F481841

General Info

Members Datasets Scaffolds Average Seq Length
811 421 801 239

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10252125|Ga0105242_102521252
Length 262
Sequence VNARPEFWPLPNPIIINPTRREAMSYVEGFVVAVPAANKETFRKHAADAAPMFKEFGATRMVEAWGDDVPDGKLTDFKGAVKAKPDEVVVFSWFEYPDKAARDAANEKMMSDPRMKQMGVNMPFDGQRMIFGGFAPIVEEGAGGKMGYADGYLVPVPAANKDAYRAMAAKAAAVFKEYGATRVVEAWGDDVPDGKVTDFKGAVKATGDEKIVYSWIEWPSKQARDAAWPKIMQDGRMKPDHANMPFDGKRMIYGGFTPIVDA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221734 Bosea sp. Root670 Isolate Unclassified
7 2818991467 Bosea vestrisii 3192 Isolate Unclassified
8 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
9 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
10 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
235 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
238 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
239 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
240 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
241 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
242 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
243 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
244 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
245 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
323 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
328 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
329 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
356 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
357 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
358 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
359 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
360 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
361 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
362 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
363 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
364 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
365 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
366 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
367 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
368 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
369 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
374 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
375 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
376 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
377 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
399 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
400 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
401 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
402 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
403 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
404 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
405 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
406 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
409 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
418 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
419 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
420 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.12
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.85
Nodule 0.12
Rhizoplane 4.44
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1936816 2162886007 Bacteria 923
2 SwRhRL2b_contig_2489364 2162886007 Bacteria 1248
3 JGI24736J21556_1000009 3300001904 Bacteria 35855
4 JGI24741J21665_1006527 3300001915 Bacteria 2338
5 JGI24752J21851_1000169 3300001976 Bacteria 8974
6 JGI24746J21847_1013136 3300001977 Bacteria 1207
7 JGI24740J21852_10014316 3300001979 Bacteria 2929
8 JGI24739J22299_10008729 3300001989 Bacteria 3780
9 JGI24737J22298_10003516 3300001990 Bacteria 5526
10 JGI24737J22298_10023018 3300001990 Bacteria 1977
11 JGI24737J22298_10027045 3300001990 Bacteria 1811
12 JGI24737J22298_10055691 3300001990 Bacteria 1195
13 JGI24735J21928_10005493 3300002067 Bacteria 4205
14 JGI24750J21931_1006614 3300002070 Bacteria 1446
15 JGI24748J21848_1000026 3300002074 Bacteria 101640
16 JGI24738J21930_10001213 3300002075 Bacteria 7231
17 JGI24749J21850_1000317 3300002076 Bacteria 7403
18 JGI24034J26672_10000015 3300002239 Bacteria 137655
19 JGI24034J26672_10009293 3300002239 Bacteria 1448
20 JGI24742J22300_10010745 3300002244 Bacteria 1516
21 JGI25151J46595_10000040 3300003187 Bacteria 176750
22 rootH2_10196163 3300003320 Bacteria 1592
23 JGI25404J52841_10000309 3300003659 Bacteria 6427
24 Ga0055526_1001693 3300003771 Bacteria 15409
25 Ga0055524_1000023 3300003775 Bacteria 221408
26 Ga0055530_10000197 3300003791 Bacteria 54281
27 Ga0055531_10000292 3300003794 Bacteria 50059
28 Ga0065165_1003945 3300005262 Bacteria 9759
29 Ga0065704_10077931 3300005289 Bacteria 4579
30 Ga0065704_10101397 3300005289 Bacteria 2239
31 Ga0065704_10153660 3300005289 Bacteria 1409
32 Ga0065707_10081800 3300005295 Bacteria 39313
33 Ga0065707_10082647 3300005295 Bacteria 13064
34 Ga0065707_10090060 3300005295 Bacteria 4220
35 Ga0070658_10003103 3300005327 Bacteria 13704
36 Ga0070658_10019332 3300005327 Bacteria 5455
37 Ga0070658_10122733 3300005327 Bacteria 2160
38 Ga0070658_10350252 3300005327 Bacteria 1264
39 Ga0070676_10016652 3300005328 Bacteria 4065
40 Ga0070676_10036119 3300005328 Bacteria 2845
41 Ga0070676_10082648 3300005328 Bacteria 1952
42 Ga0070676_10246759 3300005328 Bacteria 1190
43 Ga0070683_100834785 3300005329 Bacteria 884
44 Ga0070690_100000025 3300005330 Bacteria 69409
45 Ga0070690_100000857 3300005330 Bacteria 15440
46 Ga0070670_100000014 3300005331 Bacteria 234648
47 Ga0070670_100276851 3300005331 Bacteria 1465
48 Ga0070677_10000102 3300005333 Bacteria 28071
49 Ga0070666_10000015 3300005335 Bacteria 208372
50 Ga0068868_100000162 3300005338 Bacteria 43570
51 Ga0068868_100063449 3300005338 Bacteria 2930
52 Ga0068868_100262021 3300005338 Bacteria 1458
53 Ga0070660_100000258 3300005339 Bacteria 34973
54 Ga0070689_100026195 3300005340 Bacteria 4389
55 Ga0070661_100010594 3300005344 Bacteria 6413
56 Ga0070661_100078990 3300005344 Bacteria 2427
57 Ga0070668_100072852 3300005347 Bacteria 2677
58 Ga0070668_100109463 3300005347 Bacteria 2198
59 Ga0070668_100118867 3300005347 Bacteria 2110
60 Ga0070668_100355482 3300005347 Bacteria 1241
61 Ga0070668_100487648 3300005347 Bacteria 1065
62 Ga0070669_100000059 3300005353 Bacteria 108504
63 Ga0070669_100068580 3300005353 Bacteria 2618
64 Ga0070669_100319693 3300005353 Bacteria 1253
65 Ga0070675_100035554 3300005354 Bacteria 4049
66 Ga0070675_100080959 3300005354 Bacteria 2707
67 Ga0070675_100251712 3300005354 Bacteria 1546
68 Ga0070675_100334862 3300005354 Bacteria 1339
69 Ga0070675_100381273 3300005354 Bacteria 1255
70 Ga0070671_100009469 3300005355 Bacteria 7820
71 Ga0070671_100081004 3300005355 Bacteria 2714
72 Ga0070671_100085184 3300005355 Bacteria 2644
73 Ga0070671_100197249 3300005355 Bacteria 1707
74 Ga0070671_100455515 3300005355 Bacteria 1098
75 Ga0070673_100090420 3300005364 Bacteria 2501
76 Ga0070688_100013459 3300005365 Bacteria 4613
77 Ga0070688_100045193 3300005365 Bacteria 2720
78 Ga0070659_100000022 3300005366 Bacteria 154091
79 Ga0070659_100098281 3300005366 Bacteria 2354
80 Ga0070659_100166761 3300005366 Bacteria 1802
81 Ga0070667_100000144 3300005367 Bacteria 89681
82 Ga0070667_100017737 3300005367 Bacteria 5900
83 Ga0070667_100025515 3300005367 Bacteria 4913
84 Ga0070667_100333577 3300005367 Bacteria 1371
85 Ga0070700_100025029 3300005441 Bacteria 3511
86 Ga0070700_100085949 3300005441 Bacteria 2041
87 Ga0070700_100110172 3300005441 Bacteria 1829
88 Ga0070694_100404932 3300005444 Bacteria 1069
89 Ga0070663_100009775 3300005455 Bacteria 5956
90 Ga0070663_100268519 3300005455 Bacteria 1355
91 Ga0070678_100019428 3300005456 Bacteria 4429
92 Ga0070678_100657701 3300005456 Bacteria 940
93 Ga0070662_100074410 3300005457 Bacteria 2512
94 Ga0070662_100104860 3300005457 Bacteria 2146
95 Ga0070662_100209315 3300005457 Bacteria 1551
96 Ga0070662_100319550 3300005457 Bacteria 1266
97 Ga0070662_100392312 3300005457 Bacteria 1144
98 Ga0068867_100040588 3300005459 Bacteria 3398
99 Ga0068867_100068904 3300005459 Bacteria 2641
100 Ga0070685_10000247 3300005466 Bacteria 35364
101 Ga0070679_100543504 3300005530 Bacteria 1105
102 Ga0070679_100615694 3300005530 Bacteria 1029
103 Ga0070684_100048210 3300005535 Bacteria 3695
104 Ga0068853_100006432 3300005539 Bacteria 9335
105 Ga0068853_100139015 3300005539 Bacteria 2180
106 Ga0068853_100982694 3300005539 Unclassified 812
107 Ga0070672_100038046 3300005543 Bacteria 3674
108 Ga0070672_100059603 3300005543 Bacteria 3004
109 Ga0070672_100304381 3300005543 Bacteria 1352
110 Ga0070672_100466143 3300005543 Bacteria 1089
111 Ga0070686_100000006 3300005544 Bacteria 243316
112 Ga0070686_100000071 3300005544 Bacteria 76738
113 Ga0070686_100100933 3300005544 Bacteria 1950
114 Ga0070665_100000217 3300005548 Bacteria 97947
115 Ga0070665_100003467 3300005548 Bacteria 16809
116 Ga0070665_100032170 3300005548 Bacteria 5279
117 Ga0070665_100056643 3300005548 Bacteria 3930
118 Ga0070665_100060021 3300005548 Bacteria 3812
119 Ga0070665_100819222 3300005548 Bacteria 944
120 Ga0070704_100405218 3300005549 Bacteria 1165
121 Ga0068855_101011226 3300005563 Bacteria 873
122 Ga0070664_100108890 3300005564 Bacteria 2416
123 Ga0070664_100267134 3300005564 Bacteria 1540
124 Ga0068857_100080184 3300005577 Bacteria 2915
125 Ga0068857_100208552 3300005577 Bacteria 1782
126 Ga0068857_100269993 3300005577 Bacteria 1563
127 Ga0068857_100759170 3300005577 Bacteria 924
128 Ga0068856_100169667 3300005614 Bacteria 2194
129 Ga0068856_100279622 3300005614 Bacteria 1686
130 Ga0068852_100026293 3300005616 Bacteria 4729
131 Ga0068859_100000937 3300005617 Bacteria 29957
132 Ga0068859_100031726 3300005617 Bacteria 5306
133 Ga0068859_100053773 3300005617 Bacteria 4050
134 Ga0068859_100286615 3300005617 Bacteria 1740
135 Ga0068859_100532863 3300005617 Bacteria 1269
136 Ga0068859_100575925 3300005617 Bacteria 1219
137 Ga0068864_100000021 3300005618 Bacteria 262378
138 Ga0068864_100009352 3300005618 Bacteria 8085
139 Ga0068864_100017721 3300005618 Bacteria 5941
140 Ga0068866_10266255 3300005718 Bacteria 1055
141 Ga0068861_100006465 3300005719 Bacteria 7984
142 Ga0068861_100164541 3300005719 Bacteria 1833
143 Ga0068851_10072312 3300005834 Bacteria 1786
144 Ga0068863_100000009 3300005841 Bacteria 250538
145 Ga0068863_100000108 3300005841 Bacteria 87921
146 Ga0068863_100001030 3300005841 Bacteria 27842
147 Ga0068863_100029844 3300005841 Bacteria 5208
148 Ga0068863_100045028 3300005841 Bacteria 4187
149 Ga0068863_100460005 3300005841 Bacteria 1249
150 Ga0068858_100000318 3300005842 Bacteria 51170
151 Ga0068858_100002534 3300005842 Bacteria 18415
152 Ga0068858_100023685 3300005842 Bacteria 5719
153 Ga0068858_100061649 3300005842 Bacteria 3467
154 Ga0068858_100103238 3300005842 Bacteria 2659
155 Ga0068860_100000050 3300005843 Bacteria 208372
156 Ga0068860_100000554 3300005843 Bacteria 45461
157 Ga0068860_100005428 3300005843 Bacteria 12929
158 Ga0068860_100031734 3300005843 Bacteria 5079
159 Ga0068860_100053433 3300005843 Bacteria 3841
160 Ga0068862_100000017 3300005844 Bacteria 247616
161 Ga0068862_100000059 3300005844 Bacteria 136840
162 Ga0068862_100000062 3300005844 Bacteria 126792
163 Ga0068862_100019112 3300005844 Bacteria 5713
164 Ga0068862_100274922 3300005844 Bacteria 1542
165 Ga0081455_10000097 3300005937 Bacteria 96027
166 Ga0081455_10315218 3300005937 Bacteria 1116
167 Ga0081540_1000022 3300005983 Bacteria 161205
168 Ga0075365_10269779 3300006038 Bacteria 1197
169 Ga0075368_10000156 3300006042 Bacteria 18343
170 Ga0075368_10149628 3300006042 Bacteria 975
171 Ga0075364_10007044 3300006051 Bacteria 6646
172 Ga0075364_10149717 3300006051 Bacteria 1572
173 Ga0075364_10167736 3300006051 Bacteria 1483
174 Ga0075364_10191021 3300006051 Bacteria 1387
175 Ga0075364_10238658 3300006051 Bacteria 1234
176 Ga0075364_10314550 3300006051 Bacteria 1066
177 Ga0075362_10004105 3300006177 Bacteria 5192
178 Ga0075362_10029630 3300006177 Bacteria 2360
179 Ga0075362_10030432 3300006177 Bacteria 2331
180 Ga0075362_10155918 3300006177 Bacteria 1097
181 Ga0075367_10015975 3300006178 Bacteria 4093
182 Ga0075367_10115586 3300006178 Bacteria 1650
183 Ga0075367_10216224 3300006178 Bacteria 1199
184 Ga0075369_10002148 3300006186 Bacteria 6961
185 Ga0075366_10001024 3300006195 Bacteria 13705
186 Ga0075366_10003581 3300006195 Bacteria 8221
187 Ga0075366_10030386 3300006195 Bacteria 3176
188 Ga0075366_10152908 3300006195 Bacteria 1398
189 Ga0097621_100002041 3300006237 Bacteria 13816
190 Ga0097621_100338866 3300006237 Bacteria 1335
191 Ga0075370_10002971 3300006353 Bacteria 7967
192 Ga0075370_10115248 3300006353 Bacteria 1562
193 Ga0068871_100002322 3300006358 Bacteria 12954
194 Ga0075428_100091137 3300006844 Bacteria 3325
195 Ga0075428_100206495 3300006844 Bacteria 2123
196 Ga0075430_100007463 3300006846 Bacteria 9229
197 Ga0075431_100042139 3300006847 Bacteria 4708
198 Ga0075433_10000419 3300006852 Bacteria 27125
199 Ga0075434_100030445 3300006871 Bacteria 5314
200 Ga0075434_100120245 3300006871 Bacteria 2641
201 Ga0068865_100093229 3300006881 Bacteria 2189
202 Ga0068865_100128545 3300006881 Bacteria 1895
203 Ga0068865_100138221 3300006881 Bacteria 1834
204 Ga0097620_100000937 3300006931 Bacteria 29957
205 Ga0097620_100031725 3300006931 Bacteria 5306
206 Ga0097620_100053773 3300006931 Bacteria 4050
207 Ga0097620_100286581 3300006931 Bacteria 1740
208 Ga0097620_100532981 3300006931 Bacteria 1269
209 Ga0097620_100575915 3300006931 Bacteria 1219
210 Ga0097620_100718397 3300006931 Bacteria 1089
211 Ga0079104_1032956 3300006946 Bacteria 1272
212 Ga0075435_100026131 3300007076 Bacteria 4552
213 Ga0105251_10000079 3300009011 Bacteria 92478
214 Ga0111539_10004649 3300009094 Bacteria 17936
215 Ga0111539_10094756 3300009094 Bacteria 3507
216 Ga0111539_10158167 3300009094 Bacteria 2651
217 Ga0111539_10771889 3300009094 Bacteria 1119
218 Ga0105245_10001471 3300009098 Bacteria 21285
219 Ga0105245_10019787 3300009098 Bacteria 5900
220 Ga0105245_10423399 3300009098 Bacteria 1335
221 Ga0105247_10002556 3300009101 Bacteria 12342
222 Ga0105247_10004620 3300009101 Bacteria 8777
223 Ga0105247_10035281 3300009101 Bacteria 3048
224 Ga0105247_10120649 3300009101 Bacteria 1698
225 Ga0114129_10271306 3300009147 Bacteria 2269
226 Ga0105243_10259015 3300009148 Bacteria 1557
227 Ga0105243_10410560 3300009148 Bacteria 1260
228 Ga0105243_10826364 3300009148 Bacteria 915
229 Ga0105242_10252125 3300009176 Bacteria 1591
230 Ga0105248_10000030 3300009177 Bacteria 206609
231 Ga0105248_10021965 3300009177 Bacteria 7072
232 Ga0105248_10141927 3300009177 Bacteria 2710
233 Ga0105248_11009374 3300009177 Bacteria 940
234 Ga0105237_10612819 3300009545 Bacteria 1095
235 Ga0105238_10082901 3300009551 Bacteria 3196
236 Ga0105238_10149933 3300009551 Bacteria 2307
237 Ga0105238_10180155 3300009551 Bacteria 2090
238 Ga0105249_10000034 3300009553 Bacteria 208378
239 Ga0105249_10000065 3300009553 Bacteria 151159
240 Ga0105249_10000625 3300009553 Bacteria 32214
241 Ga0105249_10219888 3300009553 Bacteria 1868
242 Ga0105239_10002028 3300010375 Bacteria 26278
243 Ga0105239_10494856 3300010375 Bacteria 1390
244 Ga0105239_10597738 3300010375 Bacteria 1258
245 Ga0105239_10606825 3300010375 Bacteria 1248
246 Ga0105246_10389494 3300011119 Bacteria 1154
247 Ga0157373_10026314 3300013100 Bacteria 4203
248 Ga0157371_10109285 3300013102 Bacteria 1963
249 Ga0157370_10075929 3300013104 Bacteria 3166
250 Ga0157370_10330166 3300013104 Bacteria 1406
251 Ga0157369_10085137 3300013105 Bacteria 3378
252 Ga0171462_1045 3300013250 Bacteria 50984
253 Ga0157374_10023048 3300013296 Bacteria 5563
254 Ga0157374_10168565 3300013296 Unclassified 2135
255 Ga0157374_11221556 3300013296 Bacteria 773
256 Ga0157378_10277596 3300013297 Bacteria 1614
257 Ga0163162_10046132 3300013306 Bacteria 4368
258 Ga0163162_10091956 3300013306 Bacteria 3117
259 Ga0163162_10106873 3300013306 Bacteria 2894
260 Ga0163162_10109407 3300013306 Bacteria 2860
261 Ga0163162_10560517 3300013306 Bacteria 1270
262 Ga0157372_10305352 3300013307 Bacteria 1851
263 Ga0157375_10039099 3300013308 Bacteria 4562
264 Ga0163163_10024253 3300014325 Bacteria 5771
265 Ga0163163_10041149 3300014325 Bacteria 4518
266 Ga0157380_10000231 3300014326 Bacteria 33437
267 Ga0157380_10000478 3300014326 Bacteria 24450
268 Ga0157380_10011127 3300014326 Bacteria 6491
269 Ga0157380_10022349 3300014326 Bacteria 4759
270 Ga0157380_10053544 3300014326 Bacteria 3200
271 Ga0157380_10077239 3300014326 Bacteria 2713
272 Ga0157380_10281387 3300014326 Bacteria 1522
273 Ga0157380_10288088 3300014326 Bacteria 1506
274 Ga0157377_10035540 3300014745 Bacteria 2734
275 Ga0157377_10151118 3300014745 Bacteria 1436
276 Ga0157379_10005954 3300014968 Bacteria 10505
277 Ga0157379_10098918 3300014968 Bacteria 2619
278 Ga0157379_10145306 3300014968 Bacteria 2139
279 Ga0157376_10361570 3300014969 Bacteria 1392
280 Ga0163161_10000051 3300017792 Bacteria 122360
281 Ga0163161_10387846 3300017792 Bacteria 1118
282 Ga0163161_10566226 3300017792 Bacteria 933
283 Ga0197907_10309105 3300020069 Bacteria 2120
284 Ga0213876_10016920 3300021384 Bacteria 3853
285 Ga0207672_1000434 3300025223 Bacteria 5298
286 Ga0209675_1000162 3300025291 Bacteria 83810
287 Ga0209676_1000113 3300025292 Bacteria 207931
288 Ga0209676_1000146 3300025292 Bacteria 174095
289 Ga0209025_1000016 3300025294 Bacteria 770739
290 Ga0209025_1075336 3300025294 Bacteria 1174
291 Ga0209564_1000076 3300025295 Bacteria 283602
292 Ga0209050_1000126 3300025298 Bacteria 188438
293 Ga0209256_1000083 3300025299 Bacteria 221460
294 Ga0209256_1002896 3300025299 Bacteria 13002
295 Ga0207426_1038778 3300025302 Bacteria 1498
296 Ga0209257_1000256 3300025304 Bacteria 123057
297 Ga0209257_1002163 3300025304 Bacteria 20403
298 Ga0209257_1002727 3300025304 Bacteria 16784
299 Ga0209257_1030993 3300025304 Bacteria 1717
300 Ga0207697_10125308 3300025315 Bacteria 1107
301 Ga0207656_10028118 3300025321 Bacteria 2305
302 Ga0207713_1001353 3300025735 Bacteria 19979
303 Ga0207682_10000779 3300025893 Bacteria 14728
304 Ga0207642_10040935 3300025899 Bacteria 2025
305 Ga0207710_10002558 3300025900 Bacteria 8406
306 Ga0207710_10002920 3300025900 Bacteria 7769
307 Ga0207710_10005791 3300025900 Bacteria 5303
308 Ga0207710_10053912 3300025900 Bacteria 1810
309 Ga0207680_10000007 3300025903 Bacteria 623574
310 Ga0207647_10001146 3300025904 Bacteria 20388
311 Ga0207647_10024093 3300025904 Bacteria 4015
312 Ga0207645_10038121 3300025907 Bacteria 3083
313 Ga0207645_10088731 3300025907 Bacteria 1988
314 Ga0207645_10207518 3300025907 Bacteria 1290
315 Ga0207643_10003813 3300025908 Bacteria 8107
316 Ga0207705_10020786 3300025909 Bacteria 4684
317 Ga0207705_10022866 3300025909 Bacteria 4457
318 Ga0207654_10001455 3300025911 Bacteria 12563
319 Ga0207695_10004741 3300025913 Bacteria 18408
320 Ga0207695_10042299 3300025913 Bacteria 4868
321 Ga0207671_10000658 3300025914 Bacteria 45037
322 Ga0207663_10388710 3300025916 Bacteria 1064
323 Ga0207657_10003941 3300025919 Bacteria 15762
324 Ga0207657_10222114 3300025919 Bacteria 1513
325 Ga0207657_10386687 3300025919 Bacteria 1101
326 Ga0207649_10077647 3300025920 Bacteria 2140
327 Ga0207652_10633583 3300025921 Bacteria 957
328 Ga0207681_10000089 3300025923 Bacteria 79526
329 Ga0207681_10351833 3300025923 Bacteria 1179
330 Ga0207694_10008129 3300025924 Bacteria 7926
331 Ga0207694_10042769 3300025924 Bacteria 3496
332 Ga0207694_10136643 3300025924 Bacteria 1969
333 Ga0207650_10000095 3300025925 Bacteria 116052
334 Ga0207650_10101038 3300025925 Bacteria 2220
335 Ga0207650_10126101 3300025925 Bacteria 1998
336 Ga0207659_10074785 3300025926 Bacteria 2484
337 Ga0207659_10186061 3300025926 Bacteria 1649
338 Ga0207687_10001257 3300025927 Bacteria 17337
339 Ga0207687_10307529 3300025927 Bacteria 1279
340 Ga0207644_10004047 3300025931 Bacteria 9509
341 Ga0207690_10000003 3300025932 Bacteria 783011
342 Ga0207690_10136197 3300025932 Bacteria 1803
343 Ga0207690_10250315 3300025932 Bacteria 1368
344 Ga0207706_10012563 3300025933 Bacteria 7709
345 Ga0207706_10074552 3300025933 Bacteria 2984
346 Ga0207706_10176351 3300025933 Bacteria 1877
347 Ga0207706_10435785 3300025933 Bacteria 1135
348 Ga0207686_10412145 3300025934 Bacteria 1032
349 Ga0207686_10582591 3300025934 Bacteria 878
350 Ga0207670_10022662 3300025936 Bacteria 3896
351 Ga0207669_10014205 3300025937 Bacteria 3985
352 Ga0207704_10130501 3300025938 Bacteria 1739
353 Ga0207704_10705897 3300025938 Bacteria 835
354 Ga0207691_10002479 3300025940 Bacteria 18051
355 Ga0207691_10030460 3300025940 Bacteria 5042
356 Ga0207691_10240259 3300025940 Bacteria 1566
357 Ga0207691_10270901 3300025940 Bacteria 1462
358 Ga0207691_10328122 3300025940 Bacteria 1311
359 Ga0207691_10627663 3300025940 Bacteria 909
360 Ga0207711_10000029 3300025941 Bacteria 206826
361 Ga0207711_10002957 3300025941 Bacteria 14862
362 Ga0207711_10021097 3300025941 Bacteria 5441
363 Ga0207711_10204548 3300025941 Bacteria 1802
364 Ga0207689_10031380 3300025942 Bacteria 4424
365 Ga0207661_10120168 3300025944 Bacteria 2236
366 Ga0207661_10305856 3300025944 Bacteria 1426
367 Ga0207679_10081988 3300025945 Bacteria 2468
368 Ga0207679_10241829 3300025945 Bacteria 1530
369 Ga0207667_10046245 3300025949 Bacteria 4608
370 Ga0207667_10696873 3300025949 Bacteria 1018
371 Ga0207651_10075202 3300025960 Bacteria 2409
372 Ga0207712_10000002 3300025961 Bacteria 706628
373 Ga0207712_10000004 3300025961 Bacteria 614655
374 Ga0207712_10000268 3300025961 Bacteria 50603
375 Ga0207712_10084392 3300025961 Bacteria 2321
376 Ga0207712_10564608 3300025961 Bacteria 980
377 Ga0207668_10030478 3300025972 Bacteria 3545
378 Ga0207668_10196665 3300025972 Bacteria 1602
379 Ga0207668_10292463 3300025972 Bacteria 1341
380 Ga0207668_10298540 3300025972 Bacteria 1328
381 Ga0207668_10425408 3300025972 Bacteria 1128
382 Ga0207640_10203787 3300025981 Bacteria 1501
383 Ga0207640_10229261 3300025981 Bacteria 1428
384 Ga0207640_10682372 3300025981 Bacteria 879
385 Ga0207658_10002005 3300025986 Bacteria 15177
386 Ga0207658_10005485 3300025986 Bacteria 8698
387 Ga0207658_10557606 3300025986 Bacteria 1026
388 Ga0207677_10000154 3300026023 Bacteria 54637
389 Ga0207677_10489542 3300026023 Bacteria 1061
390 Ga0207703_10001286 3300026035 Bacteria 23270
391 Ga0207703_10004368 3300026035 Bacteria 11617
392 Ga0207703_10006943 3300026035 Bacteria 9011
393 Ga0207703_10258552 3300026035 Bacteria 1573
394 Ga0207703_10381902 3300026035 Bacteria 1303
395 Ga0207639_10003651 3300026041 Bacteria 10345
396 Ga0207639_10227605 3300026041 Bacteria 1614
397 Ga0207639_10332244 3300026041 Bacteria 1353
398 Ga0207678_10023624 3300026067 Bacteria 5375
399 Ga0207678_10080714 3300026067 Bacteria 2784
400 Ga0207678_10169135 3300026067 Bacteria 1866
401 Ga0207708_10009902 3300026075 Bacteria 7077
402 Ga0207708_10060007 3300026075 Bacteria 2904
403 Ga0207702_10001915 3300026078 Bacteria 20339
404 Ga0207641_10000017 3300026088 Bacteria 299119
405 Ga0207641_10000209 3300026088 Bacteria 75878
406 Ga0207641_10000428 3300026088 Bacteria 48639
407 Ga0207641_10027160 3300026088 Bacteria 4726
408 Ga0207641_10031322 3300026088 Bacteria 4411
409 Ga0207641_10038679 3300026088 Bacteria 3988
410 Ga0207641_10050427 3300026088 Bacteria 3521
411 Ga0207641_10521385 3300026088 Bacteria 1156
412 Ga0207648_10029171 3300026089 Bacteria 4893
413 Ga0207648_10074433 3300026089 Bacteria 2960
414 Ga0207676_10000037 3300026095 Bacteria 180826
415 Ga0207676_10001679 3300026095 Bacteria 16324
416 Ga0207676_10079562 3300026095 Bacteria 2658
417 Ga0207674_10007684 3300026116 Bacteria 12551
418 Ga0207674_10032587 3300026116 Bacteria 5464
419 Ga0207675_100000449 3300026118 Bacteria 39979
420 Ga0207675_100016886 3300026118 Bacteria 6820
421 Ga0207675_100109265 3300026118 Bacteria 2609
422 Ga0207675_100301892 3300026118 Bacteria 1560
423 Ga0207683_10036842 3300026121 Bacteria 4259
424 Ga0207698_10019699 3300026142 Bacteria 4625
425 Ga0207698_10283261 3300026142 Bacteria 1534
426 Ga0209967_1024052 3300027364 Bacteria 898
427 Ga0209813_10045803 3300027866 Bacteria 1348
428 Ga0207428_10030363 3300027907 Bacteria 4468
429 Ga0268266_10000225 3300028379 Bacteria 98082
430 Ga0268266_10002973 3300028379 Bacteria 17474
431 Ga0268266_10009750 3300028379 Bacteria 8447
432 Ga0268266_10138729 3300028379 Bacteria 2180
433 Ga0268266_10282084 3300028379 Bacteria 1545
434 Ga0268265_10000025 3300028380 Bacteria 250207
435 Ga0268265_10000086 3300028380 Bacteria 119049
436 Ga0268265_10000141 3300028380 Bacteria 91426
437 Ga0268265_10033676 3300028380 Unclassified 3727
438 Ga0268265_10936629 3300028380 Bacteria 852
439 Ga0268264_10000003 3300028381 Bacteria 1141976
440 Ga0268264_10000044 3300028381 Bacteria 368079
441 Ga0268264_10000788 3300028381 Bacteria 34588
442 Ga0268264_10026990 3300028381 Bacteria 4691
443 Ga0268264_11190785 3300028381 Bacteria 771
444 Ga0307511_10013450 3300030521 Bacteria 7993
445 Ga0307513_10034806 3300031456 Bacteria 5644
446 Ga0307509_10000016 3300031507 Bacteria 266991
447 Ga0307408_100024971 3300031548 Bacteria 4088
448 Ga0307408_100157720 3300031548 Bacteria 1799
449 Ga0307408_100207280 3300031548 Bacteria 1591
450 Ga0307408_100668982 3300031548 Bacteria 930
451 Ga0307508_10202239 3300031616 Bacteria 1587
452 Ga0307405_10003561 3300031731 Bacteria 7185
453 Ga0307405_10004054 3300031731 Bacteria 6878
454 Ga0307405_10079796 3300031731 Bacteria 2134
455 Ga0307405_10417888 3300031731 Bacteria 1054
456 Ga0307413_10028415 3300031824 Bacteria 3114
457 Ga0307413_10202997 3300031824 Bacteria 1433
458 Ga0307413_10555109 3300031824 Bacteria 932
459 Ga0307410_10066439 3300031852 Bacteria 2484
460 Ga0307410_10144649 3300031852 Bacteria 1763
461 Ga0307406_10031941 3300031901 Bacteria 3210
462 Ga0307406_10062785 3300031901 Bacteria 2404
463 Ga0307406_10205315 3300031901 Bacteria 1454
464 Ga0307412_10046548 3300031911 Bacteria 2842
465 Ga0307412_10189750 3300031911 Bacteria 1553
466 Ga0307409_100080639 3300031995 Bacteria 2627
467 Ga0307409_100097477 3300031995 Bacteria 2429
468 Ga0307409_100332116 3300031995 Bacteria 1427
469 Ga0307409_101227144 3300031995 Bacteria 774
470 Ga0307416_100000441 3300032002 Bacteria 21217
471 Ga0307416_100731774 3300032002 Bacteria 1081
472 Ga0307414_10000607 3300032004 Bacteria 18398
473 Ga0307414_10030871 3300032004 Bacteria 3506
474 Ga0307414_10045555 3300032004 Bacteria 3005
475 Ga0307414_10208914 3300032004 Bacteria 1594
476 Ga0307414_10248475 3300032004 Bacteria 1477
477 Ga0307414_10447535 3300032004 Bacteria 1132
478 Ga0307414_10580403 3300032004 Bacteria 1003
479 Ga0307411_10001164 3300032005 Bacteria 10335
480 Ga0307411_10074810 3300032005 Bacteria 2310
481 Ga0307411_10120380 3300032005 Bacteria 1898
482 Ga0307411_10313672 3300032005 Bacteria 1263
483 Ga0307415_100031322 3300032126 Bacteria 3425
484 Ga0307415_100213342 3300032126 Bacteria 1542
485 Ga0373953_0012233 3300035117 Bacteria 3035
486 Ga0373954_0032919 3300035118 Bacteria 2398
487 Ga0373946_0005530 3300035171 Bacteria 4559
488 Ga0373955_0340095 3300035172 Bacteria 908
489 Ga0373962_0033882 3300035242 Bacteria 1412
490 Ga0373924_0005515 3300035410 Bacteria 4487
491 Ga0373935_0373196 3300035692 Bacteria 1020
492 Ga0373933_0053543 3300035724 Bacteria 2417
493 Ga0373947_0082426 3300035725 Bacteria 1993
494 Ga0373937_0261786 3300036401 Bacteria 1631
495 Ga0373937_0294166 3300036401 Bacteria 1534
496 Ga0373925_0077146 3300037068 Bacteria 2528
497 Ga0395899_0032112 3300037312 Bacteria 3944
498 Ga0395899_0122289 3300037312 Bacteria 1863
499 Ga0395899_0243748 3300037312 Bacteria 1236
500 Ga0395900_0056710 3300037418 Bacteria 4032
501 Ga0395900_0167869 3300037418 Bacteria 2235
502 Ga0395900_0192160 3300037418 Bacteria 2070
503 Ga0395898_0220985 3300037466 Bacteria 1807
504 Ga0395905_0034610 3300037471 Bacteria 4744
505 Ga0395905_0100066 3300037471 Bacteria 2722
506 Ga0395905_0562865 3300037471 Bacteria 1041
507 Ga0395901_0010662 3300038443 Bacteria 9315
508 Ga0395901_0046767 3300038443 Bacteria 4495
509 Ga0395901_0076679 3300038443 Bacteria 3488
510 Ga0395901_0120911 3300038443 Bacteria 2752
511 Ga0237819_01311 3300038705 Bacteria 6665
512 Ga0237816_01700 3300039145 Bacteria 1757
513 Ga0436365_0211517 3300039437 Bacteria 10464
514 Ga0436365_0587652 3300039437 Bacteria 4889
515 Ga0439453_0013774 3300041408 Bacteria 1378
516 Ga0450920_002276 3300042122 Bacteria 3253
517 Ga0450923_008347 3300042125 Bacteria 1781
518 Ga0450923_012749 3300042125 Bacteria 1534
519 Ga0450894_002291 3300042131 Bacteria 2595
520 Ga0450895_003276 3300042132 Bacteria 1241
521 Ga0450906_032253 3300042145 Bacteria 926
522 Ga0450910_014943 3300042147 Bacteria 1139
523 Ga0439446_0003219 3300042156 Bacteria 4030
524 Ga0439446_0006965 3300042156 Bacteria 2961
525 Ga0439434_0000069 3300042435 Bacteria 25160
526 Ga0439435_0002644 3300042436 Bacteria 3601
527 Ga0450918_007305 3300042531 Bacteria 1958
528 Ga0466970_0052642 3300044765 Bacteria 2173
529 Ga0466970_0056532 3300044765 Bacteria 2097
530 Ga0495617_063441 3300046452 Bacteria 1220
531 Ga0495592_0038235 3300046454 Bacteria 3611
532 Ga0495590_0124134 3300046457 Bacteria 926
533 Ga0495629_0027980 3300046459 Bacteria 4004
534 Ga0495638_0002975 3300046460 Bacteria 13525
535 Ga0495638_0126205 3300046460 Bacteria 1508
536 Ga0495641_0043345 3300046461 Bacteria 2081
537 Ga0495653_0017397 3300046463 Bacteria 5847
538 Ga0495582_0017692 3300046473 Bacteria 3898
539 Ga0495639_0095079 3300046475 Bacteria 1402
540 Ga0495662_0122445 3300046476 Bacteria 1277
541 Ga0495664_0212688 3300046477 Bacteria 1171
542 Ga0495584_0205700 3300046491 Bacteria 1000
543 Ga0495585_0129286 3300046492 Bacteria 1330
544 Ga0495607_0171300 3300046501 Bacteria 1096
545 Ga0495606_0173926 3300046507 Bacteria 1247
546 Ga0495606_0329864 3300046507 Bacteria 817
547 Ga0495608_0016441 3300046511 Bacteria 5120
548 Ga0495620_0040613 3300046515 Bacteria 2046
549 Ga0495628_0110486 3300046516 Bacteria 2115
550 Ga0495630_0036902 3300046517 Bacteria 3654
551 Ga0495631_0121153 3300046518 Bacteria 1125
552 Ga0495666_0114793 3300046526 Bacteria 1264
553 Ga0495652_0156991 3300046529 Bacteria 1771
554 Ga0495640_0003772 3300046533 Bacteria 12157
555 Ga0495586_0267904 3300046535 Bacteria 976
556 Ga0495621_0020218 3300046539 Bacteria 2183
557 Ga0495645_0266154 3300046543 Bacteria 1133
558 Ga0495667_0041413 3300046559 Bacteria 3055
559 Ga0495667_0278014 3300046559 Bacteria 1063
560 Ga0495634_0009029 3300046642 Bacteria 7375
561 Ga0495634_0120963 3300046642 Bacteria 1677
562 Ga0495611_0267748 3300046648 Bacteria 790
563 Ga0495625_0031870 3300046660 Bacteria 3916
564 Ga0495625_0139285 3300046660 Bacteria 1638
565 Ga0495625_0217587 3300046660 Bacteria 1253
566 Ga0495635_0005370 3300046663 Bacteria 8919
567 Ga0495635_0415215 3300046663 Bacteria 893
568 Ga0495659_0074038 3300046664 Bacteria 1281
569 Ga0495661_0123239 3300046665 Bacteria 1429
570 Ga0495599_0246029 3300046678 Bacteria 1089
571 Ga0495599_0344597 3300046678 Bacteria 894
572 Ga0495646_0015685 3300046680 Bacteria 4808
573 Ga0495647_0136946 3300046681 Bacteria 1042
574 Ga0495669_0000691 3300046684 Bacteria 14739
575 Ga0495613_0042320 3300046689 Bacteria 3371
576 Ga0495613_0190358 3300046689 Bacteria 1450
577 Ga0495613_0266069 3300046689 Bacteria 1193
578 Ga0495624_0065285 3300046690 Bacteria 2274
579 Ga0495670_0018122 3300046691 Bacteria 3467
580 Ga0495649_0148309 3300046694 Bacteria 1233
581 Ga0495600_0050936 3300046809 Bacteria 2702
582 Ga0495581_0093842 3300047315 Bacteria 1742
583 Ga0495581_0309379 3300047315 Bacteria 923
584 Ga0495604_0002468 3300047317 Bacteria 14761
585 Ga0495674_0002597 3300047319 Bacteria 17589
586 Ga0495680_0006886 3300047322 Bacteria 10493
587 Ga0495675_0085415 3300047444 Bacteria 1984
588 Ga0495684_0043679 3300047471 Bacteria 3432
589 Ga0495684_0093022 3300047471 Bacteria 2284
590 Ga0495686_0221284 3300047472 Bacteria 1076
591 Ga0495593_0101065 3300047673 Bacteria 1479
592 Ga0495602_0062499 3300048088 Bacteria 3230
593 Ga0495615_0052262 3300048090 Bacteria 1055
594 Ga0495626_0119582 3300048091 Bacteria 1134
595 Ga0496101_0168156 3300048904 Bacteria 1684
596 Ga0496101_0567664 3300048904 Bacteria 897
597 Ga0496102_0029469 3300048905 Bacteria 4911
598 Ga0496102_0035433 3300048905 Bacteria 4491
599 Ga0496102_0065734 3300048905 Bacteria 3324
600 Ga0496102_0158320 3300048905 Bacteria 2129
601 Ga0496103_0007410 3300048906 Bacteria 6538
602 Ga0496103_0015627 3300048906 Bacteria 4522
603 Ga0496104_0044921 3300048907 Bacteria 4152
604 Ga0496104_0113736 3300048907 Bacteria 2595
605 Ga0496104_0212088 3300048907 Unclassified 1848
606 Ga0496105_0025731 3300048908 Bacteria 4794
607 Ga0496105_0137340 3300048908 Bacteria 2013
608 Ga0496106_0033684 3300048909 Bacteria 3823
609 Ga0496106_0036115 3300048909 Bacteria 3696
610 Ga0496107_0056984 3300048910 Bacteria 2824
611 Ga0496107_0469089 3300048910 Bacteria 934
612 Ga0496108_0008694 3300048911 Bacteria 8234
613 Ga0496108_0028422 3300048911 Bacteria 4626
614 Ga0496109_0014437 3300048912 Bacteria 6872
615 Ga0496109_0015956 3300048912 Bacteria 6561
616 Ga0496109_0342971 3300048912 Bacteria 1411
617 Ga0496110_0015800 3300048913 Bacteria 6293
618 Ga0496110_0096335 3300048913 Bacteria 2651
619 Ga0496110_0117673 3300048913 Bacteria 2393
620 Ga0496111_0008197 3300048914 Bacteria 6905
621 Ga0496111_0038006 3300048914 Bacteria 3447
622 Ga0496111_0054703 3300048914 Bacteria 2886
623 Ga0496112_0002369 3300048915 Bacteria 15145
624 Ga0496112_0122707 3300048915 Bacteria 2568
625 Ga0496113_0003688 3300048916 Bacteria 9224
626 Ga0496113_0037136 3300048916 Bacteria 3572
627 Ga0496114_0013568 3300048917 Bacteria 6536
628 Ga0496114_0115522 3300048917 Bacteria 2303
629 Ga0496115_0024390 3300048918 Bacteria 4699
630 Ga0496115_0619335 3300048918 Bacteria 859
631 Ga0496117_0000067 3300048920 Bacteria 249348
632 Ga0496117_0008247 3300048920 Bacteria 9929
633 Ga0496117_0038265 3300048920 Bacteria 3560
634 Ga0496117_0052793 3300048920 Bacteria 2861
635 Ga0496118_0000021 3300048921 Bacteria 444988
636 Ga0496118_0000216 3300048921 Bacteria 100502
637 Ga0496119_0000323 3300048922 Bacteria 67133
638 Ga0496119_0017268 3300048922 Bacteria 5435
639 Ga0496119_0280868 3300048922 Bacteria 828
640 Ga0496120_0000042 3300048923 Bacteria 197055
641 Ga0496120_0019318 3300048923 Bacteria 4361
642 Ga0496121_0002128 3300048924 Bacteria 31122
643 Ga0496121_0028474 3300048924 Bacteria 5199
644 Ga0496121_0031827 3300048924 Bacteria 4810
645 Ga0496121_0285638 3300048924 Bacteria 1126
646 Ga0496122_0022949 3300048925 Bacteria 5523
647 Ga0496122_0208254 3300048925 Bacteria 1135
648 Ga0496123_0041927 3300048926 Bacteria 3166
649 Ga0496123_0086227 3300048926 Bacteria 1885
650 Ga0496124_0377854 3300048927 Bacteria 992
651 Ga0496125_0000533 3300048928 Bacteria 65519
652 Ga0496125_0032702 3300048928 Unclassified 4617
653 Ga0496125_0087806 3300048928 Bacteria 2347
654 Ga0496125_0154082 3300048928 Bacteria 1573
655 Ga0496126_0041273 3300048929 Bacteria 4271
656 Ga0501292_000003 3300049515 Bacteria 161908
657 Ga0501294_000294 3300049517 Bacteria 6102
658 Ga0501300_000197 3300049523 Bacteria 9234
659 Ga0501031_0296295 3300049568 Bacteria 1048
660 Ga0501032_0053949 3300049569 Bacteria 2706
661 Ga0501032_0265464 3300049569 Bacteria 1113
662 Ga0501033_0047333 3300049570 Bacteria 3197
663 Ga0501033_0221451 3300049570 Bacteria 1347
664 Ga0501033_0276579 3300049570 Bacteria 1186
665 Ga0501034_0252078 3300049571 Bacteria 1709
666 Ga0501036_0011042 3300049572 Bacteria 7468
667 Ga0501036_0131748 3300049572 Bacteria 2111
668 Ga0501037_0014087 3300049573 Bacteria 5890
669 Ga0501037_0088088 3300049573 Bacteria 2247
670 Ga0501038_0085233 3300049574 Bacteria 2657
671 Ga0501039_0038875 3300049575 Bacteria 3674
672 Ga0501039_0197728 3300049575 Bacteria 1581
673 Ga0501041_0349067 3300049577 Bacteria 935
674 Ga0501042_0089563 3300049578 Bacteria 2208
675 Ga0501042_0295178 3300049578 Bacteria 1171
676 Ga0501043_0016353 3300049579 Bacteria 5819
677 Ga0501043_0207250 3300049579 Bacteria 1520
678 Ga0501046_0151101 3300049580 Bacteria 1752
679 Ga0501047_0161069 3300049581 Bacteria 2115
680 Ga0501047_0324545 3300049581 Bacteria 1379
681 Ga0501048_0610296 3300049582 Bacteria 783
682 Ga0501067_0095853 3300049583 Bacteria 1647
683 Ga0501068_0000308 3300049584 Bacteria 24470
684 Ga0501068_0019639 3300049584 Bacteria 3927
685 Ga0501068_0082502 3300049584 Bacteria 1975
686 Ga0501069_0042863 3300049585 Bacteria 2504
687 Ga0501070_0026692 3300049586 Bacteria 4845
688 Ga0501070_0234987 3300049586 Bacteria 1501
689 Ga0501071_0028442 3300049587 Bacteria 3940
690 Ga0501071_0094772 3300049587 Bacteria 2196
691 Ga0501071_0170166 3300049587 Bacteria 1631
692 Ga0501071_0381232 3300049587 Bacteria 1075
693 Ga0501072_0005081 3300049588 Bacteria 10018
694 Ga0501072_0544800 3300049588 Bacteria 916
695 Ga0501073_0000671 3300049589 Bacteria 24036
696 Ga0501074_0000926 3300049590 Bacteria 18838
697 Ga0501074_0300278 3300049590 Bacteria 1140
698 Ga0501075_0027830 3300049591 Bacteria 4168
699 Ga0501075_0165224 3300049591 Bacteria 1689
700 Ga0501075_0392160 3300049591 Bacteria 1058
701 Ga0501076_0173241 3300049592 Bacteria 1759
702 Ga0501076_0192599 3300049592 Bacteria 1664
703 Ga0501076_0318703 3300049592 Bacteria 1275
704 Ga0501076_0580676 3300049592 Bacteria 924
705 Ga0501077_0023354 3300049593 Bacteria 3921
706 Ga0501077_0214446 3300049593 Bacteria 1223
707 Ga0501202_036608 3300049652 Bacteria 1045
708 Ga0501206_023323 3300049653 Bacteria 891
709 Ga0501222_000197 3300049662 Bacteria 10844
710 Ga0501224_003301 3300049664 Bacteria 2244
711 Ga0501227_000365 3300049665 Bacteria 9527
712 Ga0501233_002537 3300049668 Bacteria 3226
713 Ga0501235_022492 3300049669 Bacteria 1401
714 Ga0501236_004811 3300049670 Bacteria 1613
715 Ga0501257_020481 3300049686 Bacteria 1553
716 Ga0501259_000022 3300049688 Bacteria 22627
717 Ga0501261_000007 3300049690 Bacteria 60773
718 Ga0501221_007955 3300049704 Bacteria 1832
719 Ga0501225_0003127 3300049705 Bacteria 5060
720 Ga0501229_004563 3300049706 Bacteria 1685
721 Ga0501245_000064 3300049708 Bacteria 10076
722 Ga0501079_0011184 3300049741 Bacteria 6846
723 Ga0501079_0013454 3300049741 Bacteria 6239
724 Ga0501079_0262476 3300049741 Bacteria 1350
725 Ga0501080_0002630 3300049742 Bacteria 15715
726 Ga0501080_0016670 3300049742 Bacteria 6784
727 Ga0501080_0374316 3300049742 Bacteria 1284
728 Ga0501083_0059698 3300049744 Bacteria 2550
729 Ga0501083_0143162 3300049744 Bacteria 1565
730 Ga0501279_000009 3300049775 Bacteria 117146
731 Ga0501280_000047 3300049776 Bacteria 35975
732 Ga0501281_00349 3300049777 Bacteria 4713
733 Ga0501282_000100 3300049778 Bacteria 9696
734 Ga0501283_000412 3300049779 Bacteria 5689
735 Ga0501035_0071455 3300049822 Bacteria 3072
736 Ga0501044_0015007 3300049823 Bacteria 8351
737 nmdc:mga03683_112313_c1 3300050489 Bacteria 1206
738 nmdc:mga03683_20740_c1 3300050489 Bacteria 2525
739 nmdc:mga03683_3715_c1 3300050489 Bacteria 4972
740 nmdc:mga03683_90072_c1 3300050489 Bacteria 1336
741 nmdc:mga0k408_137650_c1 3300050493 Bacteria 1451
742 nmdc:mga0k408_25599_c1 3300050493 Bacteria 3342
743 nmdc:mga0k408_25689_c1 3300050493 Bacteria 3337
744 nmdc:mga0k408_6102_c1 3300050493 Bacteria 6419
745 nmdc:mga06z11_122085_c1 3300050494 Bacteria 1454
746 nmdc:mga07m45_14207_c1 3300050496 Bacteria 4236
747 nmdc:mga07m45_63136_c2 3300050496 Bacteria 1634
748 nmdc:mga07m45_80550_c1 3300050496 Bacteria 1859
749 nmdc:mga07m45_886_c1 3300050496 Bacteria 12563
750 nmdc:mga05p37_209805_c1 3300050507 Bacteria 2355
751 nmdc:mga09592_128621_c1 3300050508 Bacteria 2178
752 nmdc:mga0qj67_18511_c1 3300050509 Bacteria 5309
753 nmdc:mga06r32_12838_c1 3300050510 Bacteria 7573
754 nmdc:mga08y16_19864_c1 3300050511 Bacteria 7086
755 nmdc:mga08y16_465329_c1 3300050511 Bacteria 1288
756 nmdc:mga08y16_633237_c1 3300050511 Bacteria 1075
757 nmdc:mga0n895_7477_c1 3300050512 Bacteria 9379
758 nmdc:mga0rr50_6155_c1 3300050513 Bacteria 7265
759 nmdc:mga0a205_2164_c1 3300050515 Bacteria 17268
760 nmdc:mga0sz30_11926_c1 3300050516 Bacteria 3369
761 nmdc:mga0sz30_4626_c1 3300050516 Bacteria 4983
762 nmdc:mga0sz30_531_c2 3300050516 Bacteria 6733
763 Ga0495601_0007858 3300053077 Bacteria 6278
764 Ga0495612_0012043 3300053078 Bacteria 3484
765 Ga0495655_0049749 3300053083 Bacteria 1105
766 Ga0495595_0017419 3300053084 Bacteria 3090
767 Ga0495619_0012574 3300053085 Bacteria 5330
768 Ga0500643_000475 3300053087 Bacteria 29406
769 Ga0500643_006666 3300053087 Bacteria 4788
770 Ga0500643_015447 3300053087 Bacteria 2618
771 Ga0500643_023162 3300053087 Bacteria 1987
772 Ga0500644_0112384 3300053088 Bacteria 1051
773 Ga0500566_0003208 3300053094 Bacteria 9779
774 Ga0500592_000558 3300053116 Bacteria 6154
775 Ga0500595_022667 3300053119 Bacteria 2218
776 Ga0500607_000007 3300053121 Bacteria 134097
777 Ga0500607_001592 3300053121 Bacteria 20060
778 Ga0500608_204682 3300053122 Bacteria 812
779 Ga0500658_0010929 3300053134 Bacteria 3348
780 Ga0500658_0011943 3300053134 Bacteria 3203
781 Ga0500559_0001181 3300053136 Bacteria 15619
782 Ga0500568_0019617 3300053139 Bacteria 2935
783 Ga0500568_0044871 3300053139 Bacteria 1760
784 Ga0500573_0000022 3300053140 Bacteria 154562
785 Ga0500604_0008236 3300053151 Bacteria 2763
786 Ga0500616_0000123 3300053153 Bacteria 140214
787 Ga0500622_0000145 3300053156 Bacteria 75417
788 Ga0500627_0000028 3300053158 Bacteria 99118
789 Ga0500627_0055583 3300053158 Bacteria 1733
790 Ga0500636_0060568 3300053177 Bacteria 2210
791 Ga0500637_0021059 3300053178 Bacteria 3539
792 Ga0500637_0057396 3300053178 Bacteria 2225
793 Ga0500611_021686 3300053727 Bacteria 1229
794 Ga0500645_002010 3300053730 Bacteria 9526
795 Ga0500552_000397 3300053733 Bacteria 3993
796 Ga0501084_0010540 3300054114 Bacteria 7644
797 Ga0590071_033434 3300059421 Bacteria 1229
798 Ga0590077_007651 3300059426 Bacteria 2208
799 Ga0501082_0014265 3300060353 Bacteria 6838
800 Ga0501082_0014811 3300060353 Bacteria 6717
801 Ga0501082_0540016 3300060353 Bacteria 1020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0221451 Ga0501033_0221451_176_775 197
2 3300025940 Ga0207691_10270901 Ga0207691_102709012 205
3 3300046642 Ga0495634_0120963 Ga0495634_0120963_10_645 210
4 3300046678 Ga0495599_0344597 Ga0495599_0344597_239_874 210
5 3300053134 Ga0500658_0011943 Ga0500658_0011943_2268_2987 210
6 3300003791 Ga0055530_10000197 Ga0055530_1000019724 211
7 3300003794 Ga0055531_10000292 Ga0055531_1000029241 211
8 3300025291 Ga0209675_1000162 Ga0209675_100016267 211
9 3300025292 Ga0209676_1000113 Ga0209676_1000113102 211
10 3300025292 Ga0209676_1000146 Ga0209676_1000146139 211
11 3300025298 Ga0209050_1000126 Ga0209050_1000126102 211
12 3300025304 Ga0209257_1000256 Ga0209257_100025696 211
13 3300025304 Ga0209257_1002727 Ga0209257_10027271 212
14 3300049569 Ga0501032_0265464 Ga0501032_0265464_175_909 214
15 3300049573 Ga0501037_0014087 Ga0501037_0014087_4854_5588 214
16 3300009101 Ga0105247_10120649 Ga0105247_101206492 221
17 3300025940 Ga0207691_10240259 Ga0207691_102402592 221
18 3300027364 Ga0209967_1024052 Ga0209967_10240521 223
19 3300031548 Ga0307408_100024971 Ga0307408_1000249712 224
20 3300031731 Ga0307405_10003561 Ga0307405_100035612 224
21 3300032002 Ga0307416_100000441 Ga0307416_1000004413 224
22 3300032004 Ga0307414_10208914 Ga0307414_102089142 224
23 3300032005 Ga0307411_10001164 Ga0307411_100011641 224
24 3300041408 Ga0439453_0013774 Ga0439453_0013774_414_1133 224
25 3300042125 Ga0450923_008347 Ga0450923_008347_22_741 224
26 3300042156 Ga0439446_0006965 Ga0439446_0006965_852_1571 224
27 3300042435 Ga0439434_0000069 Ga0439434_0000069_8150_8869 224
28 3300042436 Ga0439435_0002644 Ga0439435_0002644_353_1072 224
29 3300046476 Ga0495662_0122445 Ga0495662_0122445_190_867 224
30 3300031995 Ga0307409_100097477 Ga0307409_1000974773 227
31 iso_pu_bacteria 2643221598 2644001505 230
32 iso_pu_bacteria 2939669807 2939673428 231
33 iso_pu_bacteria 2643221734 2644733455 232
34 iso_pu_bacteria 2818991467 2819717404 232
35 iso_pu_bacteria 2917699015 2917701041 232
36 3300049570 Ga0501033_0276579 Ga0501033_0276579_371_1081 234
37 iso_pu_bacteria 2643221560 2643820274 234
38 iso_pu_bacteria 2643221563 2643834590 234
39 iso_pu_bacteria 2643221608 2644055516 234
40 iso_pu_bacteria 2852680915 2852683335 234
41 3300001990 JGI24737J22298_10055691 JGI24737J22298_100556912 235
42 3300002067 JGI24735J21928_10005493 JGI24735J21928_100054935 235
43 3300005344 Ga0070661_100010594 Ga0070661_1000105947 235
44 3300005366 Ga0070659_100166761 Ga0070659_1001667612 235
45 3300005455 Ga0070663_100268519 Ga0070663_1002685192 235
46 3300005530 Ga0070679_100543504 Ga0070679_1005435042 235
47 3300013102 Ga0157371_10109285 Ga0157371_101092853 235
48 3300013296 Ga0157374_10023048 Ga0157374_100230486 235
49 3300025904 Ga0207647_10024093 Ga0207647_100240935 235
50 3300025909 Ga0207705_10020786 Ga0207705_100207865 235
51 3300025919 Ga0207657_10386687 Ga0207657_103866872 235
52 3300025932 Ga0207690_10136197 Ga0207690_101361972 235
53 3300025986 Ga0207658_10557606 Ga0207658_105576062 235
54 3300026067 Ga0207678_10080714 Ga0207678_100807142 235
55 3300032004 Ga0307414_10447535 Ga0307414_104475351 235
56 3300037312 Ga0395899_0243748 Ga0395899_0243748_119_847 235
57 3300039437 Ga0436365_0587652 Ga0436365_0587652_419_1132 235
58 3300044765 Ga0466970_0052642 Ga0466970_0052642_671_1423 235
59 3300044765 Ga0466970_0056532 Ga0466970_0056532_1163_1912 235
60 3300048928 Ga0496125_0154082 Ga0496125_0154082_379_1089 235
61 3300053122 Ga0500608_204682 Ga0500608_204682_66_776 235
62 3300053139 Ga0500568_0019617 Ga0500568_0019617_1280_1993 235
63 3300053177 Ga0500636_0060568 Ga0500636_0060568_1317_2027 235
64 3300003187 JGI25151J46595_10000040 JGI25151J46595_10000040107 236
65 3300003320 rootH2_10196163 rootH2_101961632 236
66 3300003771 Ga0055526_1001693 Ga0055526_100169313 236
67 3300003775 Ga0055524_1000023 Ga0055524_1000023132 236
68 3300005327 Ga0070658_10003103 Ga0070658_100031036 236
69 3300005327 Ga0070658_10122733 Ga0070658_101227333 236
70 3300005327 Ga0070658_10350252 Ga0070658_103502522 236
71 3300005328 Ga0070676_10016652 Ga0070676_100166523 236
72 3300005328 Ga0070676_10036119 Ga0070676_100361193 236
73 3300005328 Ga0070676_10082648 Ga0070676_100826482 236
74 3300005328 Ga0070676_10246759 Ga0070676_102467592 236
75 3300005330 Ga0070690_100000857 Ga0070690_1000008578 236
76 3300005331 Ga0070670_100276851 Ga0070670_1002768512 236
77 3300005347 Ga0070668_100355482 Ga0070668_1003554821 236
78 3300005347 Ga0070668_100487648 Ga0070668_1004876482 236
79 3300005353 Ga0070669_100068580 Ga0070669_1000685803 236
80 3300005353 Ga0070669_100319693 Ga0070669_1003196931 236
81 3300005354 Ga0070675_100035554 Ga0070675_1000355542 236
82 3300005354 Ga0070675_100251712 Ga0070675_1002517123 236
83 3300005354 Ga0070675_100334862 Ga0070675_1003348622 236
84 3300005355 Ga0070671_100085184 Ga0070671_1000851843 236
85 3300005355 Ga0070671_100197249 Ga0070671_1001972492 236
86 3300005364 Ga0070673_100090420 Ga0070673_1000904202 236
87 3300005367 Ga0070667_100333577 Ga0070667_1003335772 236
88 3300005441 Ga0070700_100025029 Ga0070700_1000250292 236
89 3300005441 Ga0070700_100110172 Ga0070700_1001101723 236
90 3300005444 Ga0070694_100404932 Ga0070694_1004049322 236
91 3300005457 Ga0070662_100209315 Ga0070662_1002093152 236
92 3300005457 Ga0070662_100392312 Ga0070662_1003923122 236
93 3300005459 Ga0068867_100040588 Ga0068867_1000405884 236
94 3300005459 Ga0068867_100068904 Ga0068867_1000689042 236
95 3300005530 Ga0070679_100615694 Ga0070679_1006156941 236
96 3300005539 Ga0068853_100139015 Ga0068853_1001390152 236
97 3300005543 Ga0070672_100038046 Ga0070672_1000380464 236
98 3300005543 Ga0070672_100304381 Ga0070672_1003043812 236
99 3300005563 Ga0068855_101011226 Ga0068855_1010112261 236
100 3300005577 Ga0068857_100269993 Ga0068857_1002699932 236
101 3300005577 Ga0068857_100759170 Ga0068857_1007591701 236
102 3300005719 Ga0068861_100164541 Ga0068861_1001645413 236
103 3300005841 Ga0068863_100460005 Ga0068863_1004600052 236
104 3300005842 Ga0068858_100000318 Ga0068858_10000031827 236
105 3300005844 Ga0068862_100274922 Ga0068862_1002749222 236
106 3300005937 Ga0081455_10315218 Ga0081455_103152182 236
107 3300006038 Ga0075365_10269779 Ga0075365_102697791 236
108 3300006051 Ga0075364_10149717 Ga0075364_101497172 236
109 3300006051 Ga0075364_10238658 Ga0075364_102386582 236
110 3300006051 Ga0075364_10314550 Ga0075364_103145502 236
111 3300006177 Ga0075362_10029630 Ga0075362_100296302 236
112 3300006177 Ga0075362_10030432 Ga0075362_100304324 236
113 3300006178 Ga0075367_10115586 Ga0075367_101155862 236
114 3300006178 Ga0075367_10216224 Ga0075367_102162242 236
115 3300006195 Ga0075366_10030386 Ga0075366_100303862 236
116 3300006195 Ga0075366_10152908 Ga0075366_101529082 236
117 3300006237 Ga0097621_100002041 Ga0097621_1000020414 236
118 3300006237 Ga0097621_100338866 Ga0097621_1003388661 236
119 3300006358 Ga0068871_100002322 Ga0068871_1000023223 236
120 3300006881 Ga0068865_100128545 Ga0068865_1001285452 236
121 3300006881 Ga0068865_100138221 Ga0068865_1001382212 236
122 3300006931 Ga0097620_100718397 Ga0097620_1007183971 236
123 3300009094 Ga0111539_10158167 Ga0111539_101581673 236
124 3300009094 Ga0111539_10771889 Ga0111539_107718892 236
125 3300009098 Ga0105245_10001471 Ga0105245_1000147115 236
126 3300009148 Ga0105243_10410560 Ga0105243_104105602 236
127 3300009148 Ga0105243_10826364 Ga0105243_108263641 236
128 3300010375 Ga0105239_10597738 Ga0105239_105977381 236
129 3300013250 Ga0171462_1045 Ga0171462_104536 236
130 3300013297 Ga0157378_10277596 Ga0157378_102775962 236
131 3300013306 Ga0163162_10560517 Ga0163162_105605172 236
132 3300013308 Ga0157375_10039099 Ga0157375_100390993 236
133 3300014326 Ga0157380_10022349 Ga0157380_100223494 236
134 3300014326 Ga0157380_10053544 Ga0157380_100535444 236
135 3300014326 Ga0157380_10281387 Ga0157380_102813872 236
136 3300017792 Ga0163161_10387846 Ga0163161_103878462 236
137 3300025294 Ga0209025_1000016 Ga0209025_1000016444 236
138 3300025294 Ga0209025_1075336 Ga0209025_10753362 236
139 3300025295 Ga0209564_1000076 Ga0209564_100007685 236
140 3300025299 Ga0209256_1000083 Ga0209256_100008385 236
141 3300025299 Ga0209256_1002896 Ga0209256_10028966 236
142 3300025907 Ga0207645_10038121 Ga0207645_100381213 236
143 3300025907 Ga0207645_10088731 Ga0207645_100887312 236
144 3300025907 Ga0207645_10207518 Ga0207645_102075182 236
145 3300025921 Ga0207652_10633583 Ga0207652_106335831 236
146 3300025926 Ga0207659_10074785 Ga0207659_100747853 236
147 3300025927 Ga0207687_10001257 Ga0207687_1000125712 236
148 3300025933 Ga0207706_10176351 Ga0207706_101763512 236
149 3300025933 Ga0207706_10435785 Ga0207706_104357852 236
150 3300025938 Ga0207704_10130501 Ga0207704_101305012 236
151 3300025938 Ga0207704_10705897 Ga0207704_107058971 236
152 3300025940 Ga0207691_10002479 Ga0207691_100024793 236
153 3300025940 Ga0207691_10627663 Ga0207691_106276631 236
154 3300025945 Ga0207679_10241829 Ga0207679_102418292 236
155 3300025960 Ga0207651_10075202 Ga0207651_100752023 236
156 3300025972 Ga0207668_10292463 Ga0207668_102924632 236
157 3300025972 Ga0207668_10425408 Ga0207668_104254081 236
158 3300025981 Ga0207640_10682372 Ga0207640_106823721 236
159 3300026035 Ga0207703_10004368 Ga0207703_100043687 236
160 3300026075 Ga0207708_10009902 Ga0207708_100099025 236
161 3300026088 Ga0207641_10031322 Ga0207641_100313223 236
162 3300026089 Ga0207648_10074433 Ga0207648_100744332 236
163 3300026118 Ga0207675_100109265 Ga0207675_1001092652 236
164 3300026118 Ga0207675_100301892 Ga0207675_1003018922 236
165 3300031731 Ga0307405_10004054 Ga0307405_100040548 236
166 3300031824 Ga0307413_10028415 Ga0307413_100284155 236
167 3300031824 Ga0307413_10555109 Ga0307413_105551092 236
168 3300032002 Ga0307416_100731774 Ga0307416_1007317741 236
169 3300035117 Ga0373953_0012233 Ga0373953_0012233_470_1183 236
170 3300035118 Ga0373954_0032919 Ga0373954_0032919_1407_2120 236
171 3300035410 Ga0373924_0005515 Ga0373924_0005515_576_1289 236
172 3300035692 Ga0373935_0373196 Ga0373935_0373196_60_773 236
173 3300035724 Ga0373933_0053543 Ga0373933_0053543_474_1187 236
174 3300036401 Ga0373937_0261786 Ga0373937_0261786_884_1597 236
175 3300036401 Ga0373937_0294166 Ga0373937_0294166_246_959 236
176 3300037312 Ga0395899_0032112 Ga0395899_0032112_385_1119 236
177 3300037312 Ga0395899_0122289 Ga0395899_0122289_140_898 236
178 3300037418 Ga0395900_0056710 Ga0395900_0056710_1521_2279 236
179 3300037418 Ga0395900_0167869 Ga0395900_0167869_694_1428 236
180 3300037418 Ga0395900_0192160 Ga0395900_0192160_164_898 236
181 3300037466 Ga0395898_0220985 Ga0395898_0220985_451_1185 236
182 3300037471 Ga0395905_0034610 Ga0395905_0034610_1441_2175 236
183 3300037471 Ga0395905_0100066 Ga0395905_0100066_516_1274 236
184 3300037471 Ga0395905_0562865 Ga0395905_0562865_58_816 236
185 3300038443 Ga0395901_0010662 Ga0395901_0010662_3229_3987 236
186 3300038443 Ga0395901_0046767 Ga0395901_0046767_126_860 236
187 3300038443 Ga0395901_0076679 Ga0395901_0076679_369_1127 236
188 3300038443 Ga0395901_0120911 Ga0395901_0120911_1525_2256 236
189 3300039145 Ga0237816_01700 Ga0237816_01700_324_1037 236
190 3300046454 Ga0495592_0038235 Ga0495592_0038235_2616_3329 236
191 3300046459 Ga0495629_0027980 Ga0495629_0027980_861_1574 236
192 3300046463 Ga0495653_0017397 Ga0495653_0017397_539_1252 236
193 3300046477 Ga0495664_0212688 Ga0495664_0212688_124_837 236
194 3300046511 Ga0495608_0016441 Ga0495608_0016441_2082_2795 236
195 3300046517 Ga0495630_0036902 Ga0495630_0036902_1460_2173 236
196 3300046529 Ga0495652_0156991 Ga0495652_0156991_839_1552 236
197 3300046533 Ga0495640_0003772 Ga0495640_0003772_9565_10278 236
198 3300046535 Ga0495586_0267904 Ga0495586_0267904_164_877 236
199 3300046543 Ga0495645_0266154 Ga0495645_0266154_66_779 236
200 3300046559 Ga0495667_0041413 Ga0495667_0041413_1584_2297 236
201 3300046642 Ga0495634_0009029 Ga0495634_0009029_2110_2823 236
202 3300046660 Ga0495625_0031870 Ga0495625_0031870_3181_3894 236
203 3300046660 Ga0495625_0217587 Ga0495625_0217587_396_1136 236
204 3300046663 Ga0495635_0005370 Ga0495635_0005370_7480_8193 236
205 3300046678 Ga0495599_0246029 Ga0495599_0246029_158_871 236
206 3300046680 Ga0495646_0015685 Ga0495646_0015685_470_1183 236
207 3300046681 Ga0495647_0136946 Ga0495647_0136946_251_964 236
208 3300046684 Ga0495669_0000691 Ga0495669_0000691_12557_13297 236
209 3300046689 Ga0495613_0266069 Ga0495613_0266069_470_1183 236
210 3300046690 Ga0495624_0065285 Ga0495624_0065285_140_853 236
211 3300046809 Ga0495600_0050936 Ga0495600_0050936_1293_2006 236
212 3300047315 Ga0495581_0093842 Ga0495581_0093842_843_1556 236
213 3300047317 Ga0495604_0002468 Ga0495604_0002468_13185_13898 236
214 3300047319 Ga0495674_0002597 Ga0495674_0002597_15329_16042 236
215 3300047322 Ga0495680_0006886 Ga0495680_0006886_8050_8763 236
216 3300047444 Ga0495675_0085415 Ga0495675_0085415_1064_1777 236
217 3300047471 Ga0495684_0043679 Ga0495684_0043679_938_1651 236
218 3300048088 Ga0495602_0062499 Ga0495602_0062499_555_1268 236
219 3300048912 Ga0496109_0342971 Ga0496109_0342971_79_792 236
220 3300048913 Ga0496110_0117673 Ga0496110_0117673_1200_1940 236
221 3300048917 Ga0496114_0115522 Ga0496114_0115522_961_1674 236
222 3300048918 Ga0496115_0619335 Ga0496115_0619335_13_726 236
223 3300048920 Ga0496117_0052793 Ga0496117_0052793_1517_2230 236
224 3300048925 Ga0496122_0022949 Ga0496122_0022949_231_944 236
225 3300048925 Ga0496122_0208254 Ga0496122_0208254_154_867 236
226 3300048926 Ga0496123_0041927 Ga0496123_0041927_2135_2848 236
227 3300048926 Ga0496123_0086227 Ga0496123_0086227_955_1668 236
228 3300048928 Ga0496125_0087806 Ga0496125_0087806_346_1068 236
229 3300049572 Ga0501036_0131748 Ga0501036_0131748_151_864 236
230 3300049577 Ga0501041_0349067 Ga0501041_0349067_204_917 236
231 3300049578 Ga0501042_0089563 Ga0501042_0089563_614_1327 236
232 3300049578 Ga0501042_0295178 Ga0501042_0295178_394_1107 236
233 3300049581 Ga0501047_0324545 Ga0501047_0324545_269_982 236
234 3300049583 Ga0501067_0095853 Ga0501067_0095853_69_782 236
235 3300049584 Ga0501068_0000308 Ga0501068_0000308_7499_8227 236
236 3300049584 Ga0501068_0019639 Ga0501068_0019639_195_908 236
237 3300049585 Ga0501069_0042863 Ga0501069_0042863_1378_2106 236
238 3300049586 Ga0501070_0026692 Ga0501070_0026692_3112_3825 236
239 3300049586 Ga0501070_0234987 Ga0501070_0234987_308_1036 236
240 3300049587 Ga0501071_0028442 Ga0501071_0028442_1271_1999 236
241 3300049587 Ga0501071_0094772 Ga0501071_0094772_1015_1728 236
242 3300049587 Ga0501071_0170166 Ga0501071_0170166_74_787 236
243 3300049588 Ga0501072_0005081 Ga0501072_0005081_1245_1973 236
244 3300049588 Ga0501072_0544800 Ga0501072_0544800_133_846 236
245 3300049589 Ga0501073_0000671 Ga0501073_0000671_12584_13312 236
246 3300049589 Ga0501073_0000671 Ga0501073_0000671_3486_4199 236
247 3300049590 Ga0501074_0000926 Ga0501074_0000926_6999_7727 236
248 3300049590 Ga0501074_0300278 Ga0501074_0300278_296_1009 236
249 3300049591 Ga0501075_0027830 Ga0501075_0027830_2403_3131 236
250 3300049592 Ga0501076_0318703 Ga0501076_0318703_393_1106 236
251 3300049593 Ga0501077_0023354 Ga0501077_0023354_2167_2895 236
252 3300049593 Ga0501077_0214446 Ga0501077_0214446_461_1174 236
253 3300049741 Ga0501079_0011184 Ga0501079_0011184_3434_4147 236
254 3300049741 Ga0501079_0013454 Ga0501079_0013454_3236_3964 236
255 3300049742 Ga0501080_0002630 Ga0501080_0002630_8209_8937 236
256 3300049742 Ga0501080_0016670 Ga0501080_0016670_2607_3320 236
257 3300049744 Ga0501083_0059698 Ga0501083_0059698_510_1238 236
258 3300049744 Ga0501083_0143162 Ga0501083_0143162_88_801 236
259 3300050489 nmdc:mga03683_112313_c1 nmdc:mga03683_112313_c1_401_1114 236
260 3300050489 nmdc:mga03683_20740_c1 nmdc:mga03683_20740_c1_1073_1786 236
261 3300050493 nmdc:mga0k408_137650_c1 nmdc:mga0k408_137650_c1_529_1242 236
262 3300050493 nmdc:mga0k408_25689_c1 nmdc:mga0k408_25689_c1_339_1055 236
263 3300050494 nmdc:mga06z11_122085_c1 nmdc:mga06z11_122085_c1_30_743 236
264 3300050511 nmdc:mga08y16_633237_c1 nmdc:mga08y16_633237_c1_326_1039 236
265 3300050516 nmdc:mga0sz30_11926_c1 nmdc:mga0sz30_11926_c1_1082_1798 236
266 3300050516 nmdc:mga0sz30_4626_c1 nmdc:mga0sz30_4626_c1_2672_3385 236
267 3300053077 Ga0495601_0007858 Ga0495601_0007858_4314_5027 236
268 3300053078 Ga0495612_0012043 Ga0495612_0012043_2247_2960 236
269 3300053083 Ga0495655_0049749 Ga0495655_0049749_122_862 236
270 3300053084 Ga0495595_0017419 Ga0495595_0017419_372_1085 236
271 3300053085 Ga0495619_0012574 Ga0495619_0012574_712_1425 236
272 3300053088 Ga0500644_0112384 Ga0500644_0112384_27_740 236
273 3300053140 Ga0500573_0000022 Ga0500573_0000022_152522_153238 236
274 3300053153 Ga0500616_0000123 Ga0500616_0000123_33886_34605 236
275 3300053733 Ga0500552_000397 Ga0500552_000397_2200_2913 236
276 3300054114 Ga0501084_0010540 Ga0501084_0010540_3474_4187 236
277 3300059421 Ga0590071_033434 Ga0590071_033434_95_856 236
278 3300059426 Ga0590077_007651 Ga0590077_007651_48_809 236
279 3300060353 Ga0501082_0014265 Ga0501082_0014265_5618_6331 236
280 3300060353 Ga0501082_0014811 Ga0501082_0014811_2732_3460 236
281 3300005262 Ga0065165_1003945 Ga0065165_10039454 237
282 3300005367 Ga0070667_100025515 Ga0070667_1000255151 237
283 3300005539 Ga0068853_100982694 Ga0068853_1009826941 237
284 3300005548 Ga0070665_100032170 Ga0070665_1000321702 237
285 3300005548 Ga0070665_100819222 Ga0070665_1008192222 237
286 3300005617 Ga0068859_100031726 Ga0068859_1000317263 237
287 3300005842 Ga0068858_100023685 Ga0068858_1000236853 237
288 3300005843 Ga0068860_100053433 Ga0068860_1000534332 237
289 3300005844 Ga0068862_100019112 Ga0068862_1000191125 237
290 3300006931 Ga0097620_100031725 Ga0097620_1000317253 237
291 3300009101 Ga0105247_10002556 Ga0105247_1000255610 237
292 3300009177 Ga0105248_11009374 Ga0105248_110093741 237
293 3300025315 Ga0207697_10125308 Ga0207697_101253082 237
294 3300025900 Ga0207710_10002920 Ga0207710_100029206 237
295 3300025923 Ga0207681_10351833 Ga0207681_103518332 237
296 3300028379 Ga0268266_10002973 Ga0268266_1000297314 237
297 3300028380 Ga0268265_10033676 Ga0268265_100336763 237
298 3300028381 Ga0268264_10026990 Ga0268264_100269904 237
299 3300031548 Ga0307408_100207280 Ga0307408_1002072802 237
300 3300031852 Ga0307410_10144649 Ga0307410_101446492 237
301 3300031995 Ga0307409_100080639 Ga0307409_1000806392 237
302 3300032005 Ga0307411_10074810 Ga0307411_100748102 237
303 3300046460 Ga0495638_0002975 Ga0495638_0002975_2828_3547 237
304 3300046507 Ga0495606_0173926 Ga0495606_0173926_244_969 237
305 3300046660 Ga0495625_0139285 Ga0495625_0139285_80_799 237
306 3300046691 Ga0495670_0018122 Ga0495670_0018122_1403_2125 237
307 3300047472 Ga0495686_0221284 Ga0495686_0221284_235_954 237
308 3300048905 Ga0496102_0029469 Ga0496102_0029469_3153_3872 237
309 3300048922 Ga0496119_0017268 Ga0496119_0017268_304_1020 237
310 3300048924 Ga0496121_0002128 Ga0496121_0002128_18157_18876 237
311 3300048924 Ga0496121_0028474 Ga0496121_0028474_1752_2468 237
312 3300048924 Ga0496121_0285638 Ga0496121_0285638_199_915 237
313 3300048928 Ga0496125_0032702 Ga0496125_0032702_1426_2142 237
314 3300049515 Ga0501292_000003 Ga0501292_000003_139084_139800 237
315 3300049517 Ga0501294_000294 Ga0501294_000294_2817_3533 237
316 3300049523 Ga0501300_000197 Ga0501300_000197_3959_4675 237
317 3300049652 Ga0501202_036608 Ga0501202_036608_296_1012 237
318 3300049653 Ga0501206_023323 Ga0501206_023323_38_754 237
319 3300049662 Ga0501222_000197 Ga0501222_000197_8762_9478 237
320 3300049664 Ga0501224_003301 Ga0501224_003301_1288_2004 237
321 3300049665 Ga0501227_000365 Ga0501227_000365_75_791 237
322 3300049668 Ga0501233_002537 Ga0501233_002537_750_1466 237
323 3300049669 Ga0501235_022492 Ga0501235_022492_446_1162 237
324 3300049670 Ga0501236_004811 Ga0501236_004811_791_1507 237
325 3300049686 Ga0501257_020481 Ga0501257_020481_282_998 237
326 3300049688 Ga0501259_000022 Ga0501259_000022_1454_2170 237
327 3300049690 Ga0501261_000007 Ga0501261_000007_22133_22849 237
328 3300049704 Ga0501221_007955 Ga0501221_007955_536_1252 237
329 3300049705 Ga0501225_0003127 Ga0501225_0003127_1985_2701 237
330 3300049706 Ga0501229_004563 Ga0501229_004563_136_852 237
331 3300049708 Ga0501245_000064 Ga0501245_000064_5429_6145 237
332 3300049775 Ga0501279_000009 Ga0501279_000009_109956_110672 237
333 3300049776 Ga0501280_000047 Ga0501280_000047_22528_23244 237
334 3300049777 Ga0501281_00349 Ga0501281_00349_1129_1845 237
335 3300049778 Ga0501282_000100 Ga0501282_000100_5153_5869 237
336 3300049779 Ga0501283_000412 Ga0501283_000412_4477_5193 237
337 3300053094 Ga0500566_0003208 Ga0500566_0003208_4684_5409 237
338 3300053134 Ga0500658_0010929 Ga0500658_0010929_993_1712 237
339 2162886007 SwRhRL2b_contig_2489364 SwRhRL2b_0179.00000770 238
340 3300001904 JGI24736J21556_1000009 JGI24736J21556_100000935 238
341 3300001915 JGI24741J21665_1006527 JGI24741J21665_10065274 238
342 3300001977 JGI24746J21847_1013136 JGI24746J21847_10131361 238
343 3300001979 JGI24740J21852_10014316 JGI24740J21852_100143162 238
344 3300001989 JGI24739J22299_10008729 JGI24739J22299_100087295 238
345 3300001990 JGI24737J22298_10003516 JGI24737J22298_100035164 238
346 3300001990 JGI24737J22298_10023018 JGI24737J22298_100230183 238
347 3300001990 JGI24737J22298_10027045 JGI24737J22298_100270452 238
348 3300002070 JGI24750J21931_1006614 JGI24750J21931_10066142 238
349 3300002074 JGI24748J21848_1000026 JGI24748J21848_1000026115 238
350 3300002075 JGI24738J21930_10001213 JGI24738J21930_100012136 238
351 3300002076 JGI24749J21850_1000317 JGI24749J21850_10003179 238
352 3300002239 JGI24034J26672_10000015 JGI24034J26672_1000001548 238
353 3300002239 JGI24034J26672_10009293 JGI24034J26672_100092932 238
354 3300002244 JGI24742J22300_10010745 JGI24742J22300_100107451 238
355 3300003659 JGI25404J52841_10000309 JGI25404J52841_100003095 238
356 3300005289 Ga0065704_10101397 Ga0065704_101013973 238
357 3300005289 Ga0065704_10153660 Ga0065704_101536602 238
358 3300005295 Ga0065707_10081800 Ga0065707_1008180021 238
359 3300005295 Ga0065707_10082647 Ga0065707_100826478 238
360 3300005327 Ga0070658_10019332 Ga0070658_100193326 238
361 3300005329 Ga0070683_100834785 Ga0070683_1008347851 238
362 3300005330 Ga0070690_100000025 Ga0070690_10000002546 238
363 3300005333 Ga0070677_10000102 Ga0070677_1000010219 238
364 3300005335 Ga0070666_10000015 Ga0070666_10000015181 238
365 3300005338 Ga0068868_100000162 Ga0068868_1000001623 238
366 3300005338 Ga0068868_100063449 Ga0068868_1000634494 238
367 3300005338 Ga0068868_100262021 Ga0068868_1002620212 238
368 3300005339 Ga0070660_100000258 Ga0070660_10000025826 238
369 3300005340 Ga0070689_100026195 Ga0070689_1000261956 238
370 3300005344 Ga0070661_100078990 Ga0070661_1000789902 238
371 3300005347 Ga0070668_100072852 Ga0070668_1000728525 238
372 3300005347 Ga0070668_100109463 Ga0070668_1001094632 238
373 3300005347 Ga0070668_100118867 Ga0070668_1001188671 238
374 3300005353 Ga0070669_100000059 Ga0070669_10000005981 238
375 3300005354 Ga0070675_100080959 Ga0070675_1000809593 238
376 3300005354 Ga0070675_100381273 Ga0070675_1003812731 238
377 3300005355 Ga0070671_100009469 Ga0070671_1000094696 238
378 3300005355 Ga0070671_100081004 Ga0070671_1000810044 238
379 3300005355 Ga0070671_100455515 Ga0070671_1004555152 238
380 3300005365 Ga0070688_100013459 Ga0070688_1000134596 238
381 3300005365 Ga0070688_100045193 Ga0070688_1000451933 238
382 3300005366 Ga0070659_100000022 Ga0070659_10000002284 238
383 3300005366 Ga0070659_100098281 Ga0070659_1000982811 238
384 3300005367 Ga0070667_100017737 Ga0070667_1000177371 238
385 3300005441 Ga0070700_100085949 Ga0070700_1000859493 238
386 3300005455 Ga0070663_100009775 Ga0070663_1000097754 238
387 3300005456 Ga0070678_100019428 Ga0070678_1000194285 238
388 3300005456 Ga0070678_100657701 Ga0070678_1006577011 238
389 3300005457 Ga0070662_100074410 Ga0070662_1000744103 238
390 3300005457 Ga0070662_100104860 Ga0070662_1001048602 238
391 3300005457 Ga0070662_100319550 Ga0070662_1003195501 238
392 3300005466 Ga0070685_10000247 Ga0070685_1000024732 238
393 3300005535 Ga0070684_100048210 Ga0070684_1000482102 238
394 3300005539 Ga0068853_100006432 Ga0068853_1000064327 238
395 3300005543 Ga0070672_100059603 Ga0070672_1000596034 238
396 3300005543 Ga0070672_100466143 Ga0070672_1004661431 238
397 3300005544 Ga0070686_100000006 Ga0070686_10000000672 238
398 3300005544 Ga0070686_100000071 Ga0070686_10000007173 238
399 3300005544 Ga0070686_100100933 Ga0070686_1001009332 238
400 3300005548 Ga0070665_100000217 Ga0070665_10000021767 238
401 3300005548 Ga0070665_100003467 Ga0070665_1000034676 238
402 3300005548 Ga0070665_100056643 Ga0070665_1000566433 238
403 3300005548 Ga0070665_100060021 Ga0070665_1000600211 238
404 3300005549 Ga0070704_100405218 Ga0070704_1004052181 238
405 3300005564 Ga0070664_100108890 Ga0070664_1001088903 238
406 3300005564 Ga0070664_100267134 Ga0070664_1002671341 238
407 3300005577 Ga0068857_100080184 Ga0068857_1000801841 238
408 3300005577 Ga0068857_100208552 Ga0068857_1002085522 238
409 3300005614 Ga0068856_100169667 Ga0068856_1001696673 238
410 3300005614 Ga0068856_100279622 Ga0068856_1002796222 238
411 3300005616 Ga0068852_100026293 Ga0068852_1000262933 238
412 3300005617 Ga0068859_100000937 Ga0068859_1000009376 238
413 3300005617 Ga0068859_100532863 Ga0068859_1005328632 238
414 3300005617 Ga0068859_100575925 Ga0068859_1005759252 238
415 3300005618 Ga0068864_100009352 Ga0068864_1000093527 238
416 3300005618 Ga0068864_100017721 Ga0068864_1000177216 238
417 3300005718 Ga0068866_10266255 Ga0068866_102662551 238
418 3300005719 Ga0068861_100006465 Ga0068861_1000064656 238
419 3300005834 Ga0068851_10072312 Ga0068851_100723122 238
420 3300005841 Ga0068863_100000108 Ga0068863_10000010854 238
421 3300005841 Ga0068863_100001030 Ga0068863_10000103025 238
422 3300005841 Ga0068863_100045028 Ga0068863_1000450283 238
423 3300005842 Ga0068858_100002534 Ga0068858_1000025347 238
424 3300005842 Ga0068858_100061649 Ga0068858_1000616494 238
425 3300005842 Ga0068858_100103238 Ga0068858_1001032383 238
426 3300005843 Ga0068860_100000050 Ga0068860_100000050182 238
427 3300005843 Ga0068860_100000554 Ga0068860_10000055410 238
428 3300005843 Ga0068860_100031734 Ga0068860_1000317344 238
429 3300005844 Ga0068862_100000062 Ga0068862_10000006247 238
430 3300005937 Ga0081455_10000097 Ga0081455_1000009719 238
431 3300005983 Ga0081540_1000022 Ga0081540_1000022101 238
432 3300006042 Ga0075368_10149628 Ga0075368_101496281 238
433 3300006051 Ga0075364_10167736 Ga0075364_101677362 238
434 3300006051 Ga0075364_10191021 Ga0075364_101910212 238
435 3300006177 Ga0075362_10004105 Ga0075362_100041052 238
436 3300006177 Ga0075362_10155918 Ga0075362_101559181 238
437 3300006178 Ga0075367_10015975 Ga0075367_100159755 238
438 3300006186 Ga0075369_10002148 Ga0075369_100021482 238
439 3300006195 Ga0075366_10003581 Ga0075366_100035814 238
440 3300006844 Ga0075428_100091137 Ga0075428_1000911374 238
441 3300006844 Ga0075428_100206495 Ga0075428_1002064953 238
442 3300006846 Ga0075430_100007463 Ga0075430_10000746311 238
443 3300006847 Ga0075431_100042139 Ga0075431_1000421394 238
444 3300006852 Ga0075433_10000419 Ga0075433_1000041915 238
445 3300006871 Ga0075434_100030445 Ga0075434_1000304452 238
446 3300006871 Ga0075434_100120245 Ga0075434_1001202454 238
447 3300006881 Ga0068865_100093229 Ga0068865_1000932293 238
448 3300006931 Ga0097620_100000937 Ga0097620_10000093732 238
449 3300006931 Ga0097620_100532981 Ga0097620_1005329812 238
450 3300006931 Ga0097620_100575915 Ga0097620_1005759152 238
451 3300007076 Ga0075435_100026131 Ga0075435_1000261312 238
452 3300009094 Ga0111539_10004649 Ga0111539_1000464911 238
453 3300009094 Ga0111539_10094756 Ga0111539_100947562 238
454 3300009098 Ga0105245_10019787 Ga0105245_100197876 238
455 3300009098 Ga0105245_10423399 Ga0105245_104233992 238
456 3300009101 Ga0105247_10035281 Ga0105247_100352815 238
457 3300009147 Ga0114129_10271306 Ga0114129_102713062 238
458 3300009148 Ga0105243_10259015 Ga0105243_102590153 238
459 3300009176 Ga0105242_10252125 Ga0105242_102521252 238
460 3300009177 Ga0105248_10021965 Ga0105248_100219652 238
461 3300009177 Ga0105248_10141927 Ga0105248_101419272 238
462 3300009545 Ga0105237_10612819 Ga0105237_106128192 238
463 3300009551 Ga0105238_10082901 Ga0105238_100829015 238
464 3300009551 Ga0105238_10149933 Ga0105238_101499332 238
465 3300009551 Ga0105238_10180155 Ga0105238_101801552 238
466 3300009553 Ga0105249_10000034 Ga0105249_1000003445 238
467 3300009553 Ga0105249_10219888 Ga0105249_102198883 238
468 3300010375 Ga0105239_10002028 Ga0105239_100020282 238
469 3300010375 Ga0105239_10494856 Ga0105239_104948562 238
470 3300010375 Ga0105239_10606825 Ga0105239_106068252 238
471 3300011119 Ga0105246_10389494 Ga0105246_103894942 238
472 3300013100 Ga0157373_10026314 Ga0157373_100263145 238
473 3300013104 Ga0157370_10075929 Ga0157370_100759294 238
474 3300013104 Ga0157370_10330166 Ga0157370_103301661 238
475 3300013105 Ga0157369_10085137 Ga0157369_100851373 238
476 3300013296 Ga0157374_10168565 Ga0157374_101685653 238
477 3300013296 Ga0157374_11221556 Ga0157374_112215561 238
478 3300013306 Ga0163162_10046132 Ga0163162_100461324 238
479 3300013306 Ga0163162_10106873 Ga0163162_101068732 238
480 3300013306 Ga0163162_10109407 Ga0163162_101094071 238
481 3300013307 Ga0157372_10305352 Ga0157372_103053522 238
482 3300014325 Ga0163163_10041149 Ga0163163_100411496 238
483 3300014326 Ga0157380_10000231 Ga0157380_1000023114 238
484 3300014326 Ga0157380_10000478 Ga0157380_1000047817 238
485 3300014326 Ga0157380_10011127 Ga0157380_100111274 238
486 3300014326 Ga0157380_10077239 Ga0157380_100772394 238
487 3300014326 Ga0157380_10288088 Ga0157380_102880882 238
488 3300014745 Ga0157377_10035540 Ga0157377_100355402 238
489 3300014745 Ga0157377_10151118 Ga0157377_101511182 238
490 3300014968 Ga0157379_10005954 Ga0157379_100059546 238
491 3300014968 Ga0157379_10145306 Ga0157379_101453063 238
492 3300014969 Ga0157376_10361570 Ga0157376_103615702 238
493 3300017792 Ga0163161_10000051 Ga0163161_10000051107 238
494 3300017792 Ga0163161_10566226 Ga0163161_105662261 238
495 3300020069 Ga0197907_10309105 Ga0197907_103091053 238
496 3300021384 Ga0213876_10016920 Ga0213876_100169203 238
497 3300025223 Ga0207672_1000434 Ga0207672_10004348 238
498 3300025302 Ga0207426_1038778 Ga0207426_10387782 238
499 3300025304 Ga0209257_1002163 Ga0209257_10021639 238
500 3300025304 Ga0209257_1030993 Ga0209257_10309933 238
501 3300025321 Ga0207656_10028118 Ga0207656_100281182 238
502 3300025893 Ga0207682_10000779 Ga0207682_100007793 238
503 3300025899 Ga0207642_10040935 Ga0207642_100409353 238
504 3300025900 Ga0207710_10005791 Ga0207710_100057913 238
505 3300025903 Ga0207680_10000007 Ga0207680_10000007449 238
506 3300025904 Ga0207647_10001146 Ga0207647_1000114621 238
507 3300025908 Ga0207643_10003813 Ga0207643_100038134 238
508 3300025909 Ga0207705_10022866 Ga0207705_100228665 238
509 3300025911 Ga0207654_10001455 Ga0207654_100014555 238
510 3300025913 Ga0207695_10004741 Ga0207695_1000474121 238
511 3300025913 Ga0207695_10042299 Ga0207695_100422996 238
512 3300025914 Ga0207671_10000658 Ga0207671_1000065823 238
513 3300025916 Ga0207663_10388710 Ga0207663_103887101 238
514 3300025919 Ga0207657_10003941 Ga0207657_100039415 238
515 3300025919 Ga0207657_10222114 Ga0207657_102221142 238
516 3300025920 Ga0207649_10077647 Ga0207649_100776471 238
517 3300025923 Ga0207681_10000089 Ga0207681_1000008957 238
518 3300025924 Ga0207694_10008129 Ga0207694_100081294 238
519 3300025924 Ga0207694_10042769 Ga0207694_100427692 238
520 3300025924 Ga0207694_10136643 Ga0207694_101366433 238
521 3300025925 Ga0207650_10101038 Ga0207650_101010383 238
522 3300025925 Ga0207650_10126101 Ga0207650_101261012 238
523 3300025926 Ga0207659_10186061 Ga0207659_101860612 238
524 3300025927 Ga0207687_10307529 Ga0207687_103075292 238
525 3300025931 Ga0207644_10004047 Ga0207644_100040477 238
526 3300025932 Ga0207690_10000003 Ga0207690_10000003729 238
527 3300025932 Ga0207690_10250315 Ga0207690_102503151 238
528 3300025933 Ga0207706_10012563 Ga0207706_100125637 238
529 3300025933 Ga0207706_10074552 Ga0207706_100745522 238
530 3300025934 Ga0207686_10412145 Ga0207686_104121452 238
531 3300025934 Ga0207686_10582591 Ga0207686_105825911 238
532 3300025936 Ga0207670_10022662 Ga0207670_100226622 238
533 3300025937 Ga0207669_10014205 Ga0207669_100142054 238
534 3300025940 Ga0207691_10030460 Ga0207691_100304605 238
535 3300025940 Ga0207691_10328122 Ga0207691_103281222 238
536 3300025941 Ga0207711_10002957 Ga0207711_1000295719 238
537 3300025941 Ga0207711_10021097 Ga0207711_100210976 238
538 3300025941 Ga0207711_10204548 Ga0207711_102045482 238
539 3300025942 Ga0207689_10031380 Ga0207689_100313804 238
540 3300025944 Ga0207661_10120168 Ga0207661_101201682 238
541 3300025944 Ga0207661_10305856 Ga0207661_103058563 238
542 3300025945 Ga0207679_10081988 Ga0207679_100819884 238
543 3300025949 Ga0207667_10046245 Ga0207667_100462455 238
544 3300025949 Ga0207667_10696873 Ga0207667_106968731 238
545 3300025961 Ga0207712_10000004 Ga0207712_10000004437 238
546 3300025961 Ga0207712_10084392 Ga0207712_100843921 238
547 3300025961 Ga0207712_10564608 Ga0207712_105646082 238
548 3300025972 Ga0207668_10030478 Ga0207668_100304783 238
549 3300025972 Ga0207668_10196665 Ga0207668_101966653 238
550 3300025972 Ga0207668_10298540 Ga0207668_102985401 238
551 3300025981 Ga0207640_10203787 Ga0207640_102037872 238
552 3300025981 Ga0207640_10229261 Ga0207640_102292612 238
553 3300025986 Ga0207658_10002005 Ga0207658_100020056 238
554 3300026023 Ga0207677_10000154 Ga0207677_100001544 238
555 3300026023 Ga0207677_10489542 Ga0207677_104895421 238
556 3300026035 Ga0207703_10001286 Ga0207703_1000128613 238
557 3300026035 Ga0207703_10006943 Ga0207703_100069433 238
558 3300026035 Ga0207703_10381902 Ga0207703_103819022 238
559 3300026041 Ga0207639_10003651 Ga0207639_100036514 238
560 3300026041 Ga0207639_10227605 Ga0207639_102276052 238
561 3300026041 Ga0207639_10332244 Ga0207639_103322441 238
562 3300026067 Ga0207678_10023624 Ga0207678_100236245 238
563 3300026067 Ga0207678_10169135 Ga0207678_101691352 238
564 3300026075 Ga0207708_10060007 Ga0207708_100600071 238
565 3300026078 Ga0207702_10001915 Ga0207702_1000191519 238
566 3300026088 Ga0207641_10000209 Ga0207641_1000020935 238
567 3300026088 Ga0207641_10000428 Ga0207641_100004287 238
568 3300026088 Ga0207641_10038679 Ga0207641_100386792 238
569 3300026088 Ga0207641_10050427 Ga0207641_100504276 238
570 3300026088 Ga0207641_10521385 Ga0207641_105213852 238
571 3300026089 Ga0207648_10029171 Ga0207648_100291713 238
572 3300026095 Ga0207676_10001679 Ga0207676_100016796 238
573 3300026095 Ga0207676_10079562 Ga0207676_100795623 238
574 3300026116 Ga0207674_10007684 Ga0207674_100076847 238
575 3300026116 Ga0207674_10032587 Ga0207674_100325874 238
576 3300026118 Ga0207675_100000449 Ga0207675_10000044916 238
577 3300026118 Ga0207675_100016886 Ga0207675_1000168864 238
578 3300026121 Ga0207683_10036842 Ga0207683_100368424 238
579 3300026142 Ga0207698_10019699 Ga0207698_100196995 238
580 3300026142 Ga0207698_10283261 Ga0207698_102832612 238
581 3300027866 Ga0209813_10045803 Ga0209813_100458031 238
582 3300027907 Ga0207428_10030363 Ga0207428_100303634 238
583 3300028379 Ga0268266_10000225 Ga0268266_1000022546 238
584 3300028379 Ga0268266_10009750 Ga0268266_100097505 238
585 3300028379 Ga0268266_10138729 Ga0268266_101387293 238
586 3300028379 Ga0268266_10282084 Ga0268266_102820842 238
587 3300028380 Ga0268265_10000086 Ga0268265_1000008697 238
588 3300028380 Ga0268265_10936629 Ga0268265_109366291 238
589 3300028381 Ga0268264_10000003 Ga0268264_10000003451 238
590 3300028381 Ga0268264_10000044 Ga0268264_10000044264 238
591 3300028381 Ga0268264_11190785 Ga0268264_111907851 238
592 3300030521 Ga0307511_10013450 Ga0307511_100134505 238
593 3300031507 Ga0307509_10000016 Ga0307509_10000016103 238
594 3300031548 Ga0307408_100157720 Ga0307408_1001577202 238
595 3300031548 Ga0307408_100668982 Ga0307408_1006689821 238
596 3300031616 Ga0307508_10202239 Ga0307508_102022391 238
597 3300031731 Ga0307405_10079796 Ga0307405_100797964 238
598 3300031731 Ga0307405_10417888 Ga0307405_104178882 238
599 3300031824 Ga0307413_10202997 Ga0307413_102029971 238
600 3300031852 Ga0307410_10066439 Ga0307410_100664392 238
601 3300031901 Ga0307406_10031941 Ga0307406_100319414 238
602 3300031901 Ga0307406_10062785 Ga0307406_100627851 238
603 3300031901 Ga0307406_10205315 Ga0307406_102053152 238
604 3300031911 Ga0307412_10046548 Ga0307412_100465482 238
605 3300031911 Ga0307412_10189750 Ga0307412_101897502 238
606 3300031995 Ga0307409_100332116 Ga0307409_1003321162 238
607 3300031995 Ga0307409_101227144 Ga0307409_1012271441 238
608 3300032004 Ga0307414_10000607 Ga0307414_100006079 238
609 3300032004 Ga0307414_10030871 Ga0307414_100308711 238
610 3300032004 Ga0307414_10045555 Ga0307414_100455551 238
611 3300032004 Ga0307414_10580403 Ga0307414_105804031 238
612 3300032005 Ga0307411_10120380 Ga0307411_101203802 238
613 3300032005 Ga0307411_10313672 Ga0307411_103136722 238
614 3300032126 Ga0307415_100031322 Ga0307415_1000313225 238
615 3300032126 Ga0307415_100213342 Ga0307415_1002133422 238
616 3300035171 Ga0373946_0005530 Ga0373946_0005530_3286_4005 238
617 3300035172 Ga0373955_0340095 Ga0373955_0340095_141_860 238
618 3300035242 Ga0373962_0033882 Ga0373962_0033882_573_1292 238
619 3300035725 Ga0373947_0082426 Ga0373947_0082426_1160_1948 238
620 3300037068 Ga0373925_0077146 Ga0373925_0077146_503_1222 238
621 3300038705 Ga0237819_01311 Ga0237819_01311_2505_3224 238
622 3300039437 Ga0436365_0211517 Ga0436365_0211517_2460_3185 238
623 3300042122 Ga0450920_002276 Ga0450920_002276_2427_3149 238
624 3300042125 Ga0450923_012749 Ga0450923_012749_506_1228 238
625 3300042131 Ga0450894_002291 Ga0450894_002291_1635_2357 238
626 3300042132 Ga0450895_003276 Ga0450895_003276_81_803 238
627 3300042145 Ga0450906_032253 Ga0450906_032253_175_897 238
628 3300042147 Ga0450910_014943 Ga0450910_014943_96_815 238
629 3300042156 Ga0439446_0003219 Ga0439446_0003219_1995_2714 238
630 3300042531 Ga0450918_007305 Ga0450918_007305_976_1698 238
631 3300046452 Ga0495617_063441 Ga0495617_063441_191_910 238
632 3300046457 Ga0495590_0124134 Ga0495590_0124134_118_906 238
633 3300046461 Ga0495641_0043345 Ga0495641_0043345_185_904 238
634 3300046473 Ga0495582_0017692 Ga0495582_0017692_30_818 238
635 3300046475 Ga0495639_0095079 Ga0495639_0095079_101_820 238
636 3300046491 Ga0495584_0205700 Ga0495584_0205700_110_829 238
637 3300046492 Ga0495585_0129286 Ga0495585_0129286_88_876 238
638 3300046501 Ga0495607_0171300 Ga0495607_0171300_64_852 238
639 3300046507 Ga0495606_0329864 Ga0495606_0329864_53_772 238
640 3300046515 Ga0495620_0040613 Ga0495620_0040613_27_815 238
641 3300046516 Ga0495628_0110486 Ga0495628_0110486_16_735 238
642 3300046518 Ga0495631_0121153 Ga0495631_0121153_95_814 238
643 3300046526 Ga0495666_0114793 Ga0495666_0114793_408_1196 238
644 3300046539 Ga0495621_0020218 Ga0495621_0020218_42_761 238
645 3300046559 Ga0495667_0278014 Ga0495667_0278014_93_812 238
646 3300046648 Ga0495611_0267748 Ga0495611_0267748_18_737 238
647 3300046663 Ga0495635_0415215 Ga0495635_0415215_137_856 238
648 3300046664 Ga0495659_0074038 Ga0495659_0074038_534_1253 238
649 3300046665 Ga0495661_0123239 Ga0495661_0123239_562_1281 238
650 3300046689 Ga0495613_0042320 Ga0495613_0042320_257_976 238
651 3300046689 Ga0495613_0190358 Ga0495613_0190358_165_884 238
652 3300046694 Ga0495649_0148309 Ga0495649_0148309_440_1159 238
653 3300047315 Ga0495581_0309379 Ga0495581_0309379_17_805 238
654 3300047471 Ga0495684_0093022 Ga0495684_0093022_201_989 238
655 3300047673 Ga0495593_0101065 Ga0495593_0101065_636_1355 238
656 3300048090 Ga0495615_0052262 Ga0495615_0052262_49_837 238
657 3300048091 Ga0495626_0119582 Ga0495626_0119582_405_1124 238
658 3300048904 Ga0496101_0168156 Ga0496101_0168156_269_988 238
659 3300048904 Ga0496101_0567664 Ga0496101_0567664_160_879 238
660 3300048905 Ga0496102_0035433 Ga0496102_0035433_209_928 238
661 3300048905 Ga0496102_0065734 Ga0496102_0065734_2259_2978 238
662 3300048905 Ga0496102_0158320 Ga0496102_0158320_212_931 238
663 3300048906 Ga0496103_0007410 Ga0496103_0007410_4089_4808 238
664 3300048906 Ga0496103_0015627 Ga0496103_0015627_3536_4255 238
665 3300048907 Ga0496104_0044921 Ga0496104_0044921_2272_2991 238
666 3300048907 Ga0496104_0113736 Ga0496104_0113736_1668_2387 238
667 3300048907 Ga0496104_0212088 Ga0496104_0212088_930_1649 238
668 3300048908 Ga0496105_0025731 Ga0496105_0025731_2834_3553 238
669 3300048908 Ga0496105_0137340 Ga0496105_0137340_1102_1821 238
670 3300048909 Ga0496106_0033684 Ga0496106_0033684_1657_2376 238
671 3300048909 Ga0496106_0036115 Ga0496106_0036115_2916_3635 238
672 3300048910 Ga0496107_0056984 Ga0496107_0056984_238_957 238
673 3300048910 Ga0496107_0469089 Ga0496107_0469089_19_738 238
674 3300048911 Ga0496108_0008694 Ga0496108_0008694_3534_4253 238
675 3300048911 Ga0496108_0028422 Ga0496108_0028422_336_1055 238
676 3300048912 Ga0496109_0014437 Ga0496109_0014437_5297_6016 238
677 3300048912 Ga0496109_0015956 Ga0496109_0015956_1856_2575 238
678 3300048913 Ga0496110_0015800 Ga0496110_0015800_3982_4701 238
679 3300048913 Ga0496110_0096335 Ga0496110_0096335_1772_2491 238
680 3300048914 Ga0496111_0008197 Ga0496111_0008197_1204_1923 238
681 3300048914 Ga0496111_0038006 Ga0496111_0038006_2609_3328 238
682 3300048914 Ga0496111_0054703 Ga0496111_0054703_21_740 238
683 3300048915 Ga0496112_0002369 Ga0496112_0002369_3987_4706 238
684 3300048915 Ga0496112_0122707 Ga0496112_0122707_1641_2360 238
685 3300048916 Ga0496113_0003688 Ga0496113_0003688_3968_4687 238
686 3300048916 Ga0496113_0037136 Ga0496113_0037136_1197_1916 238
687 3300048917 Ga0496114_0013568 Ga0496114_0013568_3564_4283 238
688 3300048918 Ga0496115_0024390 Ga0496115_0024390_238_957 238
689 3300048920 Ga0496117_0000067 Ga0496117_0000067_102471_103190 238
690 3300048920 Ga0496117_0038265 Ga0496117_0038265_1986_2705 238
691 3300048921 Ga0496118_0000021 Ga0496118_0000021_228563_229282 238
692 3300048922 Ga0496119_0000323 Ga0496119_0000323_36368_37087 238
693 3300048922 Ga0496119_0280868 Ga0496119_0280868_41_760 238
694 3300048923 Ga0496120_0000042 Ga0496120_0000042_140764_141483 238
695 3300048923 Ga0496120_0019318 Ga0496120_0019318_474_1193 238
696 3300048924 Ga0496121_0031827 Ga0496121_0031827_237_956 238
697 3300048927 Ga0496124_0377854 Ga0496124_0377854_149_868 238
698 3300048928 Ga0496125_0000533 Ga0496125_0000533_21828_22547 238
699 3300048929 Ga0496126_0041273 Ga0496126_0041273_2520_3239 238
700 3300049568 Ga0501031_0296295 Ga0501031_0296295_75_794 238
701 3300049569 Ga0501032_0053949 Ga0501032_0053949_1096_1815 238
702 3300049570 Ga0501033_0047333 Ga0501033_0047333_220_939 238
703 3300049571 Ga0501034_0252078 Ga0501034_0252078_332_1051 238
704 3300049572 Ga0501036_0011042 Ga0501036_0011042_920_1639 238
705 3300049573 Ga0501037_0088088 Ga0501037_0088088_237_959 238
706 3300049574 Ga0501038_0085233 Ga0501038_0085233_794_1513 238
707 3300049575 Ga0501039_0038875 Ga0501039_0038875_2453_3172 238
708 3300049575 Ga0501039_0197728 Ga0501039_0197728_840_1559 238
709 3300049579 Ga0501043_0016353 Ga0501043_0016353_3579_4298 238
710 3300049579 Ga0501043_0207250 Ga0501043_0207250_402_1124 238
711 3300049580 Ga0501046_0151101 Ga0501046_0151101_818_1537 238
712 3300049581 Ga0501047_0161069 Ga0501047_0161069_1166_1885 238
713 3300049582 Ga0501048_0610296 Ga0501048_0610296_21_740 238
714 3300049584 Ga0501068_0082502 Ga0501068_0082502_39_758 238
715 3300049587 Ga0501071_0381232 Ga0501071_0381232_202_921 238
716 3300049591 Ga0501075_0165224 Ga0501075_0165224_613_1332 238
717 3300049591 Ga0501075_0392160 Ga0501075_0392160_25_744 238
718 3300049592 Ga0501076_0173241 Ga0501076_0173241_675_1394 238
719 3300049592 Ga0501076_0192599 Ga0501076_0192599_449_1168 238
720 3300049592 Ga0501076_0580676 Ga0501076_0580676_129_848 238
721 3300049741 Ga0501079_0262476 Ga0501079_0262476_261_980 238
722 3300049742 Ga0501080_0374316 Ga0501080_0374316_321_1040 238
723 3300049822 Ga0501035_0071455 Ga0501035_0071455_446_1165 238
724 3300049823 Ga0501044_0015007 Ga0501044_0015007_3613_4332 238
725 3300050489 nmdc:mga03683_3715_c1 nmdc:mga03683_3715_c1_4130_4849 238
726 3300050489 nmdc:mga03683_90072_c1 nmdc:mga03683_90072_c1_457_1176 238
727 3300050493 nmdc:mga0k408_6102_c1 nmdc:mga0k408_6102_c1_4123_4842 238
728 3300050496 nmdc:mga07m45_14207_c1 nmdc:mga07m45_14207_c1_2334_3053 238
729 3300050507 nmdc:mga05p37_209805_c1 nmdc:mga05p37_209805_c1_893_1612 238
730 3300050508 nmdc:mga09592_128621_c1 nmdc:mga09592_128621_c1_1447_2166 238
731 3300050509 nmdc:mga0qj67_18511_c1 nmdc:mga0qj67_18511_c1_446_1165 238
732 3300050510 nmdc:mga06r32_12838_c1 nmdc:mga06r32_12838_c1_2388_3107 238
733 3300050511 nmdc:mga08y16_19864_c1 nmdc:mga08y16_19864_c1_2479_3198 238
734 3300050511 nmdc:mga08y16_465329_c1 nmdc:mga08y16_465329_c1_298_1017 238
735 3300050512 nmdc:mga0n895_7477_c1 nmdc:mga0n895_7477_c1_242_970 238
736 3300050513 nmdc:mga0rr50_6155_c1 nmdc:mga0rr50_6155_c1_5061_5780 238
737 3300050515 nmdc:mga0a205_2164_c1 nmdc:mga0a205_2164_c1_2928_3647 238
738 3300050516 nmdc:mga0sz30_531_c2 nmdc:mga0sz30_531_c2_4117_4836 238
739 3300053087 Ga0500643_000475 Ga0500643_000475_3425_4144 238
740 3300053087 Ga0500643_015447 Ga0500643_015447_615_1334 238
741 3300053087 Ga0500643_023162 Ga0500643_023162_1242_1961 238
742 3300053116 Ga0500592_000558 Ga0500592_000558_3237_3962 238
743 3300053139 Ga0500568_0044871 Ga0500568_0044871_253_972 238
744 3300053151 Ga0500604_0008236 Ga0500604_0008236_1004_1729 238
745 3300053158 Ga0500627_0055583 Ga0500627_0055583_475_1194 238
746 3300053178 Ga0500637_0057396 Ga0500637_0057396_1392_2111 238
747 3300053727 Ga0500611_021686 Ga0500611_021686_294_1019 238
748 3300060353 Ga0501082_0540016 Ga0501082_0540016_185_943 238
749 3300006042 Ga0075368_10000156 Ga0075368_100001568 239
750 3300006051 Ga0075364_10007044 Ga0075364_100070446 239
751 3300006195 Ga0075366_10001024 Ga0075366_100010243 239
752 3300006353 Ga0075370_10002971 Ga0075370_100029718 239
753 3300006353 Ga0075370_10115248 Ga0075370_101152482 239
754 3300006946 Ga0079104_1032956 Ga0079104_10329563 239
755 3300032004 Ga0307414_10248475 Ga0307414_102484751 239
756 3300046460 Ga0495638_0126205 Ga0495638_0126205_165_932 239
757 3300050493 nmdc:mga0k408_25599_c1 nmdc:mga0k408_25599_c1_1751_2518 239
758 3300050496 nmdc:mga07m45_63136_c2 nmdc:mga07m45_63136_c2_230_997 239
759 3300050496 nmdc:mga07m45_80550_c1 nmdc:mga07m45_80550_c1_61_828 239
760 3300050496 nmdc:mga07m45_886_c1 nmdc:mga07m45_886_c1_3838_4611 239
761 3300053087 Ga0500643_006666 Ga0500643_006666_522_1289 239
762 3300053119 Ga0500595_022667 Ga0500595_022667_285_1046 239
763 3300053121 Ga0500607_000007 Ga0500607_000007_111111_111878 239
764 3300053121 Ga0500607_001592 Ga0500607_001592_3096_3863 239
765 3300053136 Ga0500559_0001181 Ga0500559_0001181_14237_15004 239
766 3300053156 Ga0500622_0000145 Ga0500622_0000145_27464_28231 239
767 3300053158 Ga0500627_0000028 Ga0500627_0000028_39055_39789 239
768 3300053178 Ga0500637_0021059 Ga0500637_0021059_1694_2461 239
769 3300053730 Ga0500645_002010 Ga0500645_002010_1398_2165 239
770 2162886007 SwRhRL2b_contig_1936816 SwRhRL2b_0051.00006120 240
771 3300001976 JGI24752J21851_1000169 JGI24752J21851_10001697 240
772 3300005289 Ga0065704_10077931 Ga0065704_100779312 240
773 3300005295 Ga0065707_10090060 Ga0065707_100900602 240
774 3300005331 Ga0070670_100000014 Ga0070670_100000014143 240
775 3300005367 Ga0070667_100000144 Ga0070667_10000014478 240
776 3300005617 Ga0068859_100053773 Ga0068859_1000537735 240
777 3300005617 Ga0068859_100286615 Ga0068859_1002866152 240
778 3300005618 Ga0068864_100000021 Ga0068864_100000021154 240
779 3300005841 Ga0068863_100000009 Ga0068863_100000009161 240
780 3300005841 Ga0068863_100029844 Ga0068863_1000298444 240
781 3300005843 Ga0068860_100005428 Ga0068860_1000054283 240
782 3300005844 Ga0068862_100000017 Ga0068862_100000017157 240
783 3300005844 Ga0068862_100000059 Ga0068862_1000000593 240
784 3300006931 Ga0097620_100053773 Ga0097620_1000537735 240
785 3300006931 Ga0097620_100286581 Ga0097620_1002865812 240
786 3300009011 Ga0105251_10000079 Ga0105251_1000007982 240
787 3300009101 Ga0105247_10004620 Ga0105247_100046209 240
788 3300009177 Ga0105248_10000030 Ga0105248_1000003055 240
789 3300009553 Ga0105249_10000065 Ga0105249_10000065105 240
790 3300009553 Ga0105249_10000625 Ga0105249_1000062533 240
791 3300013306 Ga0163162_10091956 Ga0163162_100919563 240
792 3300014325 Ga0163163_10024253 Ga0163163_100242537 240
793 3300014968 Ga0157379_10098918 Ga0157379_100989184 240
794 3300025735 Ga0207713_1001353 Ga0207713_10013538 240
795 3300025900 Ga0207710_10002558 Ga0207710_100025583 240
796 3300025900 Ga0207710_10053912 Ga0207710_100539123 240
797 3300025925 Ga0207650_10000095 Ga0207650_1000009579 240
798 3300025941 Ga0207711_10000029 Ga0207711_1000002955 240
799 3300025961 Ga0207712_10000002 Ga0207712_10000002268 240
800 3300025961 Ga0207712_10000268 Ga0207712_1000026849 240
801 3300025986 Ga0207658_10005485 Ga0207658_100054855 240
802 3300026035 Ga0207703_10258552 Ga0207703_102585522 240
803 3300026088 Ga0207641_10000017 Ga0207641_10000017181 240
804 3300026088 Ga0207641_10027160 Ga0207641_100271602 240
805 3300026095 Ga0207676_10000037 Ga0207676_10000037105 240
806 3300028380 Ga0268265_10000025 Ga0268265_1000002582 240
807 3300028380 Ga0268265_10000141 Ga0268265_1000014142 240
808 3300028381 Ga0268264_10000788 Ga0268264_100007889 240
809 3300031456 Ga0307513_10034806 Ga0307513_100348067 240
810 3300048920 Ga0496117_0008247 Ga0496117_0008247_1232_1954 240
811 3300048921 Ga0496118_0000216 Ga0496118_0000216_77976_78698 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

25

126

0.99

PF07237

DUF1428

Protein of unknown function (DUF1428)

147

248

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9737 1 117
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9704 1 111
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8929 1 117
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8442 1 111
3tvz-assembly3.cif.gz_C structure of bacillus subtilis hmob 0.7299 5 236
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.994 1 117 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9856 1 117 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7199 3 113 3.30.70.100
1xbwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7195 1 108 3.30.70.100
3hx9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7132 125 240 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A526UZL9-F1-model_v4 DUF1428 domain-containing protein 0.9881 36 240
AF-A0A5N7MXK8-F1-model_v4 DUF1428 domain-containing protein 0.988 1 164
AF-A0A547NNR5-F1-model_v4 DUF1428 family protein 0.9861 123 235
AF-A0A7W0XNB7-F1-model_v4 DUF1428 domain-containing protein 0.9857 1 75
AF-A0A658NKC3-F1-model_v4 DUF1428 domain-containing protein 0.9846 131 212

Feature Viewer

pLDDT pTM Quality
95.72 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map