 236 |
| 227 | 3300048926 | Ga0496123_0086227 | Ga0496123_0086227_955_1668 | 236 |
| 228 | 3300048928 | Ga0496125_0087806 | Ga0496125_0087806_346_1068 | 236 |
| 229 | 3300049572 | Ga0501036_0131748 | Ga0501036_0131748_151_864 | 236 |
| 230 | 3300049577 | Ga0501041_0349067 | Ga0501041_0349067_204_917 | 236 |
| 231 | 3300049578 | Ga0501042_0089563 | Ga0501042_0089563_614_1327 | 236 |
| 232 | 3300049578 | Ga0501042_0295178 | Ga0501042_0295178_394_1107 | 236 |
| 233 | 3300049581 | Ga0501047_0324545 | Ga0501047_0324545_269_982 | 236 |
| 234 | 3300049583 | Ga0501067_0095853 | Ga0501067_0095853_69_782 | 236 |
| 235 | 3300049584 | Ga0501068_0000308 | Ga0501068_0000308_7499_8227 | 236 |
| 236 | 3300049584 | Ga0501068_0019639 | Ga0501068_0019639_195_908 | 236 |
| 237 | 3300049585 | Ga0501069_0042863 | Ga0501069_0042863_1378_2106 | 236 |
| 238 | 3300049586 | Ga0501070_0026692 | Ga0501070_0026692_3112_3825 | 236 |
| 239 | 3300049586 | Ga0501070_0234987 | Ga0501070_0234987_308_1036 | 236 |
| 240 | 3300049587 | Ga0501071_0028442 | Ga0501071_0028442_1271_1999 | 236 |
| 241 | 3300049587 | Ga0501071_0094772 | Ga0501071_0094772_1015_1728 | 236 |
| 242 | 3300049587 | Ga0501071_0170166 | Ga0501071_0170166_74_787 | 236 |
| 243 | 3300049588 | Ga0501072_0005081 | Ga0501072_0005081_1245_1973 | 236 |
| 244 | 3300049588 | Ga0501072_0544800 | Ga0501072_0544800_133_846 | 236 |
| 245 | 3300049589 | Ga0501073_0000671 | Ga0501073_0000671_12584_13312 | 236 |
| 246 | 3300049589 | Ga0501073_0000671 | Ga0501073_0000671_3486_4199 | 236 |
| 247 | 3300049590 | Ga0501074_0000926 | Ga0501074_0000926_6999_7727 | 236 |
| 248 | 3300049590 | Ga0501074_0300278 | Ga0501074_0300278_296_1009 | 236 |
| 249 | 3300049591 | Ga0501075_0027830 | Ga0501075_0027830_2403_3131 | 236 |
| 250 | 3300049592 | Ga0501076_0318703 | Ga0501076_0318703_393_1106 | 236 |
| 251 | 3300049593 | Ga0501077_0023354 | Ga0501077_0023354_2167_2895 | 236 |
| 252 | 3300049593 | Ga0501077_0214446 | Ga0501077_0214446_461_1174 | 236 |
| 253 | 3300049741 | Ga0501079_0011184 | Ga0501079_0011184_3434_4147 | 236 |
| 254 | 3300049741 | Ga0501079_0013454 | Ga0501079_0013454_3236_3964 | 236 |
| 255 | 3300049742 | Ga0501080_0002630 | Ga0501080_0002630_8209_8937 | 236 |
| 256 | 3300049742 | Ga0501080_0016670 | Ga0501080_0016670_2607_3320 | 236 |
| 257 | 3300049744 | Ga0501083_0059698 | Ga0501083_0059698_510_1238 | 236 |
| 258 | 3300049744 | Ga0501083_0143162 | Ga0501083_0143162_88_801 | 236 |
| 259 | 3300050489 | nmdc:mga03683_112313_c1 | nmdc:mga03683_112313_c1_401_1114 | 236 |
| 260 | 3300050489 | nmdc:mga03683_20740_c1 | nmdc:mga03683_20740_c1_1073_1786 | 236 |
| 261 | 3300050493 | nmdc:mga0k408_137650_c1 | nmdc:mga0k408_137650_c1_529_1242 | 236 |
| 262 | 3300050493 | nmdc:mga0k408_25689_c1 | nmdc:mga0k408_25689_c1_339_1055 | 236 |
| 263 | 3300050494 | nmdc:mga06z11_122085_c1 | nmdc:mga06z11_122085_c1_30_743 | 236 |
| 264 | 3300050511 | nmdc:mga08y16_633237_c1 | nmdc:mga08y16_633237_c1_326_1039 | 236 |
| 265 | 3300050516 | nmdc:mga0sz30_11926_c1 | nmdc:mga0sz30_11926_c1_1082_1798 | 236 |
| 266 | 3300050516 | nmdc:mga0sz30_4626_c1 | nmdc:mga0sz30_4626_c1_2672_3385 | 236 |
| 267 | 3300053077 | Ga0495601_0007858 | Ga0495601_0007858_4314_5027 | 236 |
| 268 | 3300053078 | Ga0495612_0012043 | Ga0495612_0012043_2247_2960 | 236 |
| 269 | 3300053083 | Ga0495655_0049749 | Ga0495655_0049749_122_862 | 236 |
| 270 | 3300053084 | Ga0495595_0017419 | Ga0495595_0017419_372_1085 | 236 |
| 271 | 3300053085 | Ga0495619_0012574 | Ga0495619_0012574_712_1425 | 236 |
| 272 | 3300053088 | Ga0500644_0112384 | Ga0500644_0112384_27_740 | 236 |
| 273 | 3300053140 | Ga0500573_0000022 | Ga0500573_0000022_152522_153238 | 236 |
| 274 | 3300053153 | Ga0500616_0000123 | Ga0500616_0000123_33886_34605 | 236 |
| 275 | 3300053733 | Ga0500552_000397 | Ga0500552_000397_2200_2913 | 236 |
| 276 | 3300054114 | Ga0501084_0010540 | Ga0501084_0010540_3474_4187 | 236 |
| 277 | 3300059421 | Ga0590071_033434 | Ga0590071_033434_95_856 | 236 |
| 278 | 3300059426 | Ga0590077_007651 | Ga0590077_007651_48_809 | 236 |
| 279 | 3300060353 | Ga0501082_0014265 | Ga0501082_0014265_5618_6331 | 236 |
| 280 | 3300060353 | Ga0501082_0014811 | Ga0501082_0014811_2732_3460 | 236 |
| 281 | 3300005262 | Ga0065165_1003945 | Ga0065165_10039454 | 237 |
| 282 | 3300005367 | Ga0070667_100025515 | Ga0070667_1000255151 | 237 |
| 283 | 3300005539 | Ga0068853_100982694 | Ga0068853_1009826941 | 237 |
| 284 | 3300005548 | Ga0070665_100032170 | Ga0070665_1000321702 | 237 |
| 285 | 3300005548 | Ga0070665_100819222 | Ga0070665_1008192222 | 237 |
| 286 | 3300005617 | Ga0068859_100031726 | Ga0068859_1000317263 | 237 |
| 287 | 3300005842 | Ga0068858_100023685 | Ga0068858_1000236853 | 237 |
| 288 | 3300005843 | Ga0068860_100053433 | Ga0068860_1000534332 | 237 |
| 289 | 3300005844 | Ga0068862_100019112 | Ga0068862_1000191125 | 237 |
| 290 | 3300006931 | Ga0097620_100031725 | Ga0097620_1000317253 | 237 |
| 291 | 3300009101 | Ga0105247_10002556 | Ga0105247_1000255610 | 237 |
| 292 | 3300009177 | Ga0105248_11009374 | Ga0105248_110093741 | 237 |
| 293 | 3300025315 | Ga0207697_10125308 | Ga0207697_101253082 | 237 |
| 294 | 3300025900 | Ga0207710_10002920 | Ga0207710_100029206 | 237 |
| 295 | 3300025923 | Ga0207681_10351833 | Ga0207681_103518332 | 237 |
| 296 | 3300028379 | Ga0268266_10002973 | Ga0268266_1000297314 | 237 |
| 297 | 3300028380 | Ga0268265_10033676 | Ga0268265_100336763 | 237 |
| 298 | 3300028381 | Ga0268264_10026990 | Ga0268264_100269904 | 237 |
| 299 | 3300031548 | Ga0307408_100207280 | Ga0307408_1002072802 | 237 |
| 300 | 3300031852 | Ga0307410_10144649 | Ga0307410_101446492 | 237 |
| 301 | 3300031995 | Ga0307409_100080639 | Ga0307409_1000806392 | 237 |
| 302 | 3300032005 | Ga0307411_10074810 | Ga0307411_100748102 | 237 |
| 303 | 3300046460 | Ga0495638_0002975 | Ga0495638_0002975_2828_3547 | 237 |
| 304 | 3300046507 | Ga0495606_0173926 | Ga0495606_0173926_244_969 | 237 |
| 305 | 3300046660 | Ga0495625_0139285 | Ga0495625_0139285_80_799 | 237 |
| 306 | 3300046691 | Ga0495670_0018122 | Ga0495670_0018122_1403_2125 | 237 |
| 307 | 3300047472 | Ga0495686_0221284 | Ga0495686_0221284_235_954 | 237 |
| 308 | 3300048905 | Ga0496102_0029469 | Ga0496102_0029469_3153_3872 | 237 |
| 309 | 3300048922 | Ga0496119_0017268 | Ga0496119_0017268_304_1020 | 237 |
| 310 | 3300048924 | Ga0496121_0002128 | Ga0496121_0002128_18157_18876 | 237 |
| 311 | 3300048924 | Ga0496121_0028474 | Ga0496121_0028474_1752_2468 | 237 |
| 312 | 3300048924 | Ga0496121_0285638 | Ga0496121_0285638_199_915 | 237 |
| 313 | 3300048928 | Ga0496125_0032702 | Ga0496125_0032702_1426_2142 | 237 |
| 314 | 3300049515 | Ga0501292_000003 | Ga0501292_000003_139084_139800 | 237 |
| 315 | 3300049517 | Ga0501294_000294 | Ga0501294_000294_2817_3533 | 237 |
| 316 | 3300049523 | Ga0501300_000197 | Ga0501300_000197_3959_4675 | 237 |
| 317 | 3300049652 | Ga0501202_036608 | Ga0501202_036608_296_1012 | 237 |
| 318 | 3300049653 | Ga0501206_023323 | Ga0501206_023323_38_754 | 237 |
| 319 | 3300049662 | Ga0501222_000197 | Ga0501222_000197_8762_9478 | 237 |
| 320 | 3300049664 | Ga0501224_003301 | Ga0501224_003301_1288_2004 | 237 |
| 321 | 3300049665 | Ga0501227_000365 | Ga0501227_000365_75_791 | 237 |
| 322 | 3300049668 | Ga0501233_002537 | Ga0501233_002537_750_1466 | 237 |
| 323 | 3300049669 | Ga0501235_022492 | Ga0501235_022492_446_1162 | 237 |
| 324 | 3300049670 | Ga0501236_004811 | Ga0501236_004811_791_1507 | 237 |
| 325 | 3300049686 | Ga0501257_020481 | Ga0501257_020481_282_998 | 237 |
| 326 | 3300049688 | Ga0501259_000022 | Ga0501259_000022_1454_2170 | 237 |
| 327 | 3300049690 | Ga0501261_000007 | Ga0501261_000007_22133_22849 | 237 |
| 328 | 3300049704 | Ga0501221_007955 | Ga0501221_007955_536_1252 | 237 |
| 329 | 3300049705 | Ga0501225_0003127 | Ga0501225_0003127_1985_2701 | 237 |
| 330 | 3300049706 | Ga0501229_004563 | Ga0501229_004563_136_852 | 237 |
| 331 | 3300049708 | Ga0501245_000064 | Ga0501245_000064_5429_6145 | 237 |
| 332 | 3300049775 | Ga0501279_000009 | Ga0501279_000009_109956_110672 | 237 |
| 333 | 3300049776 | Ga0501280_000047 | Ga0501280_000047_22528_23244 | 237 |
| 334 | 3300049777 | Ga0501281_00349 | Ga0501281_00349_1129_1845 | 237 |
| 335 | 3300049778 | Ga0501282_000100 | Ga0501282_000100_5153_5869 | 237 |
| 336 | 3300049779 | Ga0501283_000412 | Ga0501283_000412_4477_5193 | 237 |
| 337 | 3300053094 | Ga0500566_0003208 | Ga0500566_0003208_4684_5409 | 237 |
| 338 | 3300053134 | Ga0500658_0010929 | Ga0500658_0010929_993_1712 | 237 |
| 339 | 2162886007 | SwRhRL2b_contig_2489364 | SwRhRL2b_0179.00000770 | 238 |
| 340 | 3300001904 | JGI24736J21556_1000009 | JGI24736J21556_100000935 | 238 |
| 341 | 3300001915 | JGI24741J21665_1006527 | JGI24741J21665_10065274 | 238 |
| 342 | 3300001977 | JGI24746J21847_1013136 | JGI24746J21847_10131361 | 238 |
| 343 | 3300001979 | JGI24740J21852_10014316 | JGI24740J21852_100143162 | 238 |
| 344 | 3300001989 | JGI24739J22299_10008729 | JGI24739J22299_100087295 | 238 |
| 345 | 3300001990 | JGI24737J22298_10003516 | JGI24737J22298_100035164 | 238 |
| 346 | 3300001990 | JGI24737J22298_10023018 | JGI24737J22298_100230183 | 238 |
| 347 | 3300001990 | JGI24737J22298_10027045 | JGI24737J22298_100270452 | 238 |
| 348 | 3300002070 | JGI24750J21931_1006614 | JGI24750J21931_10066142 | 238 |
| 349 | 3300002074 | JGI24748J21848_1000026 | JGI24748J21848_1000026115 | 238 |
| 350 | 3300002075 | JGI24738J21930_10001213 | JGI24738J21930_100012136 | 238 |
| 351 | 3300002076 | JGI24749J21850_1000317 | JGI24749J21850_10003179 | 238 |
| 352 | 3300002239 | JGI24034J26672_10000015 | JGI24034J26672_1000001548 | 238 |
| 353 | 3300002239 | JGI24034J26672_10009293 | JGI24034J26672_100092932 | 238 |
| 354 | 3300002244 | JGI24742J22300_10010745 | JGI24742J22300_100107451 | 238 |
| 355 | 3300003659 | JGI25404J52841_10000309 | JGI25404J52841_100003095 | 238 |
| 356 | 3300005289 | Ga0065704_10101397 | Ga0065704_101013973 | 238 |
| 357 | 3300005289 | Ga0065704_10153660 | Ga0065704_101536602 | 238 |
| 358 | 3300005295 | Ga0065707_10081800 | Ga0065707_1008180021 | 238 |
| 359 | 3300005295 | Ga0065707_10082647 | Ga0065707_100826478 | 238 |
| 360 | 3300005327 | Ga0070658_10019332 | Ga0070658_100193326 | 238 |
| 361 | 3300005329 | Ga0070683_100834785 | Ga0070683_1008347851 | 238 |
| 362 | 3300005330 | Ga0070690_100000025 | Ga0070690_10000002546 | 238 |
| 363 | 3300005333 | Ga0070677_10000102 | Ga0070677_1000010219 | 238 |
| 364 | 3300005335 | Ga0070666_10000015 | Ga0070666_10000015181 | 238 |
| 365 | 3300005338 | Ga0068868_100000162 | Ga0068868_1000001623 | 238 |
| 366 | 3300005338 | Ga0068868_100063449 | Ga0068868_1000634494 | 238 |
| 367 | 3300005338 | Ga0068868_100262021 | Ga0068868_1002620212 | 238 |
| 368 | 3300005339 | Ga0070660_100000258 | Ga0070660_10000025826 | 238 |
| 369 | 3300005340 | Ga0070689_100026195 | Ga0070689_1000261956 | 238 |
| 370 | 3300005344 | Ga0070661_100078990 | Ga0070661_1000789902 | 238 |
| 371 | 3300005347 | Ga0070668_100072852 | Ga0070668_1000728525 | 238 |
| 372 | 3300005347 | Ga0070668_100109463 | Ga0070668_1001094632 | 238 |
| 373 | 3300005347 | Ga0070668_100118867 | Ga0070668_1001188671 | 238 |
| 374 | 3300005353 | Ga0070669_100000059 | Ga0070669_10000005981 | 238 |
| 375 | 3300005354 | Ga0070675_100080959 | Ga0070675_1000809593 | 238 |
| 376 | 3300005354 | Ga0070675_100381273 | Ga0070675_1003812731 | 238 |
| 377 | 3300005355 | Ga0070671_100009469 | Ga0070671_1000094696 | 238 |
| 378 | 3300005355 | Ga0070671_100081004 | Ga0070671_1000810044 | 238 |
| 379 | 3300005355 | Ga0070671_100455515 | Ga0070671_1004555152 | 238 |
| 380 | 3300005365 | Ga0070688_100013459 | Ga0070688_1000134596 | 238 |
| 381 | 3300005365 | Ga0070688_100045193 | Ga0070688_1000451933 | 238 |
| 382 | 3300005366 | Ga0070659_100000022 | Ga0070659_10000002284 | 238 |
| 383 | 3300005366 | Ga0070659_100098281 | Ga0070659_1000982811 | 238 |
| 384 | 3300005367 | Ga0070667_100017737 | Ga0070667_1000177371 | 238 |
| 385 | 3300005441 | Ga0070700_100085949 | Ga0070700_1000859493 | 238 |
| 386 | 3300005455 | Ga0070663_100009775 | Ga0070663_1000097754 | 238 |
| 387 | 3300005456 | Ga0070678_100019428 | Ga0070678_1000194285 | 238 |
| 388 | 3300005456 | Ga0070678_100657701 | Ga0070678_1006577011 | 238 |
| 389 | 3300005457 | Ga0070662_100074410 | Ga0070662_1000744103 | 238 |
| 390 | 3300005457 | Ga0070662_100104860 | Ga0070662_1001048602 | 238 |
| 391 | 3300005457 | Ga0070662_100319550 | Ga0070662_1003195501 | 238 |
| 392 | 3300005466 | Ga0070685_10000247 | Ga0070685_1000024732 | 238 |
| 393 | 3300005535 | Ga0070684_100048210 | Ga0070684_1000482102 | 238 |
| 394 | 3300005539 | Ga0068853_100006432 | Ga0068853_1000064327 | 238 |
| 395 | 3300005543 | Ga0070672_100059603 | Ga0070672_1000596034 | 238 |
| 396 | 3300005543 | Ga0070672_100466143 | Ga0070672_1004661431 | 238 |
| 397 | 3300005544 | Ga0070686_100000006 | Ga0070686_10000000672 | 238 |
| 398 | 3300005544 | Ga0070686_100000071 | Ga0070686_10000007173 | 238 |
| 399 | 3300005544 | Ga0070686_100100933 | Ga0070686_1001009332 | 238 |
| 400 | 3300005548 | Ga0070665_100000217 | Ga0070665_10000021767 | 238 |
| 401 | 3300005548 | Ga0070665_100003467 | Ga0070665_1000034676 | 238 |
| 402 | 3300005548 | Ga0070665_100056643 | Ga0070665_1000566433 | 238 |
| 403 | 3300005548 | Ga0070665_100060021 | Ga0070665_1000600211 | 238 |
| 404 | 3300005549 | Ga0070704_100405218 | Ga0070704_1004052181 | 238 |
| 405 | 3300005564 | Ga0070664_100108890 | Ga0070664_1001088903 | 238 |
| 406 | 3300005564 | Ga0070664_100267134 | Ga0070664_1002671341 | 238 |
| 407 | 3300005577 | Ga0068857_100080184 | Ga0068857_1000801841 | 238 |
| 408 | 3300005577 | Ga0068857_100208552 | Ga0068857_1002085522 | 238 |
| 409 | 3300005614 | Ga0068856_100169667 | Ga0068856_1001696673 | 238 |
| 410 | 3300005614 | Ga0068856_100279622 | Ga0068856_1002796222 | 238 |
| 411 | 3300005616 | Ga0068852_100026293 | Ga0068852_1000262933 | 238 |
| 412 | 3300005617 | Ga0068859_100000937 | Ga0068859_1000009376 | 238 |
| 413 | 3300005617 | Ga0068859_100532863 | Ga0068859_1005328632 | 238 |
| 414 | 3300005617 | Ga0068859_100575925 | Ga0068859_1005759252 | 238 |
| 415 | 3300005618 | Ga0068864_100009352 | Ga0068864_1000093527 | 238 |
| 416 | 3300005618 | Ga0068864_100017721 | Ga0068864_1000177216 | 238 |
| 417 | 3300005718 | Ga0068866_10266255 | Ga0068866_102662551 | 238 |
| 418 | 3300005719 | Ga0068861_100006465 | Ga0068861_1000064656 | 238 |
| 419 | 3300005834 | Ga0068851_10072312 | Ga0068851_100723122 | 238 |
| 420 | 3300005841 | Ga0068863_100000108 | Ga0068863_10000010854 | 238 |
| 421 | 3300005841 | Ga0068863_100001030 | Ga0068863_10000103025 | 238 |
| 422 | 3300005841 | Ga0068863_100045028 | Ga0068863_1000450283 | 238 |
| 423 | 3300005842 | Ga0068858_100002534 | Ga0068858_1000025347 | 238 |
| 424 | 3300005842 | Ga0068858_100061649 | Ga0068858_1000616494 | 238 |
| 425 | 3300005842 | Ga0068858_100103238 | Ga0068858_1001032383 | 238 |
| 426 | 3300005843 | Ga0068860_100000050 | Ga0068860_100000050182 | 238 |
| 427 | 3300005843 | Ga0068860_100000554 | Ga0068860_10000055410 | 238 |
| 428 | 3300005843 | Ga0068860_100031734 | Ga0068860_1000317344 | 238 |
| 429 | 3300005844 | Ga0068862_100000062 | Ga0068862_10000006247 | 238 |
| 430 | 3300005937 | Ga0081455_10000097 | Ga0081455_1000009719 | 238 |
| 431 | 3300005983 | Ga0081540_1000022 | Ga0081540_1000022101 | 238 |
| 432 | 3300006042 | Ga0075368_10149628 | Ga0075368_101496281 | 238 |
| 433 | 3300006051 | Ga0075364_10167736 | Ga0075364_101677362 | 238 |
| 434 | 3300006051 | Ga0075364_10191021 | Ga0075364_101910212 | 238 |
| 435 | 3300006177 | Ga0075362_10004105 | Ga0075362_100041052 | 238 |
| 436 | 3300006177 | Ga0075362_10155918 | Ga0075362_101559181 | 238 |
| 437 | 3300006178 | Ga0075367_10015975 | Ga0075367_100159755 | 238 |
| 438 | 3300006186 | Ga0075369_10002148 | Ga0075369_100021482 | 238 |
| 439 | 3300006195 | Ga0075366_10003581 | Ga0075366_100035814 | 238 |
| 440 | 3300006844 | Ga0075428_100091137 | Ga0075428_1000911374 | 238 |
| 441 | 3300006844 | Ga0075428_100206495 | Ga0075428_1002064953 | 238 |
| 442 | 3300006846 | Ga0075430_100007463 | Ga0075430_10000746311 | 238 |
| 443 | 3300006847 | Ga0075431_100042139 | Ga0075431_1000421394 | 238 |
| 444 | 3300006852 | Ga0075433_10000419 | Ga0075433_1000041915 | 238 |
| 445 | 3300006871 | Ga0075434_100030445 | Ga0075434_1000304452 | 238 |
| 446 | 3300006871 | Ga0075434_100120245 | Ga0075434_1001202454 | 238 |
| 447 | 3300006881 | Ga0068865_100093229 | Ga0068865_1000932293 | 238 |
| 448 | 3300006931 | Ga0097620_100000937 | Ga0097620_10000093732 | 238 |
| 449 | 3300006931 | Ga0097620_100532981 | Ga0097620_1005329812 | 238 |
| 450 | 3300006931 | Ga0097620_100575915 | Ga0097620_1005759152 | 238 |
| 451 | 3300007076 | Ga0075435_100026131 | Ga0075435_1000261312 | 238 |
| 452 | 3300009094 | Ga0111539_10004649 | Ga0111539_1000464911 | 238 |
| 453 | 3300009094 | Ga0111539_10094756 | Ga0111539_100947562 | 238 |
| 454 | 3300009098 | Ga0105245_10019787 | Ga0105245_100197876 | 238 |
| 455 | 3300009098 | Ga0105245_10423399 | Ga0105245_104233992 | 238 |
| 456 | 3300009101 | Ga0105247_10035281 | Ga0105247_100352815 | 238 |
| 457 | 3300009147 | Ga0114129_10271306 | Ga0114129_102713062 | 238 |
| 458 | 3300009148 | Ga0105243_10259015 | Ga0105243_102590153 | 238 |
| 459 | 3300009176 | Ga0105242_10252125 | Ga0105242_102521252 | 238 |
| 460 | 3300009177 | Ga0105248_10021965 | Ga0105248_100219652 | 238 |
| 461 | 3300009177 | Ga0105248_10141927 | Ga0105248_101419272 | 238 |
| 462 | 3300009545 | Ga0105237_10612819 | Ga0105237_106128192 | 238 |
| 463 | 3300009551 | Ga0105238_10082901 | Ga0105238_100829015 | 238 |
| 464 | 3300009551 | Ga0105238_10149933 | Ga0105238_101499332 | 238 |
| 465 | 3300009551 | Ga0105238_10180155 | Ga0105238_101801552 | 238 |
| 466 | 3300009553 | Ga0105249_10000034 | Ga0105249_1000003445 | 238 |
| 467 | 3300009553 | Ga0105249_10219888 | Ga0105249_102198883 | 238 |
| 468 | 3300010375 | Ga0105239_10002028 | Ga0105239_100020282 | 238 |
| 469 | 3300010375 | Ga0105239_10494856 | Ga0105239_104948562 | 238 |
| 470 | 3300010375 | Ga0105239_10606825 | Ga0105239_106068252 | 238 |
| 471 | 3300011119 | Ga0105246_10389494 | Ga0105246_103894942 | 238 |
| 472 | 3300013100 | Ga0157373_10026314 | Ga0157373_100263145 | 238 |
| 473 | 3300013104 | Ga0157370_10075929 | Ga0157370_100759294 | 238 |
| 474 | 3300013104 | Ga0157370_10330166 | Ga0157370_103301661 | 238 |
| 475 | 3300013105 | Ga0157369_10085137 | Ga0157369_100851373 | 238 |
| 476 | 3300013296 | Ga0157374_10168565 | Ga0157374_101685653 | 238 |
| 477 | 3300013296 | Ga0157374_11221556 | Ga0157374_112215561 | 238 |
| 478 | 3300013306 | Ga0163162_10046132 | Ga0163162_100461324 | 238 |
| 479 | 3300013306 | Ga0163162_10106873 | Ga0163162_101068732 | 238 |
| 480 | 3300013306 | Ga0163162_10109407 | Ga0163162_101094071 | 238 |
| 481 | 3300013307 | Ga0157372_10305352 | Ga0157372_103053522 | 238 |
| 482 | 3300014325 | Ga0163163_10041149 | Ga0163163_100411496 | 238 |
| 483 | 3300014326 | Ga0157380_10000231 | Ga0157380_1000023114 | 238 |
| 484 | 3300014326 | Ga0157380_10000478 | Ga0157380_1000047817 | 238 |
| 485 | 3300014326 | Ga0157380_10011127 | Ga0157380_100111274 | 238 |
| 486 | 3300014326 | Ga0157380_10077239 | Ga0157380_100772394 | 238 |
| 487 | 3300014326 | Ga0157380_10288088 | Ga0157380_102880882 | 238 |
| 488 | 3300014745 | Ga0157377_10035540 | Ga0157377_100355402 | 238 |
| 489 | 3300014745 | Ga0157377_10151118 | Ga0157377_101511182 | 238 |
| 490 | 3300014968 | Ga0157379_10005954 | Ga0157379_100059546 | 238 |
| 491 | 3300014968 | Ga0157379_10145306 | Ga0157379_101453063 | 238 |
| 492 | 3300014969 | Ga0157376_10361570 | Ga0157376_103615702 | 238 |
| 493 | 3300017792 | Ga0163161_10000051 | Ga0163161_10000051107 | 238 |
| 494 | 3300017792 | Ga0163161_10566226 | Ga0163161_105662261 | 238 |
| 495 | 3300020069 | Ga0197907_10309105 | Ga0197907_103091053 | 238 |
| 496 | 3300021384 | Ga0213876_10016920 | Ga0213876_100169203 | 238 |
| 497 | 3300025223 | Ga0207672_1000434 | Ga0207672_10004348 | 238 |
| 498 | 3300025302 | Ga0207426_1038778 | Ga0207426_10387782 | 238 |
| 499 | 3300025304 | Ga0209257_1002163 | Ga0209257_10021639 | 238 |
| 500 | 3300025304 | Ga0209257_1030993 | Ga0209257_10309933 | 238 |
| 501 | 3300025321 | Ga0207656_10028118 | Ga0207656_100281182 | 238 |
| 502 | 3300025893 | Ga0207682_10000779 | Ga0207682_100007793 | 238 |
| 503 | 3300025899 | Ga0207642_10040935 | Ga0207642_100409353 | 238 |
| 504 | 3300025900 | Ga0207710_10005791 | Ga0207710_100057913 | 238 |
| 505 | 3300025903 | Ga0207680_10000007 | Ga0207680_10000007449 | 238 |
| 506 | 3300025904 | Ga0207647_10001146 | Ga0207647_1000114621 | 238 |
| 507 | 3300025908 | Ga0207643_10003813 | Ga0207643_100038134 | 238 |
| 508 | 3300025909 | Ga0207705_10022866 | Ga0207705_100228665 | 238 |
| 509 | 3300025911 | Ga0207654_10001455 | Ga0207654_100014555 | 238 |
| 510 | 3300025913 | Ga0207695_10004741 | Ga0207695_1000474121 | 238 |
| 511 | 3300025913 | Ga0207695_10042299 | Ga0207695_100422996 | 238 |
| 512 | 3300025914 | Ga0207671_10000658 | Ga0207671_1000065823 | 238 |
| 513 | 3300025916 | Ga0207663_10388710 | Ga0207663_103887101 | 238 |
| 514 | 3300025919 | Ga0207657_10003941 | Ga0207657_100039415 | 238 |
| 515 | 3300025919 | Ga0207657_10222114 | Ga0207657_102221142 | 238 |
| 516 | 3300025920 | Ga0207649_10077647 | Ga0207649_100776471 | 238 |
| 517 | 3300025923 | Ga0207681_10000089 | Ga0207681_1000008957 | 238 |
| 518 | 3300025924 | Ga0207694_10008129 | Ga0207694_100081294 | 238 |
| 519 | 3300025924 | Ga0207694_10042769 | Ga0207694_100427692 | 238 |
| 520 | 3300025924 | Ga0207694_10136643 | Ga0207694_101366433 | 238 |
| 521 | 3300025925 | Ga0207650_10101038 | Ga0207650_101010383 | 238 |
| 522 | 3300025925 | Ga0207650_10126101 | Ga0207650_101261012 | 238 |
| 523 | 3300025926 | Ga0207659_10186061 | Ga0207659_101860612 | 238 |
| 524 | 3300025927 | Ga0207687_10307529 | Ga0207687_103075292 | 238 |
| 525 | 3300025931 | Ga0207644_10004047 | Ga0207644_100040477 | 238 |
| 526 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003729 | 238 |
| 527 | 3300025932 | Ga0207690_10250315 | Ga0207690_102503151 | 238 |
| 528 | 3300025933 | Ga0207706_10012563 | Ga0207706_100125637 | 238 |
| 529 | 3300025933 | Ga0207706_10074552 | Ga0207706_100745522 | 238 |
| 530 | 3300025934 | Ga0207686_10412145 | Ga0207686_104121452 | 238 |
| 531 | 3300025934 | Ga0207686_10582591 | Ga0207686_105825911 | 238 |
| 532 | 3300025936 | Ga0207670_10022662 | Ga0207670_100226622 | 238 |
| 533 | 3300025937 | Ga0207669_10014205 | Ga0207669_100142054 | 238 |
| 534 | 3300025940 | Ga0207691_10030460 | Ga0207691_100304605 | 238 |
| 535 | 3300025940 | Ga0207691_10328122 | Ga0207691_103281222 | 238 |
| 536 | 3300025941 | Ga0207711_10002957 | Ga0207711_1000295719 | 238 |
| 537 | 3300025941 | Ga0207711_10021097 | Ga0207711_100210976 | 238 |
| 538 | 3300025941 | Ga0207711_10204548 | Ga0207711_102045482 | 238 |
| 539 | 3300025942 | Ga0207689_10031380 | Ga0207689_100313804 | 238 |
| 540 | 3300025944 | Ga0207661_10120168 | Ga0207661_101201682 | 238 |
| 541 | 3300025944 | Ga0207661_10305856 | Ga0207661_103058563 | 238 |
| 542 | 3300025945 | Ga0207679_10081988 | Ga0207679_100819884 | 238 |
| 543 | 3300025949 | Ga0207667_10046245 | Ga0207667_100462455 | 238 |
| 544 | 3300025949 | Ga0207667_10696873 | Ga0207667_106968731 | 238 |
| 545 | 3300025961 | Ga0207712_10000004 | Ga0207712_10000004437 | 238 |
| 546 | 3300025961 | Ga0207712_10084392 | Ga0207712_100843921 | 238 |
| 547 | 3300025961 | Ga0207712_10564608 | Ga0207712_105646082 | 238 |
| 548 | 3300025972 | Ga0207668_10030478 | Ga0207668_100304783 | 238 |
| 549 | 3300025972 | Ga0207668_10196665 | Ga0207668_101966653 | 238 |
| 550 | 3300025972 | Ga0207668_10298540 | Ga0207668_102985401 | 238 |
| 551 | 3300025981 | Ga0207640_10203787 | Ga0207640_102037872 | 238 |
| 552 | 3300025981 | Ga0207640_10229261 | Ga0207640_102292612 | 238 |
| 553 | 3300025986 | Ga0207658_10002005 | Ga0207658_100020056 | 238 |
| 554 | 3300026023 | Ga0207677_10000154 | Ga0207677_100001544 | 238 |
| 555 | 3300026023 | Ga0207677_10489542 | Ga0207677_104895421 | 238 |
| 556 | 3300026035 | Ga0207703_10001286 | Ga0207703_1000128613 | 238 |
| 557 | 3300026035 | Ga0207703_10006943 | Ga0207703_100069433 | 238 |
| 558 | 3300026035 | Ga0207703_10381902 | Ga0207703_103819022 | 238 |
| 559 | 3300026041 | Ga0207639_10003651 | Ga0207639_100036514 | 238 |
| 560 | 3300026041 | Ga0207639_10227605 | Ga0207639_102276052 | 238 |
| 561 | 3300026041 | Ga0207639_10332244 | Ga0207639_103322441 | 238 |
| 562 | 3300026067 | Ga0207678_10023624 | Ga0207678_100236245 | 238 |
| 563 | 3300026067 | Ga0207678_10169135 | Ga0207678_101691352 | 238 |
| 564 | 3300026075 | Ga0207708_10060007 | Ga0207708_100600071 | 238 |
| 565 | 3300026078 | Ga0207702_10001915 | Ga0207702_1000191519 | 238 |
| 566 | 3300026088 | Ga0207641_10000209 | Ga0207641_1000020935 | 238 |
| 567 | 3300026088 | Ga0207641_10000428 | Ga0207641_100004287 | 238 |
| 568 | 3300026088 | Ga0207641_10038679 | Ga0207641_100386792 | 238 |
| 569 | 3300026088 | Ga0207641_10050427 | Ga0207641_100504276 | 238 |
| 570 | 3300026088 | Ga0207641_10521385 | Ga0207641_105213852 | 238 |
| 571 | 3300026089 | Ga0207648_10029171 | Ga0207648_100291713 | 238 |
| 572 | 3300026095 | Ga0207676_10001679 | Ga0207676_100016796 | 238 |
| 573 | 3300026095 | Ga0207676_10079562 | Ga0207676_100795623 | 238 |
| 574 | 3300026116 | Ga0207674_10007684 | Ga0207674_100076847 | 238 |
| 575 | 3300026116 | Ga0207674_10032587 | Ga0207674_100325874 | 238 |
| 576 | 3300026118 | Ga0207675_100000449 | Ga0207675_10000044916 | 238 |
| 577 | 3300026118 | Ga0207675_100016886 | Ga0207675_1000168864 | 238 |
| 578 | 3300026121 | Ga0207683_10036842 | Ga0207683_100368424 | 238 |
| 579 | 3300026142 | Ga0207698_10019699 | Ga0207698_100196995 | 238 |
| 580 | 3300026142 | Ga0207698_10283261 | Ga0207698_102832612 | 238 |
| 581 | 3300027866 | Ga0209813_10045803 | Ga0209813_100458031 | 238 |
| 582 | 3300027907 | Ga0207428_10030363 | Ga0207428_100303634 | 238 |
| 583 | 3300028379 | Ga0268266_10000225 | Ga0268266_1000022546 | 238 |
| 584 | 3300028379 | Ga0268266_10009750 | Ga0268266_100097505 | 238 |
| 585 | 3300028379 | Ga0268266_10138729 | Ga0268266_101387293 | 238 |
| 586 | 3300028379 | Ga0268266_10282084 | Ga0268266_102820842 | 238 |
| 587 | 3300028380 | Ga0268265_10000086 | Ga0268265_1000008697 | 238 |
| 588 | 3300028380 | Ga0268265_10936629 | Ga0268265_109366291 | 238 |
| 589 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003451 | 238 |
| 590 | 3300028381 | Ga0268264_10000044 | Ga0268264_10000044264 | 238 |
| 591 | 3300028381 | Ga0268264_11190785 | Ga0268264_111907851 | 238 |
| 592 | 3300030521 | Ga0307511_10013450 | Ga0307511_100134505 | 238 |
| 593 | 3300031507 | Ga0307509_10000016 | Ga0307509_10000016103 | 238 |
| 594 | 3300031548 | Ga0307408_100157720 | Ga0307408_1001577202 | 238 |
| 595 | 3300031548 | Ga0307408_100668982 | Ga0307408_1006689821 | 238 |
| 596 | 3300031616 | Ga0307508_10202239 | Ga0307508_102022391 | 238 |
| 597 | 3300031731 | Ga0307405_10079796 | Ga0307405_100797964 | 238 |
| 598 | 3300031731 | Ga0307405_10417888 | Ga0307405_104178882 | 238 |
| 599 | 3300031824 | Ga0307413_10202997 | Ga0307413_102029971 | 238 |
| 600 | 3300031852 | Ga0307410_10066439 | Ga0307410_100664392 | 238 |
| 601 | 3300031901 | Ga0307406_10031941 | Ga0307406_100319414 | 238 |
| 602 | 3300031901 | Ga0307406_10062785 | Ga0307406_100627851 | 238 |
| 603 | 3300031901 | Ga0307406_10205315 | Ga0307406_102053152 | 238 |
| 604 | 3300031911 | Ga0307412_10046548 | Ga0307412_100465482 | 238 |
| 605 | 3300031911 | Ga0307412_10189750 | Ga0307412_101897502 | 238 |
| 606 | 3300031995 | Ga0307409_100332116 | Ga0307409_1003321162 | 238 |
| 607 | 3300031995 | Ga0307409_101227144 | Ga0307409_1012271441 | 238 |
| 608 | 3300032004 | Ga0307414_10000607 | Ga0307414_100006079 | 238 |
| 609 | 3300032004 | Ga0307414_10030871 | Ga0307414_100308711 | 238 |
| 610 | 3300032004 | Ga0307414_10045555 | Ga0307414_100455551 | 238 |
| 611 | 3300032004 | Ga0307414_10580403 | Ga0307414_105804031 | 238 |
| 612 | 3300032005 | Ga0307411_10120380 | Ga0307411_101203802 | 238 |
| 613 | 3300032005 | Ga0307411_10313672 | Ga0307411_103136722 | 238 |
| 614 | 3300032126 | Ga0307415_100031322 | Ga0307415_1000313225 | 238 |
| 615 | 3300032126 | Ga0307415_100213342 | Ga0307415_1002133422 | 238 |
| 616 | 3300035171 | Ga0373946_0005530 | Ga0373946_0005530_3286_4005 | 238 |
| 617 | 3300035172 | Ga0373955_0340095 | Ga0373955_0340095_141_860 | 238 |
| 618 | 3300035242 | Ga0373962_0033882 | Ga0373962_0033882_573_1292 | 238 |
| 619 | 3300035725 | Ga0373947_0082426 | Ga0373947_0082426_1160_1948 | 238 |
| 620 | 3300037068 | Ga0373925_0077146 | Ga0373925_0077146_503_1222 | 238 |
| 621 | 3300038705 | Ga0237819_01311 | Ga0237819_01311_2505_3224 | 238 |
| 622 | 3300039437 | Ga0436365_0211517 | Ga0436365_0211517_2460_3185 | 238 |
| 623 | 3300042122 | Ga0450920_002276 | Ga0450920_002276_2427_3149 | 238 |
| 624 | 3300042125 | Ga0450923_012749 | Ga0450923_012749_506_1228 | 238 |
| 625 | 3300042131 | Ga0450894_002291 | Ga0450894_002291_1635_2357 | 238 |
| 626 | 3300042132 | Ga0450895_003276 | Ga0450895_003276_81_803 | 238 |
| 627 | 3300042145 | Ga0450906_032253 | Ga0450906_032253_175_897 | 238 |
| 628 | 3300042147 | Ga0450910_014943 | Ga0450910_014943_96_815 | 238 |
| 629 | 3300042156 | Ga0439446_0003219 | Ga0439446_0003219_1995_2714 | 238 |
| 630 | 3300042531 | Ga0450918_007305 | Ga0450918_007305_976_1698 | 238 |
| 631 | 3300046452 | Ga0495617_063441 | Ga0495617_063441_191_910 | 238 |
| 632 | 3300046457 | Ga0495590_0124134 | Ga0495590_0124134_118_906 | 238 |
| 633 | 3300046461 | Ga0495641_0043345 | Ga0495641_0043345_185_904 | 238 |
| 634 | 3300046473 | Ga0495582_0017692 | Ga0495582_0017692_30_818 | 238 |
| 635 | 3300046475 | Ga0495639_0095079 | Ga0495639_0095079_101_820 | 238 |
| 636 | 3300046491 | Ga0495584_0205700 | Ga0495584_0205700_110_829 | 238 |
| 637 | 3300046492 | Ga0495585_0129286 | Ga0495585_0129286_88_876 | 238 |
| 638 | 3300046501 | Ga0495607_0171300 | Ga0495607_0171300_64_852 | 238 |
| 639 | 3300046507 | Ga0495606_0329864 | Ga0495606_0329864_53_772 | 238 |
| 640 | 3300046515 | Ga0495620_0040613 | Ga0495620_0040613_27_815 | 238 |
| 641 | 3300046516 | Ga0495628_0110486 | Ga0495628_0110486_16_735 | 238 |
| 642 | 3300046518 | Ga0495631_0121153 | Ga0495631_0121153_95_814 | 238 |
| 643 | 3300046526 | Ga0495666_0114793 | Ga0495666_0114793_408_1196 | 238 |
| 644 | 3300046539 | Ga0495621_0020218 | Ga0495621_0020218_42_761 | 238 |
| 645 | 3300046559 | Ga0495667_0278014 | Ga0495667_0278014_93_812 | 238 |
| 646 | 3300046648 | Ga0495611_0267748 | Ga0495611_0267748_18_737 | 238 |
| 647 | 3300046663 | Ga0495635_0415215 | Ga0495635_0415215_137_856 | 238 |
| 648 | 3300046664 | Ga0495659_0074038 | Ga0495659_0074038_534_1253 | 238 |
| 649 | 3300046665 | Ga0495661_0123239 | Ga0495661_0123239_562_1281 | 238 |
| 650 | 3300046689 | Ga0495613_0042320 | Ga0495613_0042320_257_976 | 238 |
| 651 | 3300046689 | Ga0495613_0190358 | Ga0495613_0190358_165_884 | 238 |
| 652 | 3300046694 | Ga0495649_0148309 | Ga0495649_0148309_440_1159 | 238 |
| 653 | 3300047315 | Ga0495581_0309379 | Ga0495581_0309379_17_805 | 238 |
| 654 | 3300047471 | Ga0495684_0093022 | Ga0495684_0093022_201_989 | 238 |
| 655 | 3300047673 | Ga0495593_0101065 | Ga0495593_0101065_636_1355 | 238 |
| 656 | 3300048090 | Ga0495615_0052262 | Ga0495615_0052262_49_837 | 238 |
| 657 | 3300048091 | Ga0495626_0119582 | Ga0495626_0119582_405_1124 | 238 |
| 658 | 3300048904 | Ga0496101_0168156 | Ga0496101_0168156_269_988 | 238 |
| 659 | 3300048904 | Ga0496101_0567664 | Ga0496101_0567664_160_879 | 238 |
| 660 | 3300048905 | Ga0496102_0035433 | Ga0496102_0035433_209_928 | 238 |
| 661 | 3300048905 | Ga0496102_0065734 | Ga0496102_0065734_2259_2978 | 238 |
| 662 | 3300048905 | Ga0496102_0158320 | Ga0496102_0158320_212_931 | 238 |
| 663 | 3300048906 | Ga0496103_0007410 | Ga0496103_0007410_4089_4808 | 238 |
| 664 | 3300048906 | Ga0496103_0015627 | Ga0496103_0015627_3536_4255 | 238 |
| 665 | 3300048907 | Ga0496104_0044921 | Ga0496104_0044921_2272_2991 | 238 |
| 666 | 3300048907 | Ga0496104_0113736 | Ga0496104_0113736_1668_2387 | 238 |
| 667 | 3300048907 | Ga0496104_0212088 | Ga0496104_0212088_930_1649 | 238 |
| 668 | 3300048908 | Ga0496105_0025731 | Ga0496105_0025731_2834_3553 | 238 |
| 669 | 3300048908 | Ga0496105_0137340 | Ga0496105_0137340_1102_1821 | 238 |
| 670 | 3300048909 | Ga0496106_0033684 | Ga0496106_0033684_1657_2376 | 238 |
| 671 | 3300048909 | Ga0496106_0036115 | Ga0496106_0036115_2916_3635 | 238 |
| 672 | 3300048910 | Ga0496107_0056984 | Ga0496107_0056984_238_957 | 238 |
| 673 | 3300048910 | Ga0496107_0469089 | Ga0496107_0469089_19_738 | 238 |
| 674 | 3300048911 | Ga0496108_0008694 | Ga0496108_0008694_3534_4253 | 238 |
| 675 | 3300048911 | Ga0496108_0028422 | Ga0496108_0028422_336_1055 | 238 |
| 676 | 3300048912 | Ga0496109_0014437 | Ga0496109_0014437_5297_6016 | 238 |
| 677 | 3300048912 | Ga0496109_0015956 | Ga0496109_0015956_1856_2575 | 238 |
| 678 | 3300048913 | Ga0496110_0015800 | Ga0496110_0015800_3982_4701 | 238 |
| 679 | 3300048913 | Ga0496110_0096335 | Ga0496110_0096335_1772_2491 | 238 |
| 680 | 3300048914 | Ga0496111_0008197 | Ga0496111_0008197_1204_1923 | 238 |
| 681 | 3300048914 | Ga0496111_0038006 | Ga0496111_0038006_2609_3328 | 238 |
| 682 | 3300048914 | Ga0496111_0054703 | Ga0496111_0054703_21_740 | 238 |
| 683 | 3300048915 | Ga0496112_0002369 | Ga0496112_0002369_3987_4706 | 238 |
| 684 | 3300048915 | Ga0496112_0122707 | Ga0496112_0122707_1641_2360 | 238 |
| 685 | 3300048916 | Ga0496113_0003688 | Ga0496113_0003688_3968_4687 | 238 |
| 686 | 3300048916 | Ga0496113_0037136 | Ga0496113_0037136_1197_1916 | 238 |
| 687 | 3300048917 | Ga0496114_0013568 | Ga0496114_0013568_3564_4283 | 238 |
| 688 | 3300048918 | Ga0496115_0024390 | Ga0496115_0024390_238_957 | 238 |
| 689 | 3300048920 | Ga0496117_0000067 | Ga0496117_0000067_102471_103190 | 238 |
| 690 | 3300048920 | Ga0496117_0038265 | Ga0496117_0038265_1986_2705 | 238 |
| 691 | 3300048921 | Ga0496118_0000021 | Ga0496118_0000021_228563_229282 | 238 |
| 692 | 3300048922 | Ga0496119_0000323 | Ga0496119_0000323_36368_37087 | 238 |
| 693 | 3300048922 | Ga0496119_0280868 | Ga0496119_0280868_41_760 | 238 |
| 694 | 3300048923 | Ga0496120_0000042 | Ga0496120_0000042_140764_141483 | 238 |
| 695 | 3300048923 | Ga0496120_0019318 | Ga0496120_0019318_474_1193 | 238 |
| 696 | 3300048924 | Ga0496121_0031827 | Ga0496121_0031827_237_956 | 238 |
| 697 | 3300048927 | Ga0496124_0377854 | Ga0496124_0377854_149_868 | 238 |
| 698 | 3300048928 | Ga0496125_0000533 | Ga0496125_0000533_21828_22547 | 238 |
| 699 | 3300048929 | Ga0496126_0041273 | Ga0496126_0041273_2520_3239 | 238 |
| 700 | 3300049568 | Ga0501031_0296295 | Ga0501031_0296295_75_794 | 238 |
| 701 | 3300049569 | Ga0501032_0053949 | Ga0501032_0053949_1096_1815 | 238 |
| 702 | 3300049570 | Ga0501033_0047333 | Ga0501033_0047333_220_939 | 238 |
| 703 | 3300049571 | Ga0501034_0252078 | Ga0501034_0252078_332_1051 | 238 |
| 704 | 3300049572 | Ga0501036_0011042 | Ga0501036_0011042_920_1639 | 238 |
| 705 | 3300049573 | Ga0501037_0088088 | Ga0501037_0088088_237_959 | 238 |
| 706 | 3300049574 | Ga0501038_0085233 | Ga0501038_0085233_794_1513 | 238 |
| 707 | 3300049575 | Ga0501039_0038875 | Ga0501039_0038875_2453_3172 | 238 |
| 708 | 3300049575 | Ga0501039_0197728 | Ga0501039_0197728_840_1559 | 238 |
| 709 | 3300049579 | Ga0501043_0016353 | Ga0501043_0016353_3579_4298 | 238 |
| 710 | 3300049579 | Ga0501043_0207250 | Ga0501043_0207250_402_1124 | 238 |
| 711 | 3300049580 | Ga0501046_0151101 | Ga0501046_0151101_818_1537 | 238 |
| 712 | 3300049581 | Ga0501047_0161069 | Ga0501047_0161069_1166_1885 | 238 |
| 713 | 3300049582 | Ga0501048_0610296 | Ga0501048_0610296_21_740 | 238 |
| 714 | 3300049584 | Ga0501068_0082502 | Ga0501068_0082502_39_758 | 238 |
| 715 | 3300049587 | Ga0501071_0381232 | Ga0501071_0381232_202_921 | 238 |
| 716 | 3300049591 | Ga0501075_0165224 | Ga0501075_0165224_613_1332 | 238 |
| 717 | 3300049591 | Ga0501075_0392160 | Ga0501075_0392160_25_744 | 238 |
| 718 | 3300049592 | Ga0501076_0173241 | Ga0501076_0173241_675_1394 | 238 |
| 719 | 3300049592 | Ga0501076_0192599 | Ga0501076_0192599_449_1168 | 238 |
| 720 | 3300049592 | Ga0501076_0580676 | Ga0501076_0580676_129_848 | 238 |
| 721 | 3300049741 | Ga0501079_0262476 | Ga0501079_0262476_261_980 | 238 |
| 722 | 3300049742 | Ga0501080_0374316 | Ga0501080_0374316_321_1040 | 238 |
| 723 | 3300049822 | Ga0501035_0071455 | Ga0501035_0071455_446_1165 | 238 |
| 724 | 3300049823 | Ga0501044_0015007 | Ga0501044_0015007_3613_4332 | 238 |
| 725 | 3300050489 | nmdc:mga03683_3715_c1 | nmdc:mga03683_3715_c1_4130_4849 | 238 |
| 726 | 3300050489 | nmdc:mga03683_90072_c1 | nmdc:mga03683_90072_c1_457_1176 | 238 |
| 727 | 3300050493 | nmdc:mga0k408_6102_c1 | nmdc:mga0k408_6102_c1_4123_4842 | 238 |
| 728 | 3300050496 | nmdc:mga07m45_14207_c1 | nmdc:mga07m45_14207_c1_2334_3053 | 238 |
| 729 | 3300050507 | nmdc:mga05p37_209805_c1 | nmdc:mga05p37_209805_c1_893_1612 | 238 |
| 730 | 3300050508 | nmdc:mga09592_128621_c1 | nmdc:mga09592_128621_c1_1447_2166 | 238 |
| 731 | 3300050509 | nmdc:mga0qj67_18511_c1 | nmdc:mga0qj67_18511_c1_446_1165 | 238 |
| 732 | 3300050510 | nmdc:mga06r32_12838_c1 | nmdc:mga06r32_12838_c1_2388_3107 | 238 |
| 733 | 3300050511 | nmdc:mga08y16_19864_c1 | nmdc:mga08y16_19864_c1_2479_3198 | 238 |
| 734 | 3300050511 | nmdc:mga08y16_465329_c1 | nmdc:mga08y16_465329_c1_298_1017 | 238 |
| 735 | 3300050512 | nmdc:mga0n895_7477_c1 | nmdc:mga0n895_7477_c1_242_970 | 238 |
| 736 | 3300050513 | nmdc:mga0rr50_6155_c1 | nmdc:mga0rr50_6155_c1_5061_5780 | 238 |
| 737 | 3300050515 | nmdc:mga0a205_2164_c1 | nmdc:mga0a205_2164_c1_2928_3647 | 238 |
| 738 | 3300050516 | nmdc:mga0sz30_531_c2 | nmdc:mga0sz30_531_c2_4117_4836 | 238 |
| 739 | 3300053087 | Ga0500643_000475 | Ga0500643_000475_3425_4144 | 238 |
| 740 | 3300053087 | Ga0500643_015447 | Ga0500643_015447_615_1334 | 238 |
| 741 | 3300053087 | Ga0500643_023162 | Ga0500643_023162_1242_1961 | 238 |
| 742 | 3300053116 | Ga0500592_000558 | Ga0500592_000558_3237_3962 | 238 |
| 743 | 3300053139 | Ga0500568_0044871 | Ga0500568_0044871_253_972 | 238 |
| 744 | 3300053151 | Ga0500604_0008236 | Ga0500604_0008236_1004_1729 | 238 |
| 745 | 3300053158 | Ga0500627_0055583 | Ga0500627_0055583_475_1194 | 238 |
| 746 | 3300053178 | Ga0500637_0057396 | Ga0500637_0057396_1392_2111 | 238 |
| 747 | 3300053727 | Ga0500611_021686 | Ga0500611_021686_294_1019 | 238 |
| 748 | 3300060353 | Ga0501082_0540016 | Ga0501082_0540016_185_943 | 238 |
| 749 | 3300006042 | Ga0075368_10000156 | Ga0075368_100001568 | 239 |
| 750 | 3300006051 | Ga0075364_10007044 | Ga0075364_100070446 | 239 |
| 751 | 3300006195 | Ga0075366_10001024 | Ga0075366_100010243 | 239 |
| 752 | 3300006353 | Ga0075370_10002971 | Ga0075370_100029718 | 239 |
| 753 | 3300006353 | Ga0075370_10115248 | Ga0075370_101152482 | 239 |
| 754 | 3300006946 | Ga0079104_1032956 | Ga0079104_10329563 | 239 |
| 755 | 3300032004 | Ga0307414_10248475 | Ga0307414_102484751 | 239 |
| 756 | 3300046460 | Ga0495638_0126205 | Ga0495638_0126205_165_932 | 239 |
| 757 | 3300050493 | nmdc:mga0k408_25599_c1 | nmdc:mga0k408_25599_c1_1751_2518 | 239 |
| 758 | 3300050496 | nmdc:mga07m45_63136_c2 | nmdc:mga07m45_63136_c2_230_997 | 239 |
| 759 | 3300050496 | nmdc:mga07m45_80550_c1 | nmdc:mga07m45_80550_c1_61_828 | 239 |
| 760 | 3300050496 | nmdc:mga07m45_886_c1 | nmdc:mga07m45_886_c1_3838_4611 | 239 |
| 761 | 3300053087 | Ga0500643_006666 | Ga0500643_006666_522_1289 | 239 |
| 762 | 3300053119 | Ga0500595_022667 | Ga0500595_022667_285_1046 | 239 |
| 763 | 3300053121 | Ga0500607_000007 | Ga0500607_000007_111111_111878 | 239 |
| 764 | 3300053121 | Ga0500607_001592 | Ga0500607_001592_3096_3863 | 239 |
| 765 | 3300053136 | Ga0500559_0001181 | Ga0500559_0001181_14237_15004 | 239 |
| 766 | 3300053156 | Ga0500622_0000145 | Ga0500622_0000145_27464_28231 | 239 |
| 767 | 3300053158 | Ga0500627_0000028 | Ga0500627_0000028_39055_39789 | 239 |
| 768 | 3300053178 | Ga0500637_0021059 | Ga0500637_0021059_1694_2461 | 239 |
| 769 | 3300053730 | Ga0500645_002010 | Ga0500645_002010_1398_2165 | 239 |
| 770 | 2162886007 | SwRhRL2b_contig_1936816 | SwRhRL2b_0051.00006120 | 240 |
| 771 | 3300001976 | JGI24752J21851_1000169 | JGI24752J21851_10001697 | 240 |
| 772 | 3300005289 | Ga0065704_10077931 | Ga0065704_100779312 | 240 |
| 773 | 3300005295 | Ga0065707_10090060 | Ga0065707_100900602 | 240 |
| 774 | 3300005331 | Ga0070670_100000014 | Ga0070670_100000014143 | 240 |
| 775 | 3300005367 | Ga0070667_100000144 | Ga0070667_10000014478 | 240 |
| 776 | 3300005617 | Ga0068859_100053773 | Ga0068859_1000537735 | 240 |
| 777 | 3300005617 | Ga0068859_100286615 | Ga0068859_1002866152 | 240 |
| 778 | 3300005618 | Ga0068864_100000021 | Ga0068864_100000021154 | 240 |
| 779 | 3300005841 | Ga0068863_100000009 | Ga0068863_100000009161 | 240 |
| 780 | 3300005841 | Ga0068863_100029844 | Ga0068863_1000298444 | 240 |
| 781 | 3300005843 | Ga0068860_100005428 | Ga0068860_1000054283 | 240 |
| 782 | 3300005844 | Ga0068862_100000017 | Ga0068862_100000017157 | 240 |
| 783 | 3300005844 | Ga0068862_100000059 | Ga0068862_1000000593 | 240 |
| 784 | 3300006931 | Ga0097620_100053773 | Ga0097620_1000537735 | 240 |
| 785 | 3300006931 | Ga0097620_100286581 | Ga0097620_1002865812 | 240 |
| 786 | 3300009011 | Ga0105251_10000079 | Ga0105251_1000007982 | 240 |
| 787 | 3300009101 | Ga0105247_10004620 | Ga0105247_100046209 | 240 |
| 788 | 3300009177 | Ga0105248_10000030 | Ga0105248_1000003055 | 240 |
| 789 | 3300009553 | Ga0105249_10000065 | Ga0105249_10000065105 | 240 |
| 790 | 3300009553 | Ga0105249_10000625 | Ga0105249_1000062533 | 240 |
| 791 | 3300013306 | Ga0163162_10091956 | Ga0163162_100919563 | 240 |
| 792 | 3300014325 | Ga0163163_10024253 | Ga0163163_100242537 | 240 |
| 793 | 3300014968 | Ga0157379_10098918 | Ga0157379_100989184 | 240 |
| 794 | 3300025735 | Ga0207713_1001353 | Ga0207713_10013538 | 240 |
| 795 | 3300025900 | Ga0207710_10002558 | Ga0207710_100025583 | 240 |
| 796 | 3300025900 | Ga0207710_10053912 | Ga0207710_100539123 | 240 |
| 797 | 3300025925 | Ga0207650_10000095 | Ga0207650_1000009579 | 240 |
| 798 | 3300025941 | Ga0207711_10000029 | Ga0207711_1000002955 | 240 |
| 799 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002268 | 240 |
| 800 | 3300025961 | Ga0207712_10000268 | Ga0207712_1000026849 | 240 |
| 801 | 3300025986 | Ga0207658_10005485 | Ga0207658_100054855 | 240 |
| 802 | 3300026035 | Ga0207703_10258552 | Ga0207703_102585522 | 240 |
| 803 | 3300026088 | Ga0207641_10000017 | Ga0207641_10000017181 | 240 |
| 804 | 3300026088 | Ga0207641_10027160 | Ga0207641_100271602 | 240 |
| 805 | 3300026095 | Ga0207676_10000037 | Ga0207676_10000037105 | 240 |
| 806 | 3300028380 | Ga0268265_10000025 | Ga0268265_1000002582 | 240 |
| 807 | 3300028380 | Ga0268265_10000141 | Ga0268265_1000014142 | 240 |
| 808 | 3300028381 | Ga0268264_10000788 | Ga0268264_100007889 | 240 |
| 809 | 3300031456 | Ga0307513_10034806 | Ga0307513_100348067 | 240 |
| 810 | 3300048920 | Ga0496117_0008247 | Ga0496117_0008247_1232_1954 | 240 |
| 811 | 3300048921 | Ga0496118_0000216 | Ga0496118_0000216_77976_78698 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9737 | 1 | 117 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9704 | 1 | 111 |
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8929 | 1 | 117 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8442 | 1 | 111 |
| 3tvz-assembly3.cif.gz_C | structure of bacillus subtilis hmob | 0.7299 | 5 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.994 | 1 | 117 | 3.30.70.100 |
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9856 | 1 | 117 | 3.30.70.100 |
| 5k9fA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7199 | 3 | 113 | 3.30.70.100 |
| 1xbwA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7195 | 1 | 108 | 3.30.70.100 |
| 3hx9B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7132 | 125 | 240 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526UZL9-F1-model_v4 | DUF1428 domain-containing protein | 0.9881 | 36 | 240 |
|
| AF-A0A5N7MXK8-F1-model_v4 | DUF1428 domain-containing protein | 0.988 | 1 | 164 |
|
| AF-A0A547NNR5-F1-model_v4 | DUF1428 family protein | 0.9861 | 123 | 235 |
|
| AF-A0A7W0XNB7-F1-model_v4 | DUF1428 domain-containing protein | 0.9857 | 1 | 75 |
|
| AF-A0A658NKC3-F1-model_v4 | DUF1428 domain-containing protein | 0.9846 | 131 | 212 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar