F481880
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 380 | 778 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10327570|Ga0105245_103275702 |
| Length | 338 |
| Sequence | LVLEKKRVLTAHRLDNIAADRENTGLNVLFSFPTPNFEEPTVSEYDKQLQKVKNDKGFIAALDQSGGSTPKALKLYGVNEDAWTNEQGMYDVVHQMRSRIMTSPAFTGKRLLGAILFENTMDRDVAGKPTPTYLWEVKGVVPFLKVDKGLADEKDGVQMMKPMPDLDALLKKAKSKNVFGTKMRSVIKQANAAAIDAVVKQQFEVGKQILAAGLMPIIEPEVDIKTPNKDKAEELLKAAILKELNQLKPDQRVMLKLTIPEKDNLYADLIKHPNVLRVVALSGGYSREESNKRLARQNGMTASFSRALSEGLTKQQSDEEFNKALDASIESIYRASIT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 7 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 8 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 9 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 10 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 11 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 12 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 13 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 14 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 15 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 16 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 17 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 18 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 19 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 20 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 21 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 22 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 23 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 24 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 25 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 26 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 27 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 28 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 29 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 30 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 31 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 32 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 247 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 251 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 252 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 254 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 255 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 256 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 257 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 265 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 266 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 267 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 274 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 282 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 285 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 286 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 287 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 288 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 289 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 290 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 291 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 292 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 293 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 294 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 295 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 296 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 301 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 302 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 303 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 304 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 351 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 353 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 354 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 373 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 379 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 380 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.57 |
| Metatranscriptomes | 0.25 |
| Isolates | 4.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.68 |
| Nodule | 0.99 |
| Rhizoplane | 2.96 |
| Rhizosphere | 85.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1200904 | 2162886007 | Bacteria | 1316 |
| 2 | JGI25406J46586_10011250 | 3300003203 | Bacteria | 3932 |
| 3 | rootH2_10036006 | 3300003320 | Unclassified | 4796 |
| 4 | Ga0055535_1009958 | 3300003761 | Bacteria | 1595 |
| 5 | Ga0055530_10000095 | 3300003791 | Bacteria | 74707 |
| 6 | Ga0055530_10024324 | 3300003791 | Bacteria | 1720 |
| 7 | Ga0055531_10002750 | 3300003794 | Bacteria | 11546 |
| 8 | Ga0055531_10004838 | 3300003794 | Bacteria | 8035 |
| 9 | Ga0055541_1004028 | 3300003841 | Bacteria | 2705 |
| 10 | Ga0065712_10034659 | 3300005290 | Bacteria | 1416 |
| 11 | Ga0065715_10113248 | 3300005293 | Bacteria | 2496 |
| 12 | Ga0065707_10001302 | 3300005295 | Bacteria | 13694 |
| 13 | Ga0065707_10247678 | 3300005295 | Bacteria | 1135 |
| 14 | Ga0070676_10044650 | 3300005328 | Bacteria | 2580 |
| 15 | Ga0070676_10046627 | 3300005328 | Bacteria | 2528 |
| 16 | Ga0070676_10114050 | 3300005328 | Bacteria | 1687 |
| 17 | Ga0070690_100072792 | 3300005330 | Bacteria | 2235 |
| 18 | Ga0070690_100189801 | 3300005330 | Bacteria | 1424 |
| 19 | Ga0070690_100290753 | 3300005330 | Bacteria | 1168 |
| 20 | Ga0070670_100002372 | 3300005331 | Bacteria | 15519 |
| 21 | Ga0070670_100016454 | 3300005331 | Bacteria | 6351 |
| 22 | Ga0070670_100036862 | 3300005331 | Bacteria | 4207 |
| 23 | Ga0070670_100069322 | 3300005331 | Bacteria | 3027 |
| 24 | Ga0070670_100088663 | 3300005331 | Bacteria | 2659 |
| 25 | Ga0070670_100404492 | 3300005331 | Bacteria | 1205 |
| 26 | Ga0068869_100009681 | 3300005334 | Bacteria | 6257 |
| 27 | Ga0068869_100070150 | 3300005334 | Bacteria | 2592 |
| 28 | Ga0068869_100104841 | 3300005334 | Bacteria | 2144 |
| 29 | Ga0070666_10007408 | 3300005335 | Bacteria | 6764 |
| 30 | Ga0070666_10021517 | 3300005335 | Bacteria | 4182 |
| 31 | Ga0070666_10038577 | 3300005335 | Bacteria | 3179 |
| 32 | Ga0070666_10340433 | 3300005335 | Bacteria | 1072 |
| 33 | Ga0070680_100201120 | 3300005336 | Bacteria | 1680 |
| 34 | Ga0070682_100007256 | 3300005337 | Bacteria | 6247 |
| 35 | Ga0068868_100010385 | 3300005338 | Bacteria | 6738 |
| 36 | Ga0068868_100010777 | 3300005338 | Bacteria | 6629 |
| 37 | Ga0068868_100053432 | 3300005338 | Bacteria | 3182 |
| 38 | Ga0070660_100081063 | 3300005339 | Bacteria | 2547 |
| 39 | Ga0070660_100098032 | 3300005339 | Bacteria | 2320 |
| 40 | Ga0070660_100214305 | 3300005339 | Bacteria | 1564 |
| 41 | Ga0070689_100224106 | 3300005340 | Bacteria | 1543 |
| 42 | Ga0070689_100452621 | 3300005340 | Bacteria | 1093 |
| 43 | Ga0070691_10002104 | 3300005341 | Bacteria | 8806 |
| 44 | Ga0070687_100155325 | 3300005343 | Bacteria | 1347 |
| 45 | Ga0070692_10038830 | 3300005345 | Bacteria | 2429 |
| 46 | Ga0070668_100003541 | 3300005347 | Bacteria | 11518 |
| 47 | Ga0070668_100008311 | 3300005347 | Bacteria | 7704 |
| 48 | Ga0070668_100009156 | 3300005347 | Bacteria | 7346 |
| 49 | Ga0070668_100025721 | 3300005347 | Bacteria | 4464 |
| 50 | Ga0070668_100043584 | 3300005347 | Bacteria | 3441 |
| 51 | Ga0070668_100093435 | 3300005347 | Bacteria | 2374 |
| 52 | Ga0070668_100115903 | 3300005347 | Bacteria | 2136 |
| 53 | Ga0070668_100185480 | 3300005347 | Bacteria | 1701 |
| 54 | Ga0070669_100054641 | 3300005353 | Bacteria | 2925 |
| 55 | Ga0070669_100063261 | 3300005353 | Bacteria | 2723 |
| 56 | Ga0070675_100013399 | 3300005354 | Bacteria | 6444 |
| 57 | Ga0070675_100018757 | 3300005354 | Bacteria | 5507 |
| 58 | Ga0070675_100087113 | 3300005354 | Bacteria | 2611 |
| 59 | Ga0070671_100007579 | 3300005355 | Bacteria | 8678 |
| 60 | Ga0070671_100023116 | 3300005355 | Bacteria | 5082 |
| 61 | Ga0070671_100024813 | 3300005355 | Bacteria | 4912 |
| 62 | Ga0070671_100025962 | 3300005355 | Bacteria | 4810 |
| 63 | Ga0070674_100003696 | 3300005356 | Bacteria | 8621 |
| 64 | Ga0070674_100046640 | 3300005356 | Bacteria | 2966 |
| 65 | Ga0070674_100130282 | 3300005356 | Bacteria | 1874 |
| 66 | Ga0070674_100154285 | 3300005356 | Bacteria | 1736 |
| 67 | Ga0070674_100159097 | 3300005356 | Bacteria | 1712 |
| 68 | Ga0070674_100236272 | 3300005356 | Bacteria | 1429 |
| 69 | Ga0070673_100000655 | 3300005364 | Bacteria | 18982 |
| 70 | Ga0070673_100051077 | 3300005364 | Bacteria | 3236 |
| 71 | Ga0070673_100134718 | 3300005364 | Bacteria | 2078 |
| 72 | Ga0070673_100174380 | 3300005364 | Bacteria | 1837 |
| 73 | Ga0070673_100276634 | 3300005364 | Bacteria | 1471 |
| 74 | Ga0070673_100282809 | 3300005364 | Bacteria | 1455 |
| 75 | Ga0070659_100046732 | 3300005366 | Bacteria | 3393 |
| 76 | Ga0070659_100061193 | 3300005366 | Bacteria | 2975 |
| 77 | Ga0070659_100089500 | 3300005366 | Bacteria | 2466 |
| 78 | Ga0070659_100180024 | 3300005366 | Bacteria | 1734 |
| 79 | Ga0070667_100022052 | 3300005367 | Bacteria | 5284 |
| 80 | Ga0070667_100049692 | 3300005367 | Bacteria | 3533 |
| 81 | Ga0070667_100144558 | 3300005367 | Bacteria | 2085 |
| 82 | Ga0070667_100163160 | 3300005367 | Bacteria | 1964 |
| 83 | Ga0070709_10056874 | 3300005434 | Bacteria | 2475 |
| 84 | Ga0070714_100047289 | 3300005435 | Bacteria | 3654 |
| 85 | Ga0070714_100102162 | 3300005435 | Bacteria | 2527 |
| 86 | Ga0070713_100000129 | 3300005436 | Bacteria | 49577 |
| 87 | Ga0070713_100011017 | 3300005436 | Bacteria | 6563 |
| 88 | Ga0070713_100227997 | 3300005436 | Bacteria | 1692 |
| 89 | Ga0070710_10025987 | 3300005437 | Bacteria | 3106 |
| 90 | Ga0070701_10018566 | 3300005438 | Bacteria | 3271 |
| 91 | Ga0070701_10128777 | 3300005438 | Bacteria | 1436 |
| 92 | Ga0070711_100053234 | 3300005439 | Bacteria | 2788 |
| 93 | Ga0070705_100059544 | 3300005440 | Bacteria | 2262 |
| 94 | Ga0070700_100107989 | 3300005441 | Bacteria | 1845 |
| 95 | Ga0070694_100023303 | 3300005444 | Bacteria | 3980 |
| 96 | Ga0070708_100210850 | 3300005445 | Bacteria | 1820 |
| 97 | Ga0070663_100002768 | 3300005455 | Bacteria | 9944 |
| 98 | Ga0070663_100058868 | 3300005455 | Bacteria | 2760 |
| 99 | Ga0070663_100384310 | 3300005455 | Bacteria | 1144 |
| 100 | Ga0070678_100016864 | 3300005456 | Bacteria | 4685 |
| 101 | Ga0070678_100058624 | 3300005456 | Bacteria | 2827 |
| 102 | Ga0070678_100087487 | 3300005456 | Bacteria | 2380 |
| 103 | Ga0070678_100099566 | 3300005456 | Bacteria | 2249 |
| 104 | Ga0070678_100111900 | 3300005456 | Bacteria | 2137 |
| 105 | Ga0070678_100188719 | 3300005456 | Bacteria | 1693 |
| 106 | Ga0070662_100027611 | 3300005457 | Bacteria | 3942 |
| 107 | Ga0070662_100032993 | 3300005457 | Bacteria | 3643 |
| 108 | Ga0070681_10036085 | 3300005458 | Bacteria | 4966 |
| 109 | Ga0068867_100008910 | 3300005459 | Bacteria | 7080 |
| 110 | Ga0068867_100012739 | 3300005459 | Bacteria | 5951 |
| 111 | Ga0068867_100060218 | 3300005459 | Bacteria | 2816 |
| 112 | Ga0068867_100130818 | 3300005459 | Bacteria | 1950 |
| 113 | Ga0068867_100144524 | 3300005459 | Bacteria | 1862 |
| 114 | Ga0070685_10059630 | 3300005466 | Bacteria | 2229 |
| 115 | Ga0070685_10075512 | 3300005466 | Bacteria | 2008 |
| 116 | Ga0070706_100159173 | 3300005467 | Unclassified | 2108 |
| 117 | Ga0070707_100016769 | 3300005468 | Bacteria | 6877 |
| 118 | Ga0070699_100000708 | 3300005518 | Bacteria | 30920 |
| 119 | Ga0070679_100018240 | 3300005530 | Bacteria | 6806 |
| 120 | Ga0070679_100148494 | 3300005530 | Bacteria | 2321 |
| 121 | Ga0070679_100240896 | 3300005530 | Bacteria | 1766 |
| 122 | Ga0070684_100059898 | 3300005535 | Bacteria | 3329 |
| 123 | Ga0068853_100009347 | 3300005539 | Bacteria | 7903 |
| 124 | Ga0068853_100026886 | 3300005539 | Bacteria | 4834 |
| 125 | Ga0070672_100003611 | 3300005543 | Bacteria | 10031 |
| 126 | Ga0070672_100037283 | 3300005543 | Bacteria | 3708 |
| 127 | Ga0070672_100335838 | 3300005543 | Bacteria | 1286 |
| 128 | Ga0070686_100189910 | 3300005544 | Bacteria | 1465 |
| 129 | Ga0070693_100008277 | 3300005547 | Bacteria | 5116 |
| 130 | Ga0070665_100036933 | 3300005548 | Bacteria | 4912 |
| 131 | Ga0070665_100042010 | 3300005548 | Bacteria | 4596 |
| 132 | Ga0070665_100056106 | 3300005548 | Bacteria | 3950 |
| 133 | Ga0070665_100233743 | 3300005548 | Bacteria | 1839 |
| 134 | Ga0070704_100010008 | 3300005549 | Bacteria | 5760 |
| 135 | Ga0068855_100104113 | 3300005563 | Bacteria | 3265 |
| 136 | Ga0068855_100214605 | 3300005563 | Bacteria | 2161 |
| 137 | Ga0070664_100004030 | 3300005564 | Bacteria | 11799 |
| 138 | Ga0070664_100121064 | 3300005564 | Bacteria | 2291 |
| 139 | Ga0068854_100012579 | 3300005578 | Bacteria | 5545 |
| 140 | Ga0068854_100025046 | 3300005578 | Bacteria | 4093 |
| 141 | Ga0068856_100004065 | 3300005614 | Bacteria | 14642 |
| 142 | Ga0070702_100003679 | 3300005615 | Bacteria | 6902 |
| 143 | Ga0070702_100031295 | 3300005615 | Bacteria | 2909 |
| 144 | Ga0070702_100068191 | 3300005615 | Bacteria | 2092 |
| 145 | Ga0068852_100039684 | 3300005616 | Bacteria | 3965 |
| 146 | Ga0068852_100041014 | 3300005616 | Bacteria | 3909 |
| 147 | Ga0068852_100157893 | 3300005616 | Bacteria | 2115 |
| 148 | Ga0068852_100183993 | 3300005616 | Bacteria | 1966 |
| 149 | Ga0068852_100262884 | 3300005616 | Bacteria | 1658 |
| 150 | Ga0068859_100025822 | 3300005617 | Bacteria | 5894 |
| 151 | Ga0068859_100032362 | 3300005617 | Bacteria | 5254 |
| 152 | Ga0068859_100035474 | 3300005617 | Bacteria | 5004 |
| 153 | Ga0068859_100042445 | 3300005617 | Bacteria | 4568 |
| 154 | Ga0068859_100079439 | 3300005617 | Bacteria | 3321 |
| 155 | Ga0068859_100674452 | 3300005617 | Bacteria | 1125 |
| 156 | Ga0068864_100027348 | 3300005618 | Bacteria | 4817 |
| 157 | Ga0068864_100095074 | 3300005618 | Bacteria | 2635 |
| 158 | Ga0068864_100116887 | 3300005618 | Bacteria | 2380 |
| 159 | Ga0068864_100122909 | 3300005618 | Bacteria | 2323 |
| 160 | Ga0068864_100149781 | 3300005618 | Bacteria | 2112 |
| 161 | Ga0068864_100283518 | 3300005618 | Bacteria | 1547 |
| 162 | Ga0068866_10118921 | 3300005718 | Bacteria | 1486 |
| 163 | Ga0068861_100003730 | 3300005719 | Bacteria | 10161 |
| 164 | Ga0068861_100095142 | 3300005719 | Bacteria | 2358 |
| 165 | Ga0068861_100127650 | 3300005719 | Bacteria | 2060 |
| 166 | Ga0068861_100220865 | 3300005719 | Bacteria | 1602 |
| 167 | Ga0068851_10001051 | 3300005834 | Bacteria | 11959 |
| 168 | Ga0068851_10009294 | 3300005834 | Bacteria | 4564 |
| 169 | Ga0068851_10077806 | 3300005834 | Bacteria | 1727 |
| 170 | Ga0068851_10081757 | 3300005834 | Bacteria | 1688 |
| 171 | Ga0068870_10001962 | 3300005840 | Bacteria | 8504 |
| 172 | Ga0068870_10051449 | 3300005840 | Bacteria | 2180 |
| 173 | Ga0068870_10192874 | 3300005840 | Bacteria | 1230 |
| 174 | Ga0068863_100003730 | 3300005841 | Bacteria | 15066 |
| 175 | Ga0068863_100016873 | 3300005841 | Bacteria | 7003 |
| 176 | Ga0068863_100087307 | 3300005841 | Bacteria | 2955 |
| 177 | Ga0068858_100010789 | 3300005842 | Bacteria | 8636 |
| 178 | Ga0068858_100020301 | 3300005842 | Bacteria | 6213 |
| 179 | Ga0068858_100076998 | 3300005842 | Bacteria | 3098 |
| 180 | Ga0068858_100145629 | 3300005842 | Bacteria | 2225 |
| 181 | Ga0068858_100211914 | 3300005842 | Bacteria | 1833 |
| 182 | Ga0068858_100402097 | 3300005842 | Bacteria | 1316 |
| 183 | Ga0068858_100585921 | 3300005842 | Bacteria | 1081 |
| 184 | Ga0068860_100022098 | 3300005843 | Bacteria | 6158 |
| 185 | Ga0068860_100126704 | 3300005843 | Bacteria | 2447 |
| 186 | Ga0068860_100198483 | 3300005843 | Bacteria | 1944 |
| 187 | Ga0068860_100515916 | 3300005843 | Bacteria | 1195 |
| 188 | Ga0068862_100008255 | 3300005844 | Bacteria | 8614 |
| 189 | Ga0068862_100011911 | 3300005844 | Bacteria | 7183 |
| 190 | Ga0068862_100030190 | 3300005844 | Bacteria | 4567 |
| 191 | Ga0068862_100174977 | 3300005844 | Bacteria | 1924 |
| 192 | Ga0068862_100178804 | 3300005844 | Bacteria | 1903 |
| 193 | Ga0068862_100485875 | 3300005844 | Bacteria | 1170 |
| 194 | Ga0081455_10042044 | 3300005937 | Bacteria | 4013 |
| 195 | Ga0081455_10086820 | 3300005937 | Bacteria | 2547 |
| 196 | Ga0081539_10000927 | 3300005985 | Bacteria | 55152 |
| 197 | Ga0081539_10045116 | 3300005985 | Bacteria | 2538 |
| 198 | Ga0070717_10012513 | 3300006028 | Bacteria | 6473 |
| 199 | Ga0070717_10070126 | 3300006028 | Bacteria | 2920 |
| 200 | Ga0070717_10080300 | 3300006028 | Bacteria | 2736 |
| 201 | Ga0070717_10216537 | 3300006028 | Bacteria | 1682 |
| 202 | Ga0070717_10620385 | 3300006028 | Bacteria | 981 |
| 203 | Ga0075365_10118627 | 3300006038 | Bacteria | 1823 |
| 204 | Ga0075365_10193734 | 3300006038 | Bacteria | 1423 |
| 205 | Ga0075365_10204591 | 3300006038 | Bacteria | 1383 |
| 206 | Ga0070712_100201659 | 3300006175 | Bacteria | 1563 |
| 207 | Ga0075367_10039793 | 3300006178 | Bacteria | 2742 |
| 208 | Ga0075367_10283228 | 3300006178 | Bacteria | 1042 |
| 209 | Ga0097621_100014203 | 3300006237 | Bacteria | 5954 |
| 210 | Ga0097621_100030796 | 3300006237 | Bacteria | 4252 |
| 211 | Ga0097621_100349621 | 3300006237 | Bacteria | 1314 |
| 212 | Ga0068871_100022746 | 3300006358 | Bacteria | 4838 |
| 213 | Ga0068871_100031530 | 3300006358 | Bacteria | 4181 |
| 214 | Ga0068871_100043670 | 3300006358 | Bacteria | 3602 |
| 215 | Ga0068871_100047252 | 3300006358 | Bacteria | 3470 |
| 216 | Ga0068871_100075727 | 3300006358 | Bacteria | 2778 |
| 217 | Ga0068871_100275157 | 3300006358 | Bacteria | 1471 |
| 218 | Ga0075428_100190255 | 3300006844 | Bacteria | 2220 |
| 219 | Ga0075428_100261056 | 3300006844 | Bacteria | 1865 |
| 220 | Ga0075430_100075967 | 3300006846 | Bacteria | 2816 |
| 221 | Ga0075430_100131372 | 3300006846 | Bacteria | 2087 |
| 222 | Ga0075430_100335223 | 3300006846 | Bacteria | 1250 |
| 223 | Ga0075431_100036988 | 3300006847 | Bacteria | 5028 |
| 224 | Ga0075431_100072856 | 3300006847 | Bacteria | 3544 |
| 225 | Ga0075431_100154691 | 3300006847 | Bacteria | 2360 |
| 226 | Ga0075433_10011974 | 3300006852 | Bacteria | 6993 |
| 227 | Ga0075434_100008016 | 3300006871 | Bacteria | 9788 |
| 228 | Ga0075429_100150497 | 3300006880 | Bacteria | 2038 |
| 229 | Ga0075429_100185014 | 3300006880 | Bacteria | 1825 |
| 230 | Ga0068865_100008038 | 3300006881 | Bacteria | 6512 |
| 231 | Ga0075436_100010195 | 3300006914 | Bacteria | 6435 |
| 232 | Ga0097620_100025822 | 3300006931 | Bacteria | 5894 |
| 233 | Ga0097620_100032362 | 3300006931 | Bacteria | 5254 |
| 234 | Ga0097620_100035474 | 3300006931 | Bacteria | 5004 |
| 235 | Ga0097620_100042445 | 3300006931 | Bacteria | 4568 |
| 236 | Ga0097620_100079438 | 3300006931 | Bacteria | 3321 |
| 237 | Ga0097620_100674499 | 3300006931 | Bacteria | 1125 |
| 238 | Ga0099824_1007872 | 3300006942 | Bacteria | 13879 |
| 239 | Ga0079104_1000146 | 3300006946 | Bacteria | 99148 |
| 240 | Ga0079104_1016660 | 3300006946 | Bacteria | 2140 |
| 241 | Ga0079104_1023901 | 3300006946 | Bacteria | 1618 |
| 242 | Ga0099826_10005057 | 3300006948 | Bacteria | 9372 |
| 243 | Ga0075435_100012598 | 3300007076 | Bacteria | 6264 |
| 244 | Ga0105251_10055930 | 3300009011 | Bacteria | 1869 |
| 245 | Ga0105250_10000006 | 3300009092 | Bacteria | 390071 |
| 246 | Ga0105240_10010715 | 3300009093 | Bacteria | 12862 |
| 247 | Ga0105240_10017187 | 3300009093 | Bacteria | 9759 |
| 248 | Ga0105240_10089075 | 3300009093 | Bacteria | 3775 |
| 249 | Ga0111539_10057862 | 3300009094 | Bacteria | 4602 |
| 250 | Ga0111539_10071416 | 3300009094 | Bacteria | 4096 |
| 251 | Ga0111539_10120566 | 3300009094 | Bacteria | 3073 |
| 252 | Ga0111539_10307347 | 3300009094 | Bacteria | 1845 |
| 253 | Ga0111539_10336516 | 3300009094 | Bacteria | 1757 |
| 254 | Ga0111539_10683653 | 3300009094 | Bacteria | 1195 |
| 255 | Ga0105245_10008219 | 3300009098 | Bacteria | 9124 |
| 256 | Ga0105245_10026816 | 3300009098 | Bacteria | 5073 |
| 257 | Ga0105245_10327570 | 3300009098 | Bacteria | 1511 |
| 258 | Ga0105245_10448387 | 3300009098 | Bacteria | 1298 |
| 259 | Ga0105247_10004007 | 3300009101 | Bacteria | 9476 |
| 260 | Ga0105247_10148587 | 3300009101 | Bacteria | 1542 |
| 261 | Ga0114129_10069834 | 3300009147 | Bacteria | 4897 |
| 262 | Ga0114129_10520896 | 3300009147 | Bacteria | 1550 |
| 263 | Ga0105243_10034179 | 3300009148 | Bacteria | 3934 |
| 264 | Ga0105241_10025396 | 3300009174 | Bacteria | 4402 |
| 265 | Ga0105241_10104068 | 3300009174 | Bacteria | 2261 |
| 266 | Ga0105241_10195305 | 3300009174 | Bacteria | 1687 |
| 267 | Ga0105242_10088775 | 3300009176 | Bacteria | 2598 |
| 268 | Ga0105248_10016488 | 3300009177 | Bacteria | 8132 |
| 269 | Ga0105248_10113758 | 3300009177 | Bacteria | 3052 |
| 270 | Ga0105248_10218452 | 3300009177 | Bacteria | 2146 |
| 271 | Ga0105237_10013036 | 3300009545 | Bacteria | 8728 |
| 272 | Ga0105237_10046598 | 3300009545 | Bacteria | 4360 |
| 273 | Ga0105237_10209728 | 3300009545 | Bacteria | 1948 |
| 274 | Ga0105238_10067892 | 3300009551 | Bacteria | 3566 |
| 275 | Ga0105238_10142509 | 3300009551 | Bacteria | 2373 |
| 276 | Ga0105249_10014648 | 3300009553 | Bacteria | 6932 |
| 277 | Ga0105249_10107042 | 3300009553 | Bacteria | 2638 |
| 278 | Ga0105249_10259151 | 3300009553 | Bacteria | 1727 |
| 279 | Ga0105239_10000037 | 3300010375 | Bacteria | 206779 |
| 280 | Ga0105239_10056407 | 3300010375 | Bacteria | 4309 |
| 281 | Ga0105239_10111081 | 3300010375 | Bacteria | 3038 |
| 282 | Ga0105239_10648910 | 3300010375 | Bacteria | 1205 |
| 283 | Ga0105246_10007529 | 3300011119 | Bacteria | 6678 |
| 284 | Ga0157373_10000023 | 3300013100 | Bacteria | 164200 |
| 285 | Ga0157373_10080711 | 3300013100 | Bacteria | 2294 |
| 286 | Ga0157371_10008583 | 3300013102 | Bacteria | 8122 |
| 287 | Ga0157371_10039729 | 3300013102 | Bacteria | 3364 |
| 288 | Ga0157371_10131106 | 3300013102 | Bacteria | 1783 |
| 289 | Ga0157371_10165535 | 3300013102 | Bacteria | 1579 |
| 290 | Ga0157370_10003921 | 3300013104 | Bacteria | 17335 |
| 291 | Ga0157370_10013827 | 3300013104 | Bacteria | 8291 |
| 292 | Ga0157369_10050251 | 3300013105 | Bacteria | 4516 |
| 293 | Ga0157374_10002677 | 3300013296 | Bacteria | 14989 |
| 294 | Ga0157374_10016721 | 3300013296 | Bacteria | 6454 |
| 295 | Ga0157374_10054267 | 3300013296 | Bacteria | 3738 |
| 296 | Ga0157374_10074957 | 3300013296 | Bacteria | 3197 |
| 297 | Ga0157374_10375497 | 3300013296 | Bacteria | 1416 |
| 298 | Ga0157378_10000631 | 3300013297 | Bacteria | 33043 |
| 299 | Ga0157378_10060000 | 3300013297 | Bacteria | 3394 |
| 300 | Ga0157378_10074921 | 3300013297 | Bacteria | 3046 |
| 301 | Ga0163162_10005487 | 3300013306 | Bacteria | 12255 |
| 302 | Ga0157375_10019639 | 3300013308 | Bacteria | 6152 |
| 303 | Ga0157375_10061837 | 3300013308 | Bacteria | 3719 |
| 304 | Ga0157375_10108044 | 3300013308 | Bacteria | 2876 |
| 305 | Ga0157375_10155169 | 3300013308 | Bacteria | 2428 |
| 306 | Ga0157375_10286061 | 3300013308 | Bacteria | 1812 |
| 307 | Ga0163163_10007534 | 3300014325 | Bacteria | 9609 |
| 308 | Ga0157380_10002142 | 3300014326 | Bacteria | 13248 |
| 309 | Ga0157380_10002279 | 3300014326 | Bacteria | 12894 |
| 310 | Ga0157380_10008389 | 3300014326 | Bacteria | 7371 |
| 311 | Ga0157380_10032855 | 3300014326 | Bacteria | 3993 |
| 312 | Ga0157380_10033683 | 3300014326 | Bacteria | 3946 |
| 313 | Ga0157380_10078277 | 3300014326 | Bacteria | 2697 |
| 314 | Ga0157380_10080884 | 3300014326 | Bacteria | 2656 |
| 315 | Ga0157380_10116787 | 3300014326 | Bacteria | 2253 |
| 316 | Ga0157377_10097218 | 3300014745 | Bacteria | 1748 |
| 317 | Ga0157377_10280655 | 3300014745 | Bacteria | 1092 |
| 318 | Ga0157379_10000830 | 3300014968 | Bacteria | 25057 |
| 319 | Ga0157379_10039058 | 3300014968 | Bacteria | 4235 |
| 320 | Ga0157379_10181531 | 3300014968 | Bacteria | 1901 |
| 321 | Ga0157379_10253425 | 3300014968 | Bacteria | 1598 |
| 322 | Ga0157376_10041860 | 3300014969 | Bacteria | 3753 |
| 323 | Ga0157376_10051232 | 3300014969 | Bacteria | 3429 |
| 324 | Ga0157376_10061915 | 3300014969 | Bacteria | 3147 |
| 325 | Ga0157376_10096073 | 3300014969 | Bacteria | 2578 |
| 326 | Ga0157376_10320753 | 3300014969 | Bacteria | 1473 |
| 327 | Ga0182006_1002701 | 3300015261 | Bacteria | 9523 |
| 328 | Ga0182006_1017283 | 3300015261 | Bacteria | 3066 |
| 329 | Ga0182006_1017297 | 3300015261 | Bacteria | 3065 |
| 330 | Ga0163161_10287141 | 3300017792 | Bacteria | 1292 |
| 331 | Ga0163161_10511148 | 3300017792 | Bacteria | 980 |
| 332 | Ga0206353_11795824 | 3300020082 | Bacteria | 1397 |
| 333 | Ga0209566_100052 | 3300025225 | Bacteria | 231848 |
| 334 | Ga0209147_103612 | 3300025229 | Bacteria | 2909 |
| 335 | Ga0209258_101156 | 3300025242 | Bacteria | 10794 |
| 336 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 337 | Ga0209676_1000198 | 3300025292 | Bacteria | 134708 |
| 338 | Ga0209676_1000362 | 3300025292 | Bacteria | 85770 |
| 339 | Ga0209676_1003189 | 3300025292 | Bacteria | 10409 |
| 340 | Ga0209676_1041396 | 3300025292 | Bacteria | 1288 |
| 341 | Ga0209025_1019137 | 3300025294 | Bacteria | 3826 |
| 342 | Ga0209025_1041993 | 3300025294 | Bacteria | 1949 |
| 343 | Ga0209050_1000849 | 3300025298 | Bacteria | 41596 |
| 344 | Ga0209050_1003508 | 3300025298 | Bacteria | 11474 |
| 345 | Ga0209257_1000860 | 3300025304 | Bacteria | 43237 |
| 346 | Ga0209257_1001370 | 3300025304 | Bacteria | 29369 |
| 347 | Ga0209257_1003116 | 3300025304 | Bacteria | 14836 |
| 348 | Ga0207697_10004336 | 3300025315 | Bacteria | 6790 |
| 349 | Ga0207696_1000069 | 3300025711 | Bacteria | 227744 |
| 350 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 351 | Ga0207682_10000798 | 3300025893 | Bacteria | 14551 |
| 352 | Ga0207682_10002137 | 3300025893 | Bacteria | 8961 |
| 353 | Ga0207682_10015311 | 3300025893 | Bacteria | 2984 |
| 354 | Ga0207642_10025189 | 3300025899 | Bacteria | 2403 |
| 355 | Ga0207642_10031370 | 3300025899 | Bacteria | 2225 |
| 356 | Ga0207642_10246690 | 3300025899 | Bacteria | 1011 |
| 357 | Ga0207710_10015418 | 3300025900 | Bacteria | 3229 |
| 358 | Ga0207688_10032338 | 3300025901 | Bacteria | 2891 |
| 359 | Ga0207688_10048236 | 3300025901 | Bacteria | 2379 |
| 360 | Ga0207688_10066672 | 3300025901 | Bacteria | 2036 |
| 361 | Ga0207680_10030105 | 3300025903 | Bacteria | 3057 |
| 362 | Ga0207680_10108620 | 3300025903 | Bacteria | 1795 |
| 363 | Ga0207647_10146562 | 3300025904 | Bacteria | 1381 |
| 364 | Ga0207647_10167662 | 3300025904 | Bacteria | 1279 |
| 365 | Ga0207699_10004323 | 3300025906 | Bacteria | 6796 |
| 366 | Ga0207645_10001048 | 3300025907 | Bacteria | 22872 |
| 367 | Ga0207645_10047151 | 3300025907 | Bacteria | 2752 |
| 368 | Ga0207645_10055042 | 3300025907 | Bacteria | 2540 |
| 369 | Ga0207645_10094092 | 3300025907 | Bacteria | 1929 |
| 370 | Ga0207645_10119781 | 3300025907 | Bacteria | 1708 |
| 371 | Ga0207643_10000594 | 3300025908 | Bacteria | 22954 |
| 372 | Ga0207643_10046706 | 3300025908 | Bacteria | 2448 |
| 373 | Ga0207643_10123129 | 3300025908 | Bacteria | 1538 |
| 374 | Ga0207654_10134043 | 3300025911 | Bacteria | 1571 |
| 375 | Ga0207695_10001017 | 3300025913 | Bacteria | 49429 |
| 376 | Ga0207695_10031430 | 3300025913 | Bacteria | 5823 |
| 377 | Ga0207695_10046636 | 3300025913 | Bacteria | 4592 |
| 378 | Ga0207695_10109233 | 3300025913 | Bacteria | 2748 |
| 379 | Ga0207671_10004808 | 3300025914 | Bacteria | 12723 |
| 380 | Ga0207671_10052375 | 3300025914 | Bacteria | 3025 |
| 381 | Ga0207671_10091997 | 3300025914 | Bacteria | 2286 |
| 382 | Ga0207693_10024239 | 3300025915 | Bacteria | 4817 |
| 383 | Ga0207663_10016077 | 3300025916 | Bacteria | 4141 |
| 384 | Ga0207660_10007800 | 3300025917 | Bacteria | 6928 |
| 385 | Ga0207660_10028542 | 3300025917 | Bacteria | 3817 |
| 386 | Ga0207662_10155727 | 3300025918 | Bacteria | 1456 |
| 387 | Ga0207657_10022327 | 3300025919 | Bacteria | 5924 |
| 388 | Ga0207657_10076906 | 3300025919 | Bacteria | 2815 |
| 389 | Ga0207657_10085036 | 3300025919 | Bacteria | 2651 |
| 390 | Ga0207649_10002784 | 3300025920 | Bacteria | 9659 |
| 391 | Ga0207652_10122608 | 3300025921 | Bacteria | 2313 |
| 392 | Ga0207652_10354277 | 3300025921 | Bacteria | 1325 |
| 393 | Ga0207646_10001356 | 3300025922 | Bacteria | 30379 |
| 394 | Ga0207681_10012027 | 3300025923 | Bacteria | 5331 |
| 395 | Ga0207681_10045203 | 3300025923 | Bacteria | 2955 |
| 396 | Ga0207681_10080936 | 3300025923 | Bacteria | 2292 |
| 397 | Ga0207681_10186577 | 3300025923 | Bacteria | 1583 |
| 398 | Ga0207694_10248910 | 3300025924 | Bacteria | 1454 |
| 399 | Ga0207650_10001016 | 3300025925 | Bacteria | 21075 |
| 400 | Ga0207650_10001564 | 3300025925 | Bacteria | 16366 |
| 401 | Ga0207650_10003470 | 3300025925 | Bacteria | 10830 |
| 402 | Ga0207650_10040514 | 3300025925 | Bacteria | 3409 |
| 403 | Ga0207659_10002573 | 3300025926 | Bacteria | 10802 |
| 404 | Ga0207659_10011881 | 3300025926 | Bacteria | 5516 |
| 405 | Ga0207659_10019574 | 3300025926 | Bacteria | 4459 |
| 406 | Ga0207659_10236941 | 3300025926 | Bacteria | 1474 |
| 407 | Ga0207687_10030832 | 3300025927 | Bacteria | 3619 |
| 408 | Ga0207700_10000044 | 3300025928 | Bacteria | 89454 |
| 409 | Ga0207700_10001414 | 3300025928 | Bacteria | 13622 |
| 410 | Ga0207700_10071401 | 3300025928 | Bacteria | 2673 |
| 411 | Ga0207664_10005921 | 3300025929 | Bacteria | 8365 |
| 412 | Ga0207664_10036227 | 3300025929 | Bacteria | 3813 |
| 413 | Ga0207664_10449804 | 3300025929 | Bacteria | 1150 |
| 414 | Ga0207644_10002140 | 3300025931 | Bacteria | 12809 |
| 415 | Ga0207644_10003507 | 3300025931 | Bacteria | 10153 |
| 416 | Ga0207644_10089931 | 3300025931 | Bacteria | 2286 |
| 417 | Ga0207690_10074617 | 3300025932 | Bacteria | 2349 |
| 418 | Ga0207690_10194039 | 3300025932 | Bacteria | 1538 |
| 419 | Ga0207690_10227839 | 3300025932 | Bacteria | 1429 |
| 420 | Ga0207706_10006526 | 3300025933 | Bacteria | 10815 |
| 421 | Ga0207706_10015081 | 3300025933 | Bacteria | 6995 |
| 422 | Ga0207706_10022657 | 3300025933 | Bacteria | 5637 |
| 423 | Ga0207706_10261322 | 3300025933 | Bacteria | 1511 |
| 424 | Ga0207709_10052850 | 3300025935 | Bacteria | 2497 |
| 425 | Ga0207709_10081325 | 3300025935 | Bacteria | 2088 |
| 426 | Ga0207709_10149120 | 3300025935 | Bacteria | 1618 |
| 427 | Ga0207670_10051408 | 3300025936 | Bacteria | 2767 |
| 428 | Ga0207670_10157127 | 3300025936 | Bacteria | 1694 |
| 429 | Ga0207670_10380867 | 3300025936 | Bacteria | 1124 |
| 430 | Ga0207669_10002485 | 3300025937 | Bacteria | 7864 |
| 431 | Ga0207669_10007588 | 3300025937 | Bacteria | 5031 |
| 432 | Ga0207669_10067523 | 3300025937 | Bacteria | 2229 |
| 433 | Ga0207669_10077647 | 3300025937 | Bacteria | 2113 |
| 434 | Ga0207669_10517847 | 3300025937 | Bacteria | 957 |
| 435 | Ga0207704_10030885 | 3300025938 | Bacteria | 3010 |
| 436 | Ga0207704_10190312 | 3300025938 | Bacteria | 1492 |
| 437 | Ga0207665_10384990 | 3300025939 | Bacteria | 1065 |
| 438 | Ga0207691_10000180 | 3300025940 | Bacteria | 59800 |
| 439 | Ga0207691_10003262 | 3300025940 | Bacteria | 15803 |
| 440 | Ga0207691_10007125 | 3300025940 | Bacteria | 10793 |
| 441 | Ga0207691_10038037 | 3300025940 | Bacteria | 4452 |
| 442 | Ga0207691_10054083 | 3300025940 | Bacteria | 3663 |
| 443 | Ga0207691_10060715 | 3300025940 | Bacteria | 3435 |
| 444 | Ga0207691_10120971 | 3300025940 | Bacteria | 2320 |
| 445 | Ga0207691_10136420 | 3300025940 | Bacteria | 2164 |
| 446 | Ga0207711_10005883 | 3300025941 | Bacteria | 10354 |
| 447 | Ga0207711_10092518 | 3300025941 | Bacteria | 2661 |
| 448 | Ga0207711_10142554 | 3300025941 | Bacteria | 2157 |
| 449 | Ga0207689_10001431 | 3300025942 | Bacteria | 22792 |
| 450 | Ga0207689_10024871 | 3300025942 | Bacteria | 5020 |
| 451 | Ga0207689_10049684 | 3300025942 | Bacteria | 3460 |
| 452 | Ga0207689_10199433 | 3300025942 | Bacteria | 1652 |
| 453 | Ga0207661_10003516 | 3300025944 | Bacteria | 10885 |
| 454 | Ga0207661_10080148 | 3300025944 | Bacteria | 2693 |
| 455 | Ga0207679_10043675 | 3300025945 | Bacteria | 3229 |
| 456 | Ga0207667_10360925 | 3300025949 | Bacteria | 1481 |
| 457 | Ga0207651_10074105 | 3300025960 | Bacteria | 2423 |
| 458 | Ga0207651_10075588 | 3300025960 | Bacteria | 2404 |
| 459 | Ga0207651_10141206 | 3300025960 | Bacteria | 1861 |
| 460 | Ga0207651_10401937 | 3300025960 | Bacteria | 1165 |
| 461 | Ga0207668_10000060 | 3300025972 | Bacteria | 89732 |
| 462 | Ga0207668_10007605 | 3300025972 | Bacteria | 6450 |
| 463 | Ga0207668_10050245 | 3300025972 | Bacteria | 2872 |
| 464 | Ga0207668_10092305 | 3300025972 | Bacteria | 2228 |
| 465 | Ga0207658_10023664 | 3300025986 | Bacteria | 4290 |
| 466 | Ga0207658_10041264 | 3300025986 | Bacteria | 3341 |
| 467 | Ga0207658_10076747 | 3300025986 | Bacteria | 2547 |
| 468 | Ga0207658_10418344 | 3300025986 | Bacteria | 1181 |
| 469 | Ga0207677_10072693 | 3300026023 | Bacteria | 2432 |
| 470 | Ga0207677_10094007 | 3300026023 | Bacteria | 2187 |
| 471 | Ga0207677_10551133 | 3300026023 | Bacteria | 1005 |
| 472 | Ga0207703_10012833 | 3300026035 | Bacteria | 6533 |
| 473 | Ga0207703_10041853 | 3300026035 | Bacteria | 3673 |
| 474 | Ga0207703_10069667 | 3300026035 | Bacteria | 2901 |
| 475 | Ga0207703_10371529 | 3300026035 | Bacteria | 1321 |
| 476 | Ga0207639_10082507 | 3300026041 | Bacteria | 2548 |
| 477 | Ga0207639_10109132 | 3300026041 | Bacteria | 2251 |
| 478 | Ga0207678_10001818 | 3300026067 | Bacteria | 19546 |
| 479 | Ga0207678_10008182 | 3300026067 | Bacteria | 9223 |
| 480 | Ga0207678_10214587 | 3300026067 | Bacteria | 1647 |
| 481 | Ga0207708_10006356 | 3300026075 | Bacteria | 8756 |
| 482 | Ga0207708_10034973 | 3300026075 | Bacteria | 3822 |
| 483 | Ga0207708_10053197 | 3300026075 | Bacteria | 3084 |
| 484 | Ga0207708_10127160 | 3300026075 | Bacteria | 1990 |
| 485 | Ga0207702_10001992 | 3300026078 | Bacteria | 19810 |
| 486 | Ga0207702_10021932 | 3300026078 | Bacteria | 5289 |
| 487 | Ga0207641_10010191 | 3300026088 | Bacteria | 7729 |
| 488 | Ga0207641_10031263 | 3300026088 | Bacteria | 4415 |
| 489 | Ga0207641_10041337 | 3300026088 | Bacteria | 3863 |
| 490 | Ga0207648_10005794 | 3300026089 | Bacteria | 12379 |
| 491 | Ga0207648_10012777 | 3300026089 | Bacteria | 7845 |
| 492 | Ga0207648_10017845 | 3300026089 | Bacteria | 6440 |
| 493 | Ga0207648_10048341 | 3300026089 | Bacteria | 3725 |
| 494 | Ga0207648_10077587 | 3300026089 | Bacteria | 2896 |
| 495 | Ga0207648_10111844 | 3300026089 | Bacteria | 2398 |
| 496 | Ga0207648_10118701 | 3300026089 | Bacteria | 2325 |
| 497 | Ga0207648_10170115 | 3300026089 | Bacteria | 1926 |
| 498 | Ga0207676_10000896 | 3300026095 | Bacteria | 23105 |
| 499 | Ga0207676_10005522 | 3300026095 | Bacteria | 8948 |
| 500 | Ga0207676_10060724 | 3300026095 | Bacteria | 2991 |
| 501 | Ga0207676_10104749 | 3300026095 | Bacteria | 2353 |
| 502 | Ga0207676_10112461 | 3300026095 | Bacteria | 2281 |
| 503 | Ga0207676_10155031 | 3300026095 | Bacteria | 1977 |
| 504 | Ga0207674_10030489 | 3300026116 | Bacteria | 5668 |
| 505 | Ga0207675_100015760 | 3300026118 | Bacteria | 7048 |
| 506 | Ga0207675_100023333 | 3300026118 | Bacteria | 5754 |
| 507 | Ga0207675_100039045 | 3300026118 | Bacteria | 4431 |
| 508 | Ga0207675_100086921 | 3300026118 | Bacteria | 2936 |
| 509 | Ga0207675_100450507 | 3300026118 | Bacteria | 1275 |
| 510 | Ga0207675_100594747 | 3300026118 | Bacteria | 1109 |
| 511 | Ga0207683_10000146 | 3300026121 | Bacteria | 58543 |
| 512 | Ga0207683_10001721 | 3300026121 | Bacteria | 19553 |
| 513 | Ga0207683_10001789 | 3300026121 | Bacteria | 19023 |
| 514 | Ga0207683_10065769 | 3300026121 | Bacteria | 3197 |
| 515 | Ga0207683_10163499 | 3300026121 | Bacteria | 2013 |
| 516 | Ga0207683_10180368 | 3300026121 | Bacteria | 1915 |
| 517 | Ga0207683_10346564 | 3300026121 | Bacteria | 1363 |
| 518 | Ga0207698_10002118 | 3300026142 | Bacteria | 11709 |
| 519 | Ga0207698_10026942 | 3300026142 | Bacteria | 4073 |
| 520 | Ga0207698_10062486 | 3300026142 | Bacteria | 2908 |
| 521 | Ga0209281_1000045 | 3300027111 | Bacteria | 328124 |
| 522 | Ga0209281_1004536 | 3300027111 | Bacteria | 4131 |
| 523 | Ga0209489_108520 | 3300027361 | Bacteria | 13879 |
| 524 | Ga0210002_1018120 | 3300027617 | Bacteria | 1124 |
| 525 | Ga0209971_1003179 | 3300027682 | Bacteria | 3915 |
| 526 | Ga0209966_1005269 | 3300027695 | Bacteria | 2218 |
| 527 | Ga0209974_10014042 | 3300027876 | Bacteria | 2668 |
| 528 | Ga0209974_10056085 | 3300027876 | Bacteria | 1329 |
| 529 | Ga0209974_10109539 | 3300027876 | Bacteria | 971 |
| 530 | Ga0207428_10015402 | 3300027907 | Bacteria | 6615 |
| 531 | Ga0207428_10214012 | 3300027907 | Bacteria | 1447 |
| 532 | Ga0268266_10028457 | 3300028379 | Bacteria | 4750 |
| 533 | Ga0268266_10208928 | 3300028379 | Bacteria | 1790 |
| 534 | Ga0268266_10287376 | 3300028379 | Bacteria | 1530 |
| 535 | Ga0268265_10007031 | 3300028380 | Bacteria | 7610 |
| 536 | Ga0268265_10050752 | 3300028380 | Bacteria | 3127 |
| 537 | Ga0268264_10008954 | 3300028381 | Bacteria | 8308 |
| 538 | Ga0268264_10018610 | 3300028381 | Bacteria | 5679 |
| 539 | Ga0268264_10086517 | 3300028381 | Bacteria | 2693 |
| 540 | Ga0268264_10095159 | 3300028381 | Bacteria | 2577 |
| 541 | Ga0268264_10207103 | 3300028381 | Bacteria | 1798 |
| 542 | Ga0268264_10282555 | 3300028381 | Bacteria | 1555 |
| 543 | Ga0265334_10016887 | 3300028573 | Bacteria | 3018 |
| 544 | Ga0265318_10011555 | 3300028577 | Bacteria | 3795 |
| 545 | Ga0265338_10015955 | 3300028800 | Bacteria | 8213 |
| 546 | Ga0265330_10030331 | 3300031235 | Bacteria | 2429 |
| 547 | Ga0265332_10014637 | 3300031238 | Bacteria | 3468 |
| 548 | Ga0265340_10092203 | 3300031247 | Bacteria | 1415 |
| 549 | Ga0265331_10008258 | 3300031250 | Bacteria | 5934 |
| 550 | Ga0265316_10018778 | 3300031344 | Bacteria | 5935 |
| 551 | Ga0307408_100000475 | 3300031548 | Bacteria | 35093 |
| 552 | Ga0307408_100163213 | 3300031548 | Bacteria | 1771 |
| 553 | Ga0307408_100404560 | 3300031548 | Bacteria | 1173 |
| 554 | Ga0307408_100438842 | 3300031548 | Bacteria | 1130 |
| 555 | Ga0316575_10076015 | 3300031665 | Bacteria | 1352 |
| 556 | Ga0316579_10005942 | 3300031691 | Bacteria | 4950 |
| 557 | Ga0265314_10000595 | 3300031711 | Bacteria | 45508 |
| 558 | Ga0265342_10051906 | 3300031712 | Bacteria | 2445 |
| 559 | Ga0316576_10004148 | 3300031727 | Bacteria | 8646 |
| 560 | Ga0316576_10087355 | 3300031727 | Bacteria | 2320 |
| 561 | Ga0316576_10125682 | 3300031727 | Bacteria | 1927 |
| 562 | Ga0316576_10145717 | 3300031727 | Bacteria | 1783 |
| 563 | Ga0316578_10017721 | 3300031728 | Bacteria | 3882 |
| 564 | Ga0316578_10166068 | 3300031728 | Bacteria | 1330 |
| 565 | Ga0307405_10010037 | 3300031731 | Bacteria | 4885 |
| 566 | Ga0316577_10028417 | 3300031733 | Bacteria | 3120 |
| 567 | Ga0316577_10072127 | 3300031733 | Bacteria | 1927 |
| 568 | Ga0316577_10122595 | 3300031733 | Bacteria | 1461 |
| 569 | Ga0307413_10014744 | 3300031824 | Bacteria | 3982 |
| 570 | Ga0307413_10201004 | 3300031824 | Bacteria | 1439 |
| 571 | Ga0307410_10005332 | 3300031852 | Bacteria | 6791 |
| 572 | Ga0307410_10009576 | 3300031852 | Bacteria | 5442 |
| 573 | Ga0307410_10018238 | 3300031852 | Bacteria | 4237 |
| 574 | Ga0307410_10020706 | 3300031852 | Bacteria | 4030 |
| 575 | Ga0307406_10000062 | 3300031901 | Bacteria | 60112 |
| 576 | Ga0307406_10030734 | 3300031901 | Bacteria | 3264 |
| 577 | Ga0307407_10000440 | 3300031903 | Bacteria | 12687 |
| 578 | Ga0307407_10001616 | 3300031903 | Bacteria | 8325 |
| 579 | Ga0307407_10043850 | 3300031903 | Bacteria | 2517 |
| 580 | Ga0307412_10111294 | 3300031911 | Bacteria | 1956 |
| 581 | Ga0307412_10151594 | 3300031911 | Bacteria | 1711 |
| 582 | Ga0307409_100007763 | 3300031995 | Bacteria | 6451 |
| 583 | Ga0307409_100078235 | 3300031995 | Bacteria | 2660 |
| 584 | Ga0307409_100089516 | 3300031995 | Bacteria | 2516 |
| 585 | Ga0307409_100275035 | 3300031995 | Bacteria | 1553 |
| 586 | Ga0307416_100000394 | 3300032002 | Bacteria | 22418 |
| 587 | Ga0307416_100008628 | 3300032002 | Bacteria | 6596 |
| 588 | Ga0307416_100910466 | 3300032002 | Bacteria | 980 |
| 589 | Ga0307414_10000027 | 3300032004 | Bacteria | 192277 |
| 590 | Ga0307414_10026665 | 3300032004 | Bacteria | 3722 |
| 591 | Ga0307414_10048545 | 3300032004 | Bacteria | 2929 |
| 592 | Ga0307414_10052365 | 3300032004 | Bacteria | 2840 |
| 593 | Ga0307414_10085742 | 3300032004 | Bacteria | 2321 |
| 594 | Ga0307411_10037604 | 3300032005 | Bacteria | 3045 |
| 595 | Ga0307411_10217284 | 3300032005 | Bacteria | 1480 |
| 596 | Ga0307415_100057771 | 3300032126 | Bacteria | 2668 |
| 597 | Ga0307415_100150460 | 3300032126 | Bacteria | 1791 |
| 598 | Ga0316583_10030367 | 3300032133 | Bacteria | 1925 |
| 599 | Ga0316585_10025747 | 3300032137 | Bacteria | 1826 |
| 600 | Ga0316580_10002895 | 3300032139 | Bacteria | 4804 |
| 601 | Ga0316580_10041620 | 3300032139 | Bacteria | 1419 |
| 602 | Ga0316596_1027287 | 3300033541 | Bacteria | 1473 |
| 603 | Ga0373955_0107256 | 3300035172 | Bacteria | 1611 |
| 604 | Ga0316574_0000018 | 3300035398 | Bacteria | 40938 |
| 605 | Ga0316574_0006270 | 3300035398 | Bacteria | 6413 |
| 606 | Ga0316574_0030139 | 3300035398 | Bacteria | 3283 |
| 607 | Ga0316574_0031913 | 3300035398 | Bacteria | 3198 |
| 608 | Ga0316574_0033376 | 3300035398 | Bacteria | 3133 |
| 609 | Ga0316574_0035454 | 3300035398 | Bacteria | 3049 |
| 610 | Ga0316574_0132803 | 3300035398 | Bacteria | 1602 |
| 611 | Ga0316574_0241715 | 3300035398 | Bacteria | 1154 |
| 612 | Ga0373931_0039649 | 3300035691 | Bacteria | 2468 |
| 613 | Ga0373933_0015401 | 3300035724 | Bacteria | 4261 |
| 614 | Ga0373937_0067615 | 3300036401 | Bacteria | 3292 |
| 615 | Ga0316582_0035066 | 3300036647 | Bacteria | 3095 |
| 616 | Ga0316582_0043967 | 3300036647 | Bacteria | 2805 |
| 617 | Ga0316582_0151651 | 3300036647 | Bacteria | 1567 |
| 618 | Ga0316582_0236407 | 3300036647 | Bacteria | 1251 |
| 619 | Ga0316584_0034958 | 3300036712 | Bacteria | 3727 |
| 620 | Ga0316584_0067765 | 3300036712 | Bacteria | 2675 |
| 621 | Ga0316584_0080062 | 3300036712 | Bacteria | 2448 |
| 622 | Ga0316584_0095372 | 3300036712 | Bacteria | 2227 |
| 623 | Ga0316584_0127517 | 3300036712 | Bacteria | 1900 |
| 624 | Ga0316584_0320366 | 3300036712 | Bacteria | 1119 |
| 625 | Ga0316584_0324251 | 3300036712 | Bacteria | 1110 |
| 626 | Ga0373925_0019723 | 3300037068 | Bacteria | 4907 |
| 627 | Ga0395899_0010439 | 3300037312 | Bacteria | 7114 |
| 628 | Ga0395899_0014021 | 3300037312 | Bacteria | 6119 |
| 629 | Ga0395900_0029177 | 3300037418 | Bacteria | 5658 |
| 630 | Ga0395900_0115958 | 3300037418 | Bacteria | 2749 |
| 631 | Ga0395900_0246709 | 3300037418 | Bacteria | 1789 |
| 632 | Ga0395898_0009056 | 3300037466 | Bacteria | 10481 |
| 633 | Ga0395898_0252324 | 3300037466 | Bacteria | 1682 |
| 634 | Ga0395905_0115294 | 3300037471 | Bacteria | 2525 |
| 635 | Ga0395905_0427804 | 3300037471 | Bacteria | 1220 |
| 636 | Ga0395901_0022229 | 3300038443 | Bacteria | 6497 |
| 637 | Ga0395901_0055805 | 3300038443 | Bacteria | 4109 |
| 638 | Ga0395901_0083749 | 3300038443 | Bacteria | 3334 |
| 639 | Ga0395901_0168108 | 3300038443 | Bacteria | 2301 |
| 640 | Ga0395901_0628756 | 3300038443 | Bacteria | 1079 |
| 641 | Ga0400486_08083 | 3300038742 | Bacteria | 5590 |
| 642 | Ga0400483_016889 | 3300039062 | Bacteria | 7256 |
| 643 | Ga0400483_147849 | 3300039062 | Bacteria | 9474 |
| 644 | Ga0400483_194805 | 3300039062 | Bacteria | 6341 |
| 645 | Ga0400483_203034 | 3300039062 | Bacteria | 3617 |
| 646 | Ga0436365_0011767 | 3300039437 | Bacteria | 7798 |
| 647 | Ga0436365_0608669 | 3300039437 | Bacteria | 1249 |
| 648 | Ga0436363_0917267 | 3300039450 | Bacteria | 2766 |
| 649 | Ga0436363_1703617 | 3300039450 | Bacteria | 1642 |
| 650 | Ga0451841_0883964 | 3300041498 | Bacteria | 2308 |
| 651 | Ga0451845_0381021 | 3300041501 | Bacteria | 1428 |
| 652 | Ga0451849_0418948 | 3300041505 | Bacteria | 1313 |
| 653 | Ga0451851_0575292 | 3300041507 | Bacteria | 1915 |
| 654 | Ga0439445_0000682 | 3300042004 | Bacteria | 7053 |
| 655 | Ga0439450_038040 | 3300042008 | Bacteria | 1108 |
| 656 | Ga0439452_037084 | 3300042010 | Bacteria | 1164 |
| 657 | Ga0450923_045122 | 3300042125 | Bacteria | 935 |
| 658 | Ga0439459_0021161 | 3300042438 | Bacteria | 1247 |
| 659 | Ga0439464_0023228 | 3300042439 | Bacteria | 1711 |
| 660 | Ga0439464_0040721 | 3300042439 | Bacteria | 1324 |
| 661 | Ga0439460_0041204 | 3300042461 | Bacteria | 1356 |
| 662 | Ga0453683_0119545 | 3300044673 | Bacteria | 1658 |
| 663 | Ga0453683_0153970 | 3300044673 | Bacteria | 1453 |
| 664 | Ga0466966_0043210 | 3300044684 | Bacteria | 2890 |
| 665 | Ga0466961_0171589 | 3300044693 | Bacteria | 1349 |
| 666 | Ga0466963_0066008 | 3300044694 | Bacteria | 2427 |
| 667 | Ga0466964_0007088 | 3300044706 | Bacteria | 4193 |
| 668 | Ga0453684_0161279 | 3300044712 | Bacteria | 2652 |
| 669 | Ga0466970_0042262 | 3300044765 | Bacteria | 2424 |
| 670 | Ga0466970_0210179 | 3300044765 | Bacteria | 1084 |
| 671 | Ga0466959_0037588 | 3300045049 | Bacteria | 3578 |
| 672 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 673 | Ga0451576_0758093 | 3300045051 | Bacteria | 1019 |
| 674 | Ga0466967_0097591 | 3300045976 | Bacteria | 2682 |
| 675 | Ga0495603_0059340 | 3300046455 | Bacteria | 2262 |
| 676 | Ga0495629_0146620 | 3300046459 | Bacteria | 1641 |
| 677 | Ga0495629_0345730 | 3300046459 | Bacteria | 1015 |
| 678 | Ga0495618_0159939 | 3300046514 | Bacteria | 1436 |
| 679 | Ga0495630_0373600 | 3300046517 | Bacteria | 1092 |
| 680 | Ga0495642_0072212 | 3300046528 | Bacteria | 1445 |
| 681 | Ga0495642_0095299 | 3300046528 | Bacteria | 1263 |
| 682 | Ga0495640_0178135 | 3300046533 | Bacteria | 1356 |
| 683 | Ga0495586_0251815 | 3300046535 | Bacteria | 1008 |
| 684 | Ga0495621_0005070 | 3300046539 | Bacteria | 3757 |
| 685 | Ga0495633_0079868 | 3300046558 | Bacteria | 1523 |
| 686 | Ga0495668_0035028 | 3300046616 | Bacteria | 2814 |
| 687 | Ga0495625_0000362 | 3300046660 | Bacteria | 69497 |
| 688 | Ga0495635_0170574 | 3300046663 | Bacteria | 1480 |
| 689 | Ga0495659_0029872 | 3300046664 | Bacteria | 1894 |
| 690 | Ga0495658_0056293 | 3300046683 | Bacteria | 2242 |
| 691 | Ga0495658_0160091 | 3300046683 | Bacteria | 1388 |
| 692 | Ga0495670_0090065 | 3300046691 | Bacteria | 1569 |
| 693 | Ga0495670_0190264 | 3300046691 | Bacteria | 1085 |
| 694 | Ga0495600_0013633 | 3300046809 | Bacteria | 5113 |
| 695 | Ga0495684_0024548 | 3300047471 | Bacteria | 4641 |
| 696 | Ga0495615_0055313 | 3300048090 | Bacteria | 1033 |
| 697 | Ga0496100_0234764 | 3300048903 | Bacteria | 1351 |
| 698 | Ga0496102_0161621 | 3300048905 | Bacteria | 2107 |
| 699 | Ga0496104_0014412 | 3300048907 | Bacteria | 7142 |
| 700 | Ga0496104_0046317 | 3300048907 | Bacteria | 4095 |
| 701 | Ga0496105_0006061 | 3300048908 | Bacteria | 9250 |
| 702 | Ga0496105_0028078 | 3300048908 | Bacteria | 4602 |
| 703 | Ga0496106_0009636 | 3300048909 | Bacteria | 7133 |
| 704 | Ga0496107_0003209 | 3300048910 | Bacteria | 10881 |
| 705 | Ga0496108_0037240 | 3300048911 | Bacteria | 4051 |
| 706 | Ga0496109_0047196 | 3300048912 | Bacteria | 3915 |
| 707 | Ga0496110_0017616 | 3300048913 | Bacteria | 5972 |
| 708 | Ga0496110_0199281 | 3300048913 | Bacteria | 1819 |
| 709 | Ga0496110_0270079 | 3300048913 | Bacteria | 1548 |
| 710 | Ga0496111_0001084 | 3300048914 | Bacteria | 15034 |
| 711 | Ga0496112_0009721 | 3300048915 | Bacteria | 8681 |
| 712 | Ga0496113_0004957 | 3300048916 | Bacteria | 8246 |
| 713 | Ga0496113_0056701 | 3300048916 | Bacteria | 2942 |
| 714 | Ga0496114_0003135 | 3300048917 | Bacteria | 12684 |
| 715 | Ga0496114_0021201 | 3300048917 | Bacteria | 5284 |
| 716 | Ga0496115_0024228 | 3300048918 | Bacteria | 4715 |
| 717 | Ga0496115_0088840 | 3300048918 | Bacteria | 2523 |
| 718 | Ga0496115_0177399 | 3300048918 | Bacteria | 1762 |
| 719 | Ga0496115_0273823 | 3300048918 | Unclassified | 1386 |
| 720 | Ga0496115_0391865 | 3300048918 | Bacteria | 1128 |
| 721 | Ga0496118_0082097 | 3300048921 | Bacteria | 2260 |
| 722 | Ga0496121_0009176 | 3300048924 | Bacteria | 11433 |
| 723 | Ga0496121_0026347 | 3300048924 | Bacteria | 5482 |
| 724 | Ga0496121_0035138 | 3300048924 | Bacteria | 4496 |
| 725 | Ga0496123_0128533 | 3300048926 | Bacteria | 1409 |
| 726 | Ga0496126_0000123 | 3300048929 | Bacteria | 182726 |
| 727 | Ga0496126_0015086 | 3300048929 | Bacteria | 7785 |
| 728 | Ga0496126_0024582 | 3300048929 | Bacteria | 5813 |
| 729 | Ga0496126_0055530 | 3300048929 | Bacteria | 3583 |
| 730 | Ga0496126_0180615 | 3300048929 | Bacteria | 1793 |
| 731 | Ga0501033_0006962 | 3300049570 | Bacteria | 8829 |
| 732 | Ga0501034_0002561 | 3300049571 | Bacteria | 21656 |
| 733 | Ga0501034_0308997 | 3300049571 | Bacteria | 1516 |
| 734 | Ga0501034_0318569 | 3300049571 | Bacteria | 1488 |
| 735 | Ga0501036_0395699 | 3300049572 | Bacteria | 1153 |
| 736 | Ga0501040_0048797 | 3300049576 | Bacteria | 2894 |
| 737 | Ga0501047_0177112 | 3300049581 | Bacteria | 2000 |
| 738 | Ga0501070_0111884 | 3300049586 | Bacteria | 2257 |
| 739 | Ga0501072_0306719 | 3300049588 | Bacteria | 1262 |
| 740 | Ga0501072_0414436 | 3300049588 | Bacteria | 1068 |
| 741 | Ga0501233_056965 | 3300049668 | Bacteria | 961 |
| 742 | Ga0501238_000149 | 3300049671 | Bacteria | 10810 |
| 743 | Ga0501241_016649 | 3300049758 | Bacteria | 1341 |
| 744 | Ga0501269_001740 | 3300049766 | Bacteria | 2779 |
| 745 | Ga0501280_000708 | 3300049776 | Bacteria | 7365 |
| 746 | Ga0501282_005616 | 3300049778 | Bacteria | 1342 |
| 747 | Ga0501282_006148 | 3300049778 | Bacteria | 1284 |
| 748 | Ga0501044_0006427 | 3300049823 | Bacteria | 12984 |
| 749 | Ga0501044_0517754 | 3300049823 | Bacteria | 1093 |
| 750 | nmdc:mga00v17_48861_c1 | 3300050491 | Bacteria | 2565 |
| 751 | nmdc:mga0yw44_105839_c1 | 3300050492 | Bacteria | 1797 |
| 752 | nmdc:mga0yw44_124646_c1 | 3300050492 | Bacteria | 1662 |
| 753 | nmdc:mga06z11_29810_c1 | 3300050494 | Bacteria | 2632 |
| 754 | nmdc:mga07m45_142566_c1 | 3300050496 | Bacteria | 1388 |
| 755 | nmdc:mga05p37_325549_c1 | 3300050507 | Bacteria | 1817 |
| 756 | nmdc:mga09592_223429_c1 | 3300050508 | Bacteria | 1631 |
| 757 | nmdc:mga09592_36737_c1 | 3300050508 | Bacteria | 4104 |
| 758 | nmdc:mga0qj67_63704_c1 | 3300050509 | Bacteria | 2932 |
| 759 | nmdc:mga06r32_6485_c1 | 3300050510 | Bacteria | 10514 |
| 760 | nmdc:mga06r32_71459_c1 | 3300050510 | Bacteria | 3358 |
| 761 | nmdc:mga08y16_158678_c1 | 3300050511 | Bacteria | 2350 |
| 762 | nmdc:mga08y16_528942_c1 | 3300050511 | Bacteria | 1195 |
| 763 | nmdc:mga08y16_80191_c1 | 3300050511 | Bacteria | 3403 |
| 764 | nmdc:mga0n895_19450_c1 | 3300050512 | Bacteria | 6313 |
| 765 | nmdc:mga0rr50_6191_c1 | 3300050513 | Bacteria | 7250 |
| 766 | nmdc:mga08x19_76538_c1 | 3300050514 | Bacteria | 2190 |
| 767 | nmdc:mga0a205_361699_c1 | 3300050515 | Bacteria | 1318 |
| 768 | nmdc:mga0a205_601820_c1 | 3300050515 | Bacteria | 952 |
| 769 | Ga0495601_0019377 | 3300053077 | Bacteria | 4150 |
| 770 | Ga0500635_0002767 | 3300053080 | Bacteria | 4356 |
| 771 | Ga0495619_0126831 | 3300053085 | Bacteria | 1752 |
| 772 | Ga0500646_0047985 | 3300053090 | Bacteria | 1223 |
| 773 | Ga0500641_0017281 | 3300053096 | Bacteria | 2696 |
| 774 | Ga0500559_0015243 | 3300053136 | Bacteria | 3246 |
| 775 | Ga0500568_0000724 | 3300053139 | Bacteria | 23628 |
| 776 | Ga0500568_0003410 | 3300053139 | Bacteria | 8874 |
| 777 | Ga0500584_009662 | 3300053726 | Bacteria | 4294 |
| 778 | Ga0501084_0000216 | 3300054114 | Bacteria | 44550 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10003921 | Ga0157370_100039212 | 243 |
| 2 | 3300027876 | Ga0209974_10109539 | Ga0209974_101095391 | 262 |
| 3 | 3300032004 | Ga0307414_10085742 | Ga0307414_100857422 | 269 |
| 4 | 3300006038 | Ga0075365_10118627 | Ga0075365_101186272 | 271 |
| 5 | 3300044765 | Ga0466970_0210179 | Ga0466970_0210179_28_987 | 271 |
| 6 | 3300005356 | Ga0070674_100154285 | Ga0070674_1001542852 | 272 |
| 7 | 3300005330 | Ga0070690_100189801 | Ga0070690_1001898011 | 273 |
| 8 | 3300005335 | Ga0070666_10007408 | Ga0070666_100074086 | 273 |
| 9 | 3300005347 | Ga0070668_100003541 | Ga0070668_10000354111 | 273 |
| 10 | 3300005354 | Ga0070675_100087113 | Ga0070675_1000871135 | 273 |
| 11 | 3300005364 | Ga0070673_100000655 | Ga0070673_10000065515 | 273 |
| 12 | 3300005456 | Ga0070678_100111900 | Ga0070678_1001119002 | 273 |
| 13 | 3300005459 | Ga0068867_100012739 | Ga0068867_1000127393 | 273 |
| 14 | 3300005466 | Ga0070685_10075512 | Ga0070685_100755121 | 273 |
| 15 | 3300005468 | Ga0070707_100016769 | Ga0070707_1000167694 | 273 |
| 16 | 3300005539 | Ga0068853_100009347 | Ga0068853_1000093479 | 273 |
| 17 | 3300005543 | Ga0070672_100037283 | Ga0070672_1000372833 | 273 |
| 18 | 3300005834 | Ga0068851_10001051 | Ga0068851_1000105114 | 273 |
| 19 | 3300005843 | Ga0068860_100198483 | Ga0068860_1001984833 | 273 |
| 20 | 3300006237 | Ga0097621_100030796 | Ga0097621_1000307962 | 273 |
| 21 | 3300006358 | Ga0068871_100047252 | Ga0068871_1000472523 | 273 |
| 22 | 3300013297 | Ga0157378_10060000 | Ga0157378_100600003 | 273 |
| 23 | 3300013308 | Ga0157375_10061837 | Ga0157375_100618373 | 273 |
| 24 | 3300014969 | Ga0157376_10041860 | Ga0157376_100418602 | 273 |
| 25 | 3300025893 | Ga0207682_10000798 | Ga0207682_100007983 | 273 |
| 26 | 3300025903 | Ga0207680_10108620 | Ga0207680_101086203 | 273 |
| 27 | 3300025907 | Ga0207645_10001048 | Ga0207645_1000104819 | 273 |
| 28 | 3300025926 | Ga0207659_10011881 | Ga0207659_100118813 | 273 |
| 29 | 3300025931 | Ga0207644_10002140 | Ga0207644_100021403 | 273 |
| 30 | 3300025937 | Ga0207669_10002485 | Ga0207669_1000248511 | 273 |
| 31 | 3300025940 | Ga0207691_10000180 | Ga0207691_1000018050 | 273 |
| 32 | 3300025942 | Ga0207689_10199433 | Ga0207689_101994332 | 273 |
| 33 | 3300026041 | Ga0207639_10082507 | Ga0207639_100825073 | 273 |
| 34 | 3300026089 | Ga0207648_10005794 | Ga0207648_1000579414 | 273 |
| 35 | 3300026095 | Ga0207676_10155031 | Ga0207676_101550312 | 273 |
| 36 | 3300026121 | Ga0207683_10000146 | Ga0207683_1000014621 | 273 |
| 37 | 3300028379 | Ga0268266_10287376 | Ga0268266_102873762 | 273 |
| 38 | 3300050492 | nmdc:mga0yw44_124646_c1 | nmdc:mga0yw44_124646_c1_19_1044 | 273 |
| 39 | 3300048924 | Ga0496121_0026347 | Ga0496121_0026347_598_1494 | 274 |
| 40 | 3300006946 | Ga0079104_1016660 | Ga0079104_10166601 | 275 |
| 41 | 3300053136 | Ga0500559_0015243 | Ga0500559_0015243_1171_2067 | 275 |
| 42 | 3300005295 | Ga0065707_10001302 | Ga0065707_100013026 | 276 |
| 43 | 3300005434 | Ga0070709_10056874 | Ga0070709_100568743 | 276 |
| 44 | 3300005435 | Ga0070714_100102162 | Ga0070714_1001021622 | 276 |
| 45 | 3300005436 | Ga0070713_100227997 | Ga0070713_1002279972 | 276 |
| 46 | 3300005437 | Ga0070710_10025987 | Ga0070710_100259872 | 276 |
| 47 | 3300005439 | Ga0070711_100053234 | Ga0070711_1000532342 | 276 |
| 48 | 3300006028 | Ga0070717_10080300 | Ga0070717_100803002 | 276 |
| 49 | 3300006175 | Ga0070712_100201659 | Ga0070712_1002016592 | 276 |
| 50 | 3300009092 | Ga0105250_10000006 | Ga0105250_10000006130 | 276 |
| 51 | 3300014968 | Ga0157379_10000830 | Ga0157379_100008304 | 276 |
| 52 | 3300025711 | Ga0207696_1000069 | Ga0207696_1000069130 | 276 |
| 53 | 3300025906 | Ga0207699_10004323 | Ga0207699_100043233 | 276 |
| 54 | 3300025915 | Ga0207693_10024239 | Ga0207693_100242395 | 276 |
| 55 | 3300025928 | Ga0207700_10071401 | Ga0207700_100714014 | 276 |
| 56 | 3300025929 | Ga0207664_10005921 | Ga0207664_100059217 | 276 |
| 57 | 3300027111 | Ga0209281_1004536 | Ga0209281_10045362 | 276 |
| 58 | 3300048929 | Ga0496126_0015086 | Ga0496126_0015086_976_1872 | 276 |
| 59 | 3300006946 | Ga0079104_1000146 | Ga0079104_100014670 | 277 |
| 60 | 3300015261 | Ga0182006_1017283 | Ga0182006_10172832 | 277 |
| 61 | 3300015261 | Ga0182006_1017297 | Ga0182006_10172972 | 277 |
| 62 | 3300027111 | Ga0209281_1000045 | Ga0209281_1000045124 | 277 |
| 63 | 3300032139 | Ga0316580_10041620 | Ga0316580_100416201 | 278 |
| 64 | 3300041498 | Ga0451841_0883964 | Ga0451841_0883964_631_1524 | 278 |
| 65 | 3300041501 | Ga0451845_0381021 | Ga0451845_0381021_442_1335 | 278 |
| 66 | 3300041505 | Ga0451849_0418948 | Ga0451849_0418948_357_1250 | 278 |
| 67 | 3300041507 | Ga0451851_0575292 | Ga0451851_0575292_947_1840 | 278 |
| 68 | 3300048908 | Ga0496105_0028078 | Ga0496105_0028078_2015_2851 | 278 |
| 69 | 3300025907 | Ga0207645_10055042 | Ga0207645_100550422 | 279 |
| 70 | 3300005985 | Ga0081539_10045116 | Ga0081539_100451162 | 280 |
| 71 | 3300009011 | Ga0105251_10055930 | Ga0105251_100559301 | 280 |
| 72 | 3300005347 | Ga0070668_100093435 | Ga0070668_1000934352 | 281 |
| 73 | 3300031733 | Ga0316577_10028417 | Ga0316577_100284172 | 282 |
| 74 | 3300036647 | Ga0316582_0151651 | Ga0316582_0151651_279_1172 | 282 |
| 75 | 3300036712 | Ga0316584_0324251 | Ga0316584_0324251_181_1074 | 282 |
| 76 | 3300003320 | rootH2_10036006 | rootH2_100360064 | 283 |
| 77 | 3300006178 | Ga0075367_10283228 | Ga0075367_102832281 | 284 |
| 78 | 3300005617 | Ga0068859_100035474 | Ga0068859_1000354744 | 285 |
| 79 | 3300006931 | Ga0097620_100035474 | Ga0097620_1000354744 | 285 |
| 80 | 3300013104 | Ga0157370_10013827 | Ga0157370_1001382710 | 286 |
| 81 | 3300053080 | Ga0500635_0002767 | Ga0500635_0002767_2024_2956 | 287 |
| 82 | 3300053090 | Ga0500646_0047985 | Ga0500646_0047985_163_1095 | 287 |
| 83 | 3300049778 | Ga0501282_005616 | Ga0501282_005616_161_1057 | 289 |
| 84 | 3300005355 | Ga0070671_100024813 | Ga0070671_1000248134 | 290 |
| 85 | 3300005366 | Ga0070659_100046732 | Ga0070659_1000467322 | 290 |
| 86 | 3300005455 | Ga0070663_100058868 | Ga0070663_1000588683 | 290 |
| 87 | 3300005616 | Ga0068852_100262884 | Ga0068852_1002628842 | 290 |
| 88 | 3300025932 | Ga0207690_10074617 | Ga0207690_100746172 | 290 |
| 89 | 3300031727 | Ga0316576_10125682 | Ga0316576_101256822 | 290 |
| 90 | 3300046664 | Ga0495659_0029872 | Ga0495659_0029872_681_1553 | 290 |
| 91 | 3300048090 | Ga0495615_0055313 | Ga0495615_0055313_56_943 | 290 |
| 92 | 3300050507 | nmdc:mga05p37_325549_c1 | nmdc:mga05p37_325549_c1_230_1114 | 290 |
| 93 | iso_pu_bacteria | 2818991441 | 2819570210 | 290 |
| 94 | iso_pu_bacteria | 3006969106 | 3006970355 | 290 |
| 95 | 3300036647 | Ga0316582_0236407 | Ga0316582_0236407_326_1201 | 291 |
| 96 | 3300037418 | Ga0395900_0115958 | Ga0395900_0115958_957_1832 | 291 |
| 97 | iso_pu_bacteria | 2519899754 | 2520880368 | 291 |
| 98 | iso_pu_bacteria | 2643221563 | 2643835659 | 291 |
| 99 | iso_pu_bacteria | 2643221608 | 2644056585 | 291 |
| 100 | iso_pu_bacteria | 2852653556 | 2852655214 | 291 |
| 101 | iso_pu_bacteria | 2857472729 | 2857474403 | 291 |
| 102 | iso_pu_bacteria | 2882806704 | 2882807950 | 291 |
| 103 | iso_pu_bacteria | 2895880812 | 2895882595 | 291 |
| 104 | iso_pu_bacteria | 2907202186 | 2907204250 | 291 |
| 105 | iso_pu_bacteria | 3006988479 | 3006990362 | 291 |
| 106 | iso_pu_bacteria | 8055632911 | 8055637247 | 291 |
| 107 | iso_pu_bacteria | 2881359912 | 2881361323 | 292 |
| 108 | 3300005937 | Ga0081455_10086820 | Ga0081455_100868203 | 293 |
| 109 | 3300006038 | Ga0075365_10193734 | Ga0075365_101937341 | 293 |
| 110 | 3300031995 | Ga0307409_100275035 | Ga0307409_1002750352 | 293 |
| 111 | iso_pu_bacteria | 2919513703 | 2919514161 | 293 |
| 112 | iso_pu_bacteria | 2919675420 | 2919676067 | 293 |
| 113 | 3300005331 | Ga0070670_100088663 | Ga0070670_1000886632 | 294 |
| 114 | 3300005334 | Ga0068869_100104841 | Ga0068869_1001048411 | 294 |
| 115 | 3300005339 | Ga0070660_100098032 | Ga0070660_1000980323 | 294 |
| 116 | 3300005339 | Ga0070660_100214305 | Ga0070660_1002143052 | 294 |
| 117 | 3300005347 | Ga0070668_100008311 | Ga0070668_1000083118 | 294 |
| 118 | 3300005356 | Ga0070674_100130282 | Ga0070674_1001302822 | 294 |
| 119 | 3300005366 | Ga0070659_100089500 | Ga0070659_1000895003 | 294 |
| 120 | 3300005367 | Ga0070667_100144558 | Ga0070667_1001445582 | 294 |
| 121 | 3300005457 | Ga0070662_100027611 | Ga0070662_1000276112 | 294 |
| 122 | 3300005459 | Ga0068867_100060218 | Ga0068867_1000602182 | 294 |
| 123 | 3300005530 | Ga0070679_100148494 | Ga0070679_1001484942 | 294 |
| 124 | 3300005539 | Ga0068853_100026886 | Ga0068853_1000268865 | 294 |
| 125 | 3300005548 | Ga0070665_100056106 | Ga0070665_1000561062 | 294 |
| 126 | 3300005616 | Ga0068852_100183993 | Ga0068852_1001839932 | 294 |
| 127 | 3300005618 | Ga0068864_100116887 | Ga0068864_1001168873 | 294 |
| 128 | 3300005842 | Ga0068858_100585921 | Ga0068858_1005859212 | 294 |
| 129 | 3300005937 | Ga0081455_10042044 | Ga0081455_100420447 | 294 |
| 130 | 3300006038 | Ga0075365_10204591 | Ga0075365_102045912 | 294 |
| 131 | 3300009093 | Ga0105240_10010715 | Ga0105240_100107157 | 294 |
| 132 | 3300009147 | Ga0114129_10520896 | Ga0114129_105208962 | 294 |
| 133 | 3300009545 | Ga0105237_10013036 | Ga0105237_1001303612 | 294 |
| 134 | 3300010375 | Ga0105239_10000037 | Ga0105239_10000037191 | 294 |
| 135 | 3300013102 | Ga0157371_10008583 | Ga0157371_100085837 | 294 |
| 136 | 3300013102 | Ga0157371_10039729 | Ga0157371_100397294 | 294 |
| 137 | 3300013102 | Ga0157371_10131106 | Ga0157371_101311062 | 294 |
| 138 | 3300017792 | Ga0163161_10287141 | Ga0163161_102871411 | 294 |
| 139 | 3300025899 | Ga0207642_10246690 | Ga0207642_102466901 | 294 |
| 140 | 3300025908 | Ga0207643_10123129 | Ga0207643_101231292 | 294 |
| 141 | 3300025913 | Ga0207695_10001017 | Ga0207695_100010177 | 294 |
| 142 | 3300025913 | Ga0207695_10046636 | Ga0207695_100466362 | 294 |
| 143 | 3300025914 | Ga0207671_10004808 | Ga0207671_1000480811 | 294 |
| 144 | 3300025919 | Ga0207657_10085036 | Ga0207657_100850363 | 294 |
| 145 | 3300025921 | Ga0207652_10354277 | Ga0207652_103542772 | 294 |
| 146 | 3300025923 | Ga0207681_10186577 | Ga0207681_101865773 | 294 |
| 147 | 3300025933 | Ga0207706_10022657 | Ga0207706_100226575 | 294 |
| 148 | 3300025938 | Ga0207704_10030885 | Ga0207704_100308851 | 294 |
| 149 | 3300025940 | Ga0207691_10038037 | Ga0207691_100380373 | 294 |
| 150 | 3300025940 | Ga0207691_10054083 | Ga0207691_100540834 | 294 |
| 151 | 3300025942 | Ga0207689_10049684 | Ga0207689_100496845 | 294 |
| 152 | 3300025972 | Ga0207668_10000060 | Ga0207668_1000006074 | 294 |
| 153 | 3300026067 | Ga0207678_10008182 | Ga0207678_100081825 | 294 |
| 154 | 3300026089 | Ga0207648_10012777 | Ga0207648_100127774 | 294 |
| 155 | 3300026116 | Ga0207674_10030489 | Ga0207674_100304895 | 294 |
| 156 | 3300026121 | Ga0207683_10346564 | Ga0207683_103465642 | 294 |
| 157 | 3300027876 | Ga0209974_10014042 | Ga0209974_100140422 | 294 |
| 158 | 3300031728 | Ga0316578_10166068 | Ga0316578_101660682 | 294 |
| 159 | 3300031731 | Ga0307405_10010037 | Ga0307405_100100373 | 294 |
| 160 | 3300031852 | Ga0307410_10005332 | Ga0307410_100053328 | 294 |
| 161 | 3300031903 | Ga0307407_10001616 | Ga0307407_100016168 | 294 |
| 162 | 3300031911 | Ga0307412_10111294 | Ga0307412_101112942 | 294 |
| 163 | 3300031911 | Ga0307412_10151594 | Ga0307412_101515943 | 294 |
| 164 | 3300032004 | Ga0307414_10048545 | Ga0307414_100485454 | 294 |
| 165 | 3300035398 | Ga0316574_0035454 | Ga0316574_0035454_1870_2787 | 294 |
| 166 | 3300036647 | Ga0316582_0035066 | Ga0316582_0035066_38_955 | 294 |
| 167 | 3300036712 | Ga0316584_0080062 | Ga0316584_0080062_85_969 | 294 |
| 168 | 3300036712 | Ga0316584_0127517 | Ga0316584_0127517_76_993 | 294 |
| 169 | 3300042125 | Ga0450923_045122 | Ga0450923_045122_22_921 | 294 |
| 170 | 3300044693 | Ga0466961_0171589 | Ga0466961_0171589_355_1254 | 294 |
| 171 | 3300044694 | Ga0466963_0066008 | Ga0466963_0066008_133_1032 | 294 |
| 172 | 3300044706 | Ga0466964_0007088 | Ga0466964_0007088_1982_2881 | 294 |
| 173 | 3300044765 | Ga0466970_0042262 | Ga0466970_0042262_1402_2301 | 294 |
| 174 | 3300045976 | Ga0466967_0097591 | Ga0466967_0097591_1681_2580 | 294 |
| 175 | 3300046528 | Ga0495642_0095299 | Ga0495642_0095299_53_940 | 294 |
| 176 | 3300048918 | Ga0496115_0088840 | Ga0496115_0088840_507_1397 | 294 |
| 177 | 3300048918 | Ga0496115_0273823 | Ga0496115_0273823_442_1332 | 294 |
| 178 | 3300048921 | Ga0496118_0082097 | Ga0496118_0082097_872_1768 | 294 |
| 179 | 3300048924 | Ga0496121_0009176 | Ga0496121_0009176_1588_2484 | 294 |
| 180 | 3300048929 | Ga0496126_0024582 | Ga0496126_0024582_504_1400 | 294 |
| 181 | 3300048929 | Ga0496126_0180615 | Ga0496126_0180615_593_1483 | 294 |
| 182 | 3300049570 | Ga0501033_0006962 | Ga0501033_0006962_1263_2147 | 294 |
| 183 | 3300049581 | Ga0501047_0177112 | Ga0501047_0177112_788_1672 | 294 |
| 184 | 3300049668 | Ga0501233_056965 | Ga0501233_056965_44_943 | 294 |
| 185 | 3300049823 | Ga0501044_0006427 | Ga0501044_0006427_1484_2368 | 294 |
| 186 | 3300049823 | Ga0501044_0517754 | Ga0501044_0517754_46_933 | 294 |
| 187 | 3300050492 | nmdc:mga0yw44_105839_c1 | nmdc:mga0yw44_105839_c1_317_1201 | 294 |
| 188 | 3300050496 | nmdc:mga07m45_142566_c1 | nmdc:mga07m45_142566_c1_440_1327 | 294 |
| 189 | 3300053139 | Ga0500568_0003410 | Ga0500568_0003410_7821_8732 | 294 |
| 190 | iso_pu_bacteria | 2643221600 | 2644012242 | 294 |
| 191 | iso_pu_bacteria | 2643221716 | 2644641524 | 294 |
| 192 | iso_pu_bacteria | 2643221725 | 2644682366 | 294 |
| 193 | iso_pu_bacteria | 2739367857 | 2740000475 | 294 |
| 194 | iso_pu_bacteria | 2739367858 | 2740005291 | 294 |
| 195 | iso_pu_bacteria | 2802428842 | 2802651138 | 294 |
| 196 | iso_pu_bacteria | 2816332280 | 2817414026 | 294 |
| 197 | iso_pu_bacteria | 2903895155 | 2903896569 | 294 |
| 198 | iso_pu_bacteria | 2904555929 | 2904557657 | 294 |
| 199 | iso_pu_bacteria | 2919191525 | 2919195828 | 294 |
| 200 | iso_pu_bacteria | 2958458903 | 2958461781 | 294 |
| 201 | iso_pu_bacteria | 2977268062 | 2977272549 | 294 |
| 202 | iso_pu_bacteria | 8054307821 | 8054310983 | 294 |
| 203 | iso_pu_bacteria | 8055419101 | 8055420243 | 294 |
| 204 | 3300003203 | JGI25406J46586_10011250 | JGI25406J46586_100112503 | 295 |
| 205 | 3300003761 | Ga0055535_1009958 | Ga0055535_10099581 | 295 |
| 206 | 3300003791 | Ga0055530_10000095 | Ga0055530_1000009566 | 295 |
| 207 | 3300003791 | Ga0055530_10024324 | Ga0055530_100243242 | 295 |
| 208 | 3300003794 | Ga0055531_10002750 | Ga0055531_100027509 | 295 |
| 209 | 3300003794 | Ga0055531_10004838 | Ga0055531_100048389 | 295 |
| 210 | 3300003841 | Ga0055541_1004028 | Ga0055541_10040282 | 295 |
| 211 | 3300005295 | Ga0065707_10247678 | Ga0065707_102476782 | 295 |
| 212 | 3300005328 | Ga0070676_10044650 | Ga0070676_100446503 | 295 |
| 213 | 3300005328 | Ga0070676_10114050 | Ga0070676_101140502 | 295 |
| 214 | 3300005331 | Ga0070670_100036862 | Ga0070670_1000368622 | 295 |
| 215 | 3300005331 | Ga0070670_100069322 | Ga0070670_1000693223 | 295 |
| 216 | 3300005334 | Ga0068869_100009681 | Ga0068869_1000096815 | 295 |
| 217 | 3300005334 | Ga0068869_100070150 | Ga0068869_1000701503 | 295 |
| 218 | 3300005335 | Ga0070666_10021517 | Ga0070666_100215174 | 295 |
| 219 | 3300005335 | Ga0070666_10340433 | Ga0070666_103404331 | 295 |
| 220 | 3300005336 | Ga0070680_100201120 | Ga0070680_1002011202 | 295 |
| 221 | 3300005337 | Ga0070682_100007256 | Ga0070682_1000072562 | 295 |
| 222 | 3300005338 | Ga0068868_100010777 | Ga0068868_1000107772 | 295 |
| 223 | 3300005339 | Ga0070660_100081063 | Ga0070660_1000810632 | 295 |
| 224 | 3300005340 | Ga0070689_100452621 | Ga0070689_1004526212 | 295 |
| 225 | 3300005341 | Ga0070691_10002104 | Ga0070691_100021045 | 295 |
| 226 | 3300005345 | Ga0070692_10038830 | Ga0070692_100388303 | 295 |
| 227 | 3300005347 | Ga0070668_100025721 | Ga0070668_1000257214 | 295 |
| 228 | 3300005347 | Ga0070668_100043584 | Ga0070668_1000435842 | 295 |
| 229 | 3300005347 | Ga0070668_100115903 | Ga0070668_1001159032 | 295 |
| 230 | 3300005353 | Ga0070669_100054641 | Ga0070669_1000546412 | 295 |
| 231 | 3300005354 | Ga0070675_100013399 | Ga0070675_1000133995 | 295 |
| 232 | 3300005355 | Ga0070671_100007579 | Ga0070671_1000075795 | 295 |
| 233 | 3300005356 | Ga0070674_100046640 | Ga0070674_1000466403 | 295 |
| 234 | 3300005356 | Ga0070674_100159097 | Ga0070674_1001590971 | 295 |
| 235 | 3300005356 | Ga0070674_100236272 | Ga0070674_1002362722 | 295 |
| 236 | 3300005364 | Ga0070673_100134718 | Ga0070673_1001347183 | 295 |
| 237 | 3300005364 | Ga0070673_100174380 | Ga0070673_1001743802 | 295 |
| 238 | 3300005366 | Ga0070659_100061193 | Ga0070659_1000611932 | 295 |
| 239 | 3300005367 | Ga0070667_100022052 | Ga0070667_1000220524 | 295 |
| 240 | 3300005367 | Ga0070667_100049692 | Ga0070667_1000496923 | 295 |
| 241 | 3300005367 | Ga0070667_100163160 | Ga0070667_1001631602 | 295 |
| 242 | 3300005435 | Ga0070714_100047289 | Ga0070714_1000472892 | 295 |
| 243 | 3300005436 | Ga0070713_100000129 | Ga0070713_10000012944 | 295 |
| 244 | 3300005436 | Ga0070713_100011017 | Ga0070713_1000110175 | 295 |
| 245 | 3300005438 | Ga0070701_10018566 | Ga0070701_100185664 | 295 |
| 246 | 3300005438 | Ga0070701_10128777 | Ga0070701_101287772 | 295 |
| 247 | 3300005440 | Ga0070705_100059544 | Ga0070705_1000595441 | 295 |
| 248 | 3300005441 | Ga0070700_100107989 | Ga0070700_1001079893 | 295 |
| 249 | 3300005445 | Ga0070708_100210850 | Ga0070708_1002108502 | 295 |
| 250 | 3300005455 | Ga0070663_100002768 | Ga0070663_1000027688 | 295 |
| 251 | 3300005455 | Ga0070663_100384310 | Ga0070663_1003843101 | 295 |
| 252 | 3300005456 | Ga0070678_100016864 | Ga0070678_1000168645 | 295 |
| 253 | 3300005456 | Ga0070678_100058624 | Ga0070678_1000586242 | 295 |
| 254 | 3300005456 | Ga0070678_100087487 | Ga0070678_1000874873 | 295 |
| 255 | 3300005458 | Ga0070681_10036085 | Ga0070681_100360853 | 295 |
| 256 | 3300005459 | Ga0068867_100008910 | Ga0068867_1000089103 | 295 |
| 257 | 3300005459 | Ga0068867_100144524 | Ga0068867_1001445242 | 295 |
| 258 | 3300005467 | Ga0070706_100159173 | Ga0070706_1001591733 | 295 |
| 259 | 3300005518 | Ga0070699_100000708 | Ga0070699_10000070810 | 295 |
| 260 | 3300005530 | Ga0070679_100018240 | Ga0070679_1000182403 | 295 |
| 261 | 3300005543 | Ga0070672_100335838 | Ga0070672_1003358382 | 295 |
| 262 | 3300005547 | Ga0070693_100008277 | Ga0070693_1000082772 | 295 |
| 263 | 3300005548 | Ga0070665_100036933 | Ga0070665_1000369334 | 295 |
| 264 | 3300005548 | Ga0070665_100042010 | Ga0070665_1000420103 | 295 |
| 265 | 3300005563 | Ga0068855_100214605 | Ga0068855_1002146053 | 295 |
| 266 | 3300005564 | Ga0070664_100121064 | Ga0070664_1001210642 | 295 |
| 267 | 3300005578 | Ga0068854_100012579 | Ga0068854_1000125791 | 295 |
| 268 | 3300005578 | Ga0068854_100025046 | Ga0068854_1000250462 | 295 |
| 269 | 3300005614 | Ga0068856_100004065 | Ga0068856_10000406516 | 295 |
| 270 | 3300005615 | Ga0070702_100003679 | Ga0070702_1000036794 | 295 |
| 271 | 3300005615 | Ga0070702_100068191 | Ga0070702_1000681912 | 295 |
| 272 | 3300005616 | Ga0068852_100039684 | Ga0068852_1000396844 | 295 |
| 273 | 3300005616 | Ga0068852_100041014 | Ga0068852_1000410145 | 295 |
| 274 | 3300005616 | Ga0068852_100157893 | Ga0068852_1001578931 | 295 |
| 275 | 3300005617 | Ga0068859_100032362 | Ga0068859_1000323622 | 295 |
| 276 | 3300005617 | Ga0068859_100079439 | Ga0068859_1000794393 | 295 |
| 277 | 3300005617 | Ga0068859_100674452 | Ga0068859_1006744521 | 295 |
| 278 | 3300005618 | Ga0068864_100027348 | Ga0068864_1000273482 | 295 |
| 279 | 3300005618 | Ga0068864_100149781 | Ga0068864_1001497813 | 295 |
| 280 | 3300005618 | Ga0068864_100283518 | Ga0068864_1002835182 | 295 |
| 281 | 3300005718 | Ga0068866_10118921 | Ga0068866_101189211 | 295 |
| 282 | 3300005719 | Ga0068861_100003730 | Ga0068861_10000373012 | 295 |
| 283 | 3300005719 | Ga0068861_100095142 | Ga0068861_1000951422 | 295 |
| 284 | 3300005834 | Ga0068851_10009294 | Ga0068851_100092942 | 295 |
| 285 | 3300005834 | Ga0068851_10077806 | Ga0068851_100778063 | 295 |
| 286 | 3300005840 | Ga0068870_10001962 | Ga0068870_100019625 | 295 |
| 287 | 3300005841 | Ga0068863_100016873 | Ga0068863_1000168732 | 295 |
| 288 | 3300005842 | Ga0068858_100020301 | Ga0068858_1000203015 | 295 |
| 289 | 3300005842 | Ga0068858_100076998 | Ga0068858_1000769983 | 295 |
| 290 | 3300005842 | Ga0068858_100145629 | Ga0068858_1001456293 | 295 |
| 291 | 3300005842 | Ga0068858_100402097 | Ga0068858_1004020972 | 295 |
| 292 | 3300005843 | Ga0068860_100022098 | Ga0068860_1000220983 | 295 |
| 293 | 3300005843 | Ga0068860_100126704 | Ga0068860_1001267043 | 295 |
| 294 | 3300005843 | Ga0068860_100515916 | Ga0068860_1005159161 | 295 |
| 295 | 3300005844 | Ga0068862_100011911 | Ga0068862_1000119115 | 295 |
| 296 | 3300005844 | Ga0068862_100178804 | Ga0068862_1001788042 | 295 |
| 297 | 3300005844 | Ga0068862_100485875 | Ga0068862_1004858751 | 295 |
| 298 | 3300005985 | Ga0081539_10000927 | Ga0081539_1000092730 | 295 |
| 299 | 3300006028 | Ga0070717_10012513 | Ga0070717_100125134 | 295 |
| 300 | 3300006028 | Ga0070717_10070126 | Ga0070717_100701262 | 295 |
| 301 | 3300006028 | Ga0070717_10216537 | Ga0070717_102165372 | 295 |
| 302 | 3300006028 | Ga0070717_10620385 | Ga0070717_106203851 | 295 |
| 303 | 3300006178 | Ga0075367_10039793 | Ga0075367_100397932 | 295 |
| 304 | 3300006237 | Ga0097621_100014203 | Ga0097621_1000142035 | 295 |
| 305 | 3300006358 | Ga0068871_100022746 | Ga0068871_1000227463 | 295 |
| 306 | 3300006358 | Ga0068871_100043670 | Ga0068871_1000436704 | 295 |
| 307 | 3300006846 | Ga0075430_100335223 | Ga0075430_1003352231 | 295 |
| 308 | 3300006852 | Ga0075433_10011974 | Ga0075433_100119745 | 295 |
| 309 | 3300006871 | Ga0075434_100008016 | Ga0075434_1000080163 | 295 |
| 310 | 3300006880 | Ga0075429_100150497 | Ga0075429_1001504972 | 295 |
| 311 | 3300006881 | Ga0068865_100008038 | Ga0068865_1000080383 | 295 |
| 312 | 3300006914 | Ga0075436_100010195 | Ga0075436_1000101955 | 295 |
| 313 | 3300006931 | Ga0097620_100032362 | Ga0097620_1000323625 | 295 |
| 314 | 3300006931 | Ga0097620_100079438 | Ga0097620_1000794383 | 295 |
| 315 | 3300006931 | Ga0097620_100674499 | Ga0097620_1006744991 | 295 |
| 316 | 3300006946 | Ga0079104_1023901 | Ga0079104_10239012 | 295 |
| 317 | 3300007076 | Ga0075435_100012598 | Ga0075435_1000125983 | 295 |
| 318 | 3300009093 | Ga0105240_10017187 | Ga0105240_100171873 | 295 |
| 319 | 3300009093 | Ga0105240_10089075 | Ga0105240_100890753 | 295 |
| 320 | 3300009094 | Ga0111539_10307347 | Ga0111539_103073473 | 295 |
| 321 | 3300009094 | Ga0111539_10683653 | Ga0111539_106836531 | 295 |
| 322 | 3300009098 | Ga0105245_10026816 | Ga0105245_100268161 | 295 |
| 323 | 3300009098 | Ga0105245_10448387 | Ga0105245_104483871 | 295 |
| 324 | 3300009148 | Ga0105243_10034179 | Ga0105243_100341793 | 295 |
| 325 | 3300009174 | Ga0105241_10025396 | Ga0105241_100253964 | 295 |
| 326 | 3300009174 | Ga0105241_10195305 | Ga0105241_101953051 | 295 |
| 327 | 3300009545 | Ga0105237_10046598 | Ga0105237_100465985 | 295 |
| 328 | 3300009545 | Ga0105237_10209728 | Ga0105237_102097281 | 295 |
| 329 | 3300009551 | Ga0105238_10142509 | Ga0105238_101425093 | 295 |
| 330 | 3300009553 | Ga0105249_10014648 | Ga0105249_100146485 | 295 |
| 331 | 3300009553 | Ga0105249_10107042 | Ga0105249_101070422 | 295 |
| 332 | 3300010375 | Ga0105239_10111081 | Ga0105239_101110811 | 295 |
| 333 | 3300010375 | Ga0105239_10648910 | Ga0105239_106489102 | 295 |
| 334 | 3300011119 | Ga0105246_10007529 | Ga0105246_100075294 | 295 |
| 335 | 3300013100 | Ga0157373_10080711 | Ga0157373_100807112 | 295 |
| 336 | 3300013102 | Ga0157371_10165535 | Ga0157371_101655352 | 295 |
| 337 | 3300013296 | Ga0157374_10016721 | Ga0157374_100167215 | 295 |
| 338 | 3300013296 | Ga0157374_10074957 | Ga0157374_100749573 | 295 |
| 339 | 3300013297 | Ga0157378_10000631 | Ga0157378_1000063126 | 295 |
| 340 | 3300013306 | Ga0163162_10005487 | Ga0163162_100054876 | 295 |
| 341 | 3300013308 | Ga0157375_10108044 | Ga0157375_101080443 | 295 |
| 342 | 3300013308 | Ga0157375_10155169 | Ga0157375_101551692 | 295 |
| 343 | 3300013308 | Ga0157375_10286061 | Ga0157375_102860612 | 295 |
| 344 | 3300014326 | Ga0157380_10032855 | Ga0157380_100328554 | 295 |
| 345 | 3300014326 | Ga0157380_10078277 | Ga0157380_100782772 | 295 |
| 346 | 3300014326 | Ga0157380_10080884 | Ga0157380_100808843 | 295 |
| 347 | 3300014745 | Ga0157377_10280655 | Ga0157377_102806551 | 295 |
| 348 | 3300014968 | Ga0157379_10039058 | Ga0157379_100390582 | 295 |
| 349 | 3300014968 | Ga0157379_10253425 | Ga0157379_102534252 | 295 |
| 350 | 3300014969 | Ga0157376_10051232 | Ga0157376_100512324 | 295 |
| 351 | 3300014969 | Ga0157376_10061915 | Ga0157376_100619153 | 295 |
| 352 | 3300014969 | Ga0157376_10096073 | Ga0157376_100960733 | 295 |
| 353 | 3300017792 | Ga0163161_10511148 | Ga0163161_105111481 | 295 |
| 354 | 3300020082 | Ga0206353_11795824 | Ga0206353_117958242 | 295 |
| 355 | 3300025225 | Ga0209566_100052 | Ga0209566_10005280 | 295 |
| 356 | 3300025242 | Ga0209258_101156 | Ga0209258_1011563 | 295 |
| 357 | 3300025291 | Ga0209675_1000025 | Ga0209675_1000025124 | 295 |
| 358 | 3300025292 | Ga0209676_1000198 | Ga0209676_100019852 | 295 |
| 359 | 3300025292 | Ga0209676_1000362 | Ga0209676_100036267 | 295 |
| 360 | 3300025292 | Ga0209676_1003189 | Ga0209676_10031897 | 295 |
| 361 | 3300025292 | Ga0209676_1041396 | Ga0209676_10413962 | 295 |
| 362 | 3300025294 | Ga0209025_1019137 | Ga0209025_10191373 | 295 |
| 363 | 3300025294 | Ga0209025_1041993 | Ga0209025_10419931 | 295 |
| 364 | 3300025298 | Ga0209050_1000849 | Ga0209050_100084925 | 295 |
| 365 | 3300025298 | Ga0209050_1003508 | Ga0209050_10035089 | 295 |
| 366 | 3300025304 | Ga0209257_1000860 | Ga0209257_10008607 | 295 |
| 367 | 3300025304 | Ga0209257_1001370 | Ga0209257_100137011 | 295 |
| 368 | 3300025304 | Ga0209257_1003116 | Ga0209257_100311619 | 295 |
| 369 | 3300025899 | Ga0207642_10025189 | Ga0207642_100251893 | 295 |
| 370 | 3300025900 | Ga0207710_10015418 | Ga0207710_100154183 | 295 |
| 371 | 3300025901 | Ga0207688_10048236 | Ga0207688_100482362 | 295 |
| 372 | 3300025901 | Ga0207688_10066672 | Ga0207688_100666723 | 295 |
| 373 | 3300025904 | Ga0207647_10146562 | Ga0207647_101465622 | 295 |
| 374 | 3300025904 | Ga0207647_10167662 | Ga0207647_101676622 | 295 |
| 375 | 3300025907 | Ga0207645_10047151 | Ga0207645_100471513 | 295 |
| 376 | 3300025907 | Ga0207645_10094092 | Ga0207645_100940922 | 295 |
| 377 | 3300025908 | Ga0207643_10000594 | Ga0207643_100005945 | 295 |
| 378 | 3300025913 | Ga0207695_10031430 | Ga0207695_100314305 | 295 |
| 379 | 3300025914 | Ga0207671_10052375 | Ga0207671_100523753 | 295 |
| 380 | 3300025914 | Ga0207671_10091997 | Ga0207671_100919972 | 295 |
| 381 | 3300025916 | Ga0207663_10016077 | Ga0207663_100160774 | 295 |
| 382 | 3300025917 | Ga0207660_10007800 | Ga0207660_100078003 | 295 |
| 383 | 3300025918 | Ga0207662_10155727 | Ga0207662_101557272 | 295 |
| 384 | 3300025919 | Ga0207657_10022327 | Ga0207657_100223272 | 295 |
| 385 | 3300025919 | Ga0207657_10076906 | Ga0207657_100769063 | 295 |
| 386 | 3300025920 | Ga0207649_10002784 | Ga0207649_100027842 | 295 |
| 387 | 3300025921 | Ga0207652_10122608 | Ga0207652_101226083 | 295 |
| 388 | 3300025922 | Ga0207646_10001356 | Ga0207646_100013565 | 295 |
| 389 | 3300025923 | Ga0207681_10080936 | Ga0207681_100809362 | 295 |
| 390 | 3300025924 | Ga0207694_10248910 | Ga0207694_102489102 | 295 |
| 391 | 3300025925 | Ga0207650_10001016 | Ga0207650_1000101615 | 295 |
| 392 | 3300025926 | Ga0207659_10019574 | Ga0207659_100195744 | 295 |
| 393 | 3300025926 | Ga0207659_10236941 | Ga0207659_102369412 | 295 |
| 394 | 3300025927 | Ga0207687_10030832 | Ga0207687_100308323 | 295 |
| 395 | 3300025928 | Ga0207700_10000044 | Ga0207700_1000004464 | 295 |
| 396 | 3300025928 | Ga0207700_10001414 | Ga0207700_1000141414 | 295 |
| 397 | 3300025929 | Ga0207664_10036227 | Ga0207664_100362272 | 295 |
| 398 | 3300025929 | Ga0207664_10449804 | Ga0207664_104498041 | 295 |
| 399 | 3300025932 | Ga0207690_10194039 | Ga0207690_101940392 | 295 |
| 400 | 3300025932 | Ga0207690_10227839 | Ga0207690_102278392 | 295 |
| 401 | 3300025933 | Ga0207706_10015081 | Ga0207706_100150811 | 295 |
| 402 | 3300025935 | Ga0207709_10081325 | Ga0207709_100813252 | 295 |
| 403 | 3300025936 | Ga0207670_10051408 | Ga0207670_100514082 | 295 |
| 404 | 3300025936 | Ga0207670_10380867 | Ga0207670_103808672 | 295 |
| 405 | 3300025937 | Ga0207669_10067523 | Ga0207669_100675232 | 295 |
| 406 | 3300025937 | Ga0207669_10077647 | Ga0207669_100776472 | 295 |
| 407 | 3300025938 | Ga0207704_10190312 | Ga0207704_101903122 | 295 |
| 408 | 3300025939 | Ga0207665_10384990 | Ga0207665_103849902 | 295 |
| 409 | 3300025940 | Ga0207691_10007125 | Ga0207691_100071253 | 295 |
| 410 | 3300025940 | Ga0207691_10060715 | Ga0207691_100607152 | 295 |
| 411 | 3300025940 | Ga0207691_10120971 | Ga0207691_101209712 | 295 |
| 412 | 3300025941 | Ga0207711_10142554 | Ga0207711_101425542 | 295 |
| 413 | 3300025942 | Ga0207689_10001431 | Ga0207689_100014315 | 295 |
| 414 | 3300025942 | Ga0207689_10024871 | Ga0207689_100248715 | 295 |
| 415 | 3300025944 | Ga0207661_10003516 | Ga0207661_100035163 | 295 |
| 416 | 3300025949 | Ga0207667_10360925 | Ga0207667_103609252 | 295 |
| 417 | 3300025960 | Ga0207651_10074105 | Ga0207651_100741052 | 295 |
| 418 | 3300025960 | Ga0207651_10141206 | Ga0207651_101412063 | 295 |
| 419 | 3300025972 | Ga0207668_10007605 | Ga0207668_100076052 | 295 |
| 420 | 3300025986 | Ga0207658_10023664 | Ga0207658_100236644 | 295 |
| 421 | 3300025986 | Ga0207658_10076747 | Ga0207658_100767471 | 295 |
| 422 | 3300025986 | Ga0207658_10418344 | Ga0207658_104183441 | 295 |
| 423 | 3300026023 | Ga0207677_10072693 | Ga0207677_100726932 | 295 |
| 424 | 3300026035 | Ga0207703_10041853 | Ga0207703_100418533 | 295 |
| 425 | 3300026035 | Ga0207703_10069667 | Ga0207703_100696673 | 295 |
| 426 | 3300026035 | Ga0207703_10371529 | Ga0207703_103715291 | 295 |
| 427 | 3300026041 | Ga0207639_10109132 | Ga0207639_101091322 | 295 |
| 428 | 3300026067 | Ga0207678_10001818 | Ga0207678_100018182 | 295 |
| 429 | 3300026067 | Ga0207678_10214587 | Ga0207678_102145872 | 295 |
| 430 | 3300026075 | Ga0207708_10034973 | Ga0207708_100349734 | 295 |
| 431 | 3300026075 | Ga0207708_10053197 | Ga0207708_100531973 | 295 |
| 432 | 3300026078 | Ga0207702_10001992 | Ga0207702_1000199213 | 295 |
| 433 | 3300026078 | Ga0207702_10021932 | Ga0207702_100219326 | 295 |
| 434 | 3300026088 | Ga0207641_10031263 | Ga0207641_100312632 | 295 |
| 435 | 3300026089 | Ga0207648_10048341 | Ga0207648_100483413 | 295 |
| 436 | 3300026089 | Ga0207648_10111844 | Ga0207648_101118443 | 295 |
| 437 | 3300026089 | Ga0207648_10170115 | Ga0207648_101701152 | 295 |
| 438 | 3300026095 | Ga0207676_10000896 | Ga0207676_100008965 | 295 |
| 439 | 3300026095 | Ga0207676_10060724 | Ga0207676_100607243 | 295 |
| 440 | 3300026118 | Ga0207675_100015760 | Ga0207675_1000157607 | 295 |
| 441 | 3300026118 | Ga0207675_100039045 | Ga0207675_1000390456 | 295 |
| 442 | 3300026118 | Ga0207675_100450507 | Ga0207675_1004505072 | 295 |
| 443 | 3300026118 | Ga0207675_100594747 | Ga0207675_1005947471 | 295 |
| 444 | 3300026121 | Ga0207683_10001721 | Ga0207683_100017215 | 295 |
| 445 | 3300026121 | Ga0207683_10001789 | Ga0207683_1000178913 | 295 |
| 446 | 3300026121 | Ga0207683_10065769 | Ga0207683_100657694 | 295 |
| 447 | 3300026121 | Ga0207683_10180368 | Ga0207683_101803682 | 295 |
| 448 | 3300026142 | Ga0207698_10002118 | Ga0207698_100021184 | 295 |
| 449 | 3300026142 | Ga0207698_10026942 | Ga0207698_100269423 | 295 |
| 450 | 3300027617 | Ga0210002_1018120 | Ga0210002_10181202 | 295 |
| 451 | 3300027682 | Ga0209971_1003179 | Ga0209971_10031792 | 295 |
| 452 | 3300027907 | Ga0207428_10015402 | Ga0207428_100154023 | 295 |
| 453 | 3300028379 | Ga0268266_10028457 | Ga0268266_100284572 | 295 |
| 454 | 3300028380 | Ga0268265_10007031 | Ga0268265_100070315 | 295 |
| 455 | 3300028381 | Ga0268264_10008954 | Ga0268264_100089547 | 295 |
| 456 | 3300028381 | Ga0268264_10018610 | Ga0268264_100186104 | 295 |
| 457 | 3300028381 | Ga0268264_10086517 | Ga0268264_100865172 | 295 |
| 458 | 3300028381 | Ga0268264_10207103 | Ga0268264_102071031 | 295 |
| 459 | 3300028573 | Ga0265334_10016887 | Ga0265334_100168872 | 295 |
| 460 | 3300028800 | Ga0265338_10015955 | Ga0265338_100159556 | 295 |
| 461 | 3300031548 | Ga0307408_100438842 | Ga0307408_1004388421 | 295 |
| 462 | 3300031691 | Ga0316579_10005942 | Ga0316579_100059424 | 295 |
| 463 | 3300031727 | Ga0316576_10145717 | Ga0316576_101457172 | 295 |
| 464 | 3300031728 | Ga0316578_10017721 | Ga0316578_100177211 | 295 |
| 465 | 3300031733 | Ga0316577_10072127 | Ga0316577_100721272 | 295 |
| 466 | 3300031733 | Ga0316577_10122595 | Ga0316577_101225952 | 295 |
| 467 | 3300031995 | Ga0307409_100007763 | Ga0307409_1000077637 | 295 |
| 468 | 3300032002 | Ga0307416_100910466 | Ga0307416_1009104661 | 295 |
| 469 | 3300032004 | Ga0307414_10026665 | Ga0307414_100266653 | 295 |
| 470 | 3300032004 | Ga0307414_10052365 | Ga0307414_100523652 | 295 |
| 471 | 3300032005 | Ga0307411_10037604 | Ga0307411_100376044 | 295 |
| 472 | 3300032126 | Ga0307415_100057771 | Ga0307415_1000577712 | 295 |
| 473 | 3300032133 | Ga0316583_10030367 | Ga0316583_100303672 | 295 |
| 474 | 3300032137 | Ga0316585_10025747 | Ga0316585_100257471 | 295 |
| 475 | 3300032139 | Ga0316580_10002895 | Ga0316580_100028954 | 295 |
| 476 | 3300035398 | Ga0316574_0000018 | Ga0316574_0000018_555_1448 | 295 |
| 477 | 3300035398 | Ga0316574_0132803 | Ga0316574_0132803_95_982 | 295 |
| 478 | 3300035398 | Ga0316574_0241715 | Ga0316574_0241715_149_1036 | 295 |
| 479 | 3300035691 | Ga0373931_0039649 | Ga0373931_0039649_789_1679 | 295 |
| 480 | 3300036712 | Ga0316584_0034958 | Ga0316584_0034958_2637_3524 | 295 |
| 481 | 3300036712 | Ga0316584_0067765 | Ga0316584_0067765_27_920 | 295 |
| 482 | 3300037068 | Ga0373925_0019723 | Ga0373925_0019723_1321_2217 | 295 |
| 483 | 3300037312 | Ga0395899_0010439 | Ga0395899_0010439_2563_3450 | 295 |
| 484 | 3300037312 | Ga0395899_0014021 | Ga0395899_0014021_4490_5377 | 295 |
| 485 | 3300037418 | Ga0395900_0029177 | Ga0395900_0029177_189_1076 | 295 |
| 486 | 3300037418 | Ga0395900_0246709 | Ga0395900_0246709_74_961 | 295 |
| 487 | 3300037466 | Ga0395898_0009056 | Ga0395898_0009056_8255_9142 | 295 |
| 488 | 3300037466 | Ga0395898_0252324 | Ga0395898_0252324_245_1132 | 295 |
| 489 | 3300037471 | Ga0395905_0115294 | Ga0395905_0115294_882_1769 | 295 |
| 490 | 3300037471 | Ga0395905_0427804 | Ga0395905_0427804_95_982 | 295 |
| 491 | 3300038443 | Ga0395901_0022229 | Ga0395901_0022229_2170_3057 | 295 |
| 492 | 3300038443 | Ga0395901_0055805 | Ga0395901_0055805_2912_3799 | 295 |
| 493 | 3300038443 | Ga0395901_0083749 | Ga0395901_0083749_1519_2406 | 295 |
| 494 | 3300038443 | Ga0395901_0168108 | Ga0395901_0168108_544_1431 | 295 |
| 495 | 3300038443 | Ga0395901_0628756 | Ga0395901_0628756_16_903 | 295 |
| 496 | 3300039062 | Ga0400483_016889 | Ga0400483_016889_6106_6999 | 295 |
| 497 | 3300039062 | Ga0400483_147849 | Ga0400483_147849_7076_7963 | 295 |
| 498 | 3300039062 | Ga0400483_194805 | Ga0400483_194805_3019_3912 | 295 |
| 499 | 3300039062 | Ga0400483_203034 | Ga0400483_203034_708_1595 | 295 |
| 500 | 3300039437 | Ga0436365_0011767 | Ga0436365_0011767_4734_5621 | 295 |
| 501 | 3300039450 | Ga0436363_0917267 | Ga0436363_0917267_568_1455 | 295 |
| 502 | 3300039450 | Ga0436363_1703617 | Ga0436363_1703617_610_1497 | 295 |
| 503 | 3300042008 | Ga0439450_038040 | Ga0439450_038040_168_1070 | 295 |
| 504 | 3300042010 | Ga0439452_037084 | Ga0439452_037084_66_953 | 295 |
| 505 | 3300042439 | Ga0439464_0023228 | Ga0439464_0023228_16_903 | 295 |
| 506 | 3300042439 | Ga0439464_0040721 | Ga0439464_0040721_168_1055 | 295 |
| 507 | 3300042461 | Ga0439460_0041204 | Ga0439460_0041204_194_1081 | 295 |
| 508 | 3300044673 | Ga0453683_0119545 | Ga0453683_0119545_721_1608 | 295 |
| 509 | 3300044684 | Ga0466966_0043210 | Ga0466966_0043210_282_1169 | 295 |
| 510 | 3300044712 | Ga0453684_0161279 | Ga0453684_0161279_1340_2227 | 295 |
| 511 | 3300045049 | Ga0466959_0037588 | Ga0466959_0037588_2666_3553 | 295 |
| 512 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_204996_205889 | 295 |
| 513 | 3300046459 | Ga0495629_0146620 | Ga0495629_0146620_354_1241 | 295 |
| 514 | 3300046528 | Ga0495642_0072212 | Ga0495642_0072212_426_1313 | 295 |
| 515 | 3300046533 | Ga0495640_0178135 | Ga0495640_0178135_342_1229 | 295 |
| 516 | 3300046616 | Ga0495668_0035028 | Ga0495668_0035028_608_1498 | 295 |
| 517 | 3300046660 | Ga0495625_0000362 | Ga0495625_0000362_51225_52115 | 295 |
| 518 | 3300046663 | Ga0495635_0170574 | Ga0495635_0170574_541_1428 | 295 |
| 519 | 3300046683 | Ga0495658_0160091 | Ga0495658_0160091_32_919 | 295 |
| 520 | 3300047471 | Ga0495684_0024548 | Ga0495684_0024548_3020_3907 | 295 |
| 521 | 3300048903 | Ga0496100_0234764 | Ga0496100_0234764_415_1302 | 295 |
| 522 | 3300048905 | Ga0496102_0161621 | Ga0496102_0161621_217_1104 | 295 |
| 523 | 3300048907 | Ga0496104_0014412 | Ga0496104_0014412_1251_2147 | 295 |
| 524 | 3300048908 | Ga0496105_0006061 | Ga0496105_0006061_4550_5446 | 295 |
| 525 | 3300048909 | Ga0496106_0009636 | Ga0496106_0009636_3939_4835 | 295 |
| 526 | 3300048910 | Ga0496107_0003209 | Ga0496107_0003209_519_1415 | 295 |
| 527 | 3300048912 | Ga0496109_0047196 | Ga0496109_0047196_186_1082 | 295 |
| 528 | 3300048913 | Ga0496110_0017616 | Ga0496110_0017616_3892_4788 | 295 |
| 529 | 3300048913 | Ga0496110_0270079 | Ga0496110_0270079_553_1440 | 295 |
| 530 | 3300048914 | Ga0496111_0001084 | Ga0496111_0001084_4371_5267 | 295 |
| 531 | 3300048916 | Ga0496113_0004957 | Ga0496113_0004957_2834_3730 | 295 |
| 532 | 3300048917 | Ga0496114_0021201 | Ga0496114_0021201_2533_3420 | 295 |
| 533 | 3300048918 | Ga0496115_0024228 | Ga0496115_0024228_3350_4237 | 295 |
| 534 | 3300048918 | Ga0496115_0177399 | Ga0496115_0177399_675_1562 | 295 |
| 535 | 3300048918 | Ga0496115_0391865 | Ga0496115_0391865_45_941 | 295 |
| 536 | 3300048926 | Ga0496123_0128533 | Ga0496123_0128533_495_1382 | 295 |
| 537 | 3300049571 | Ga0501034_0002561 | Ga0501034_0002561_7853_8743 | 295 |
| 538 | 3300049571 | Ga0501034_0318569 | Ga0501034_0318569_410_1297 | 295 |
| 539 | 3300049572 | Ga0501036_0395699 | Ga0501036_0395699_73_984 | 295 |
| 540 | 3300049778 | Ga0501282_006148 | Ga0501282_006148_250_1140 | 295 |
| 541 | 3300050491 | nmdc:mga00v17_48861_c1 | nmdc:mga00v17_48861_c1_1425_2312 | 295 |
| 542 | 3300050494 | nmdc:mga06z11_29810_c1 | nmdc:mga06z11_29810_c1_946_1833 | 295 |
| 543 | 3300050508 | nmdc:mga09592_223429_c1 | nmdc:mga09592_223429_c1_77_964 | 295 |
| 544 | 3300050511 | nmdc:mga08y16_528942_c1 | nmdc:mga08y16_528942_c1_183_1073 | 295 |
| 545 | 3300050512 | nmdc:mga0n895_19450_c1 | nmdc:mga0n895_19450_c1_1178_2074 | 295 |
| 546 | 3300050513 | nmdc:mga0rr50_6191_c1 | nmdc:mga0rr50_6191_c1_2706_3602 | 295 |
| 547 | 3300050514 | nmdc:mga08x19_76538_c1 | nmdc:mga08x19_76538_c1_144_1040 | 295 |
| 548 | 3300050515 | nmdc:mga0a205_601820_c1 | nmdc:mga0a205_601820_c1_51_938 | 295 |
| 549 | 3300053085 | Ga0495619_0126831 | Ga0495619_0126831_825_1712 | 295 |
| 550 | 3300053139 | Ga0500568_0000724 | Ga0500568_0000724_15581_16471 | 295 |
| 551 | 3300054114 | Ga0501084_0000216 | Ga0501084_0000216_6162_7049 | 295 |
| 552 | 3300005293 | Ga0065715_10113248 | Ga0065715_101132483 | 296 |
| 553 | 3300005331 | Ga0070670_100016454 | Ga0070670_1000164546 | 296 |
| 554 | 3300005347 | Ga0070668_100009156 | Ga0070668_1000091567 | 296 |
| 555 | 3300005353 | Ga0070669_100063261 | Ga0070669_1000632613 | 296 |
| 556 | 3300005355 | Ga0070671_100025962 | Ga0070671_1000259624 | 296 |
| 557 | 3300005356 | Ga0070674_100003696 | Ga0070674_1000036967 | 296 |
| 558 | 3300005364 | Ga0070673_100276634 | Ga0070673_1002766343 | 296 |
| 559 | 3300005366 | Ga0070659_100180024 | Ga0070659_1001800242 | 296 |
| 560 | 3300005457 | Ga0070662_100032993 | Ga0070662_1000329933 | 296 |
| 561 | 3300005459 | Ga0068867_100130818 | Ga0068867_1001308181 | 296 |
| 562 | 3300005543 | Ga0070672_100003611 | Ga0070672_1000036114 | 296 |
| 563 | 3300005617 | Ga0068859_100025822 | Ga0068859_1000258226 | 296 |
| 564 | 3300005618 | Ga0068864_100095074 | Ga0068864_1000950743 | 296 |
| 565 | 3300005844 | Ga0068862_100008255 | Ga0068862_1000082554 | 296 |
| 566 | 3300006844 | Ga0075428_100261056 | Ga0075428_1002610562 | 296 |
| 567 | 3300006847 | Ga0075431_100036988 | Ga0075431_1000369883 | 296 |
| 568 | 3300006931 | Ga0097620_100025822 | Ga0097620_1000258226 | 296 |
| 569 | 3300009177 | Ga0105248_10218452 | Ga0105248_102184522 | 296 |
| 570 | 3300009553 | Ga0105249_10259151 | Ga0105249_102591512 | 296 |
| 571 | 3300013105 | Ga0157369_10050251 | Ga0157369_100502512 | 296 |
| 572 | 3300014326 | Ga0157380_10002279 | Ga0157380_1000227911 | 296 |
| 573 | 3300014326 | Ga0157380_10008389 | Ga0157380_100083894 | 296 |
| 574 | 3300014326 | Ga0157380_10033683 | Ga0157380_100336833 | 296 |
| 575 | 3300025315 | Ga0207697_10004336 | Ga0207697_100043367 | 296 |
| 576 | 3300025893 | Ga0207682_10002137 | Ga0207682_100021372 | 296 |
| 577 | 3300025923 | Ga0207681_10012027 | Ga0207681_100120274 | 296 |
| 578 | 3300025925 | Ga0207650_10001564 | Ga0207650_1000156417 | 296 |
| 579 | 3300025925 | Ga0207650_10003470 | Ga0207650_1000347012 | 296 |
| 580 | 3300025926 | Ga0207659_10002573 | Ga0207659_1000257311 | 296 |
| 581 | 3300025931 | Ga0207644_10089931 | Ga0207644_100899312 | 296 |
| 582 | 3300025933 | Ga0207706_10006526 | Ga0207706_1000652612 | 296 |
| 583 | 3300025937 | Ga0207669_10007588 | Ga0207669_100075885 | 296 |
| 584 | 3300025940 | Ga0207691_10003262 | Ga0207691_100032627 | 296 |
| 585 | 3300025945 | Ga0207679_10043675 | Ga0207679_100436753 | 296 |
| 586 | 3300025960 | Ga0207651_10401937 | Ga0207651_104019372 | 296 |
| 587 | 3300025972 | Ga0207668_10050245 | Ga0207668_100502453 | 296 |
| 588 | 3300025972 | Ga0207668_10092305 | Ga0207668_100923053 | 296 |
| 589 | 3300025986 | Ga0207658_10041264 | Ga0207658_100412643 | 296 |
| 590 | 3300026023 | Ga0207677_10551133 | Ga0207677_105511331 | 296 |
| 591 | 3300026075 | Ga0207708_10127160 | Ga0207708_101271602 | 296 |
| 592 | 3300026089 | Ga0207648_10017845 | Ga0207648_100178457 | 296 |
| 593 | 3300026095 | Ga0207676_10112461 | Ga0207676_101124611 | 296 |
| 594 | 3300028380 | Ga0268265_10050752 | Ga0268265_100507524 | 296 |
| 595 | 3300028381 | Ga0268264_10095159 | Ga0268264_100951592 | 296 |
| 596 | 3300031665 | Ga0316575_10076015 | Ga0316575_100760152 | 296 |
| 597 | 3300031727 | Ga0316576_10087355 | Ga0316576_100873552 | 296 |
| 598 | 3300031824 | Ga0307413_10014744 | Ga0307413_100147443 | 296 |
| 599 | 3300031852 | Ga0307410_10009576 | Ga0307410_100095762 | 296 |
| 600 | 3300031901 | Ga0307406_10030734 | Ga0307406_100307344 | 296 |
| 601 | 3300031995 | Ga0307409_100078235 | Ga0307409_1000782352 | 296 |
| 602 | 3300031995 | Ga0307409_100089516 | Ga0307409_1000895162 | 296 |
| 603 | 3300032126 | Ga0307415_100150460 | Ga0307415_1001504603 | 296 |
| 604 | 3300035398 | Ga0316574_0006270 | Ga0316574_0006270_3443_4333 | 296 |
| 605 | 3300035398 | Ga0316574_0030139 | Ga0316574_0030139_1604_2494 | 296 |
| 606 | 3300036712 | Ga0316584_0095372 | Ga0316584_0095372_179_1069 | 296 |
| 607 | 3300038742 | Ga0400486_08083 | Ga0400486_08083_4563_5453 | 296 |
| 608 | 3300042004 | Ga0439445_0000682 | Ga0439445_0000682_1192_2115 | 296 |
| 609 | 3300046539 | Ga0495621_0005070 | Ga0495621_0005070_620_1528 | 296 |
| 610 | 3300046558 | Ga0495633_0079868 | Ga0495633_0079868_367_1275 | 296 |
| 611 | 3300046691 | Ga0495670_0090065 | Ga0495670_0090065_348_1256 | 296 |
| 612 | 3300046691 | Ga0495670_0190264 | Ga0495670_0190264_33_941 | 296 |
| 613 | 3300046809 | Ga0495600_0013633 | Ga0495600_0013633_3807_4718 | 296 |
| 614 | 3300048924 | Ga0496121_0035138 | Ga0496121_0035138_1593_2483 | 296 |
| 615 | 3300049571 | Ga0501034_0308997 | Ga0501034_0308997_209_1099 | 296 |
| 616 | 3300050510 | nmdc:mga06r32_6485_c1 | nmdc:mga06r32_6485_c1_9064_9978 | 296 |
| 617 | iso_pu_bacteria | 2643221667 | 2644374455 | 296 |
| 618 | iso_pu_bacteria | 2738541279 | 2738735933 | 296 |
| 619 | iso_pu_bacteria | 2738541285 | 2738768510 | 296 |
| 620 | iso_pu_bacteria | 2738543007 | 2739217515 | 296 |
| 621 | iso_pu_bacteria | 2857613821 | 2857616246 | 296 |
| 622 | 2162886007 | SwRhRL2b_contig_1200904 | SwRhRL2b_0118.00002930 | 297 |
| 623 | 3300005290 | Ga0065712_10034659 | Ga0065712_100346591 | 297 |
| 624 | 3300005328 | Ga0070676_10046627 | Ga0070676_100466273 | 297 |
| 625 | 3300005330 | Ga0070690_100072792 | Ga0070690_1000727922 | 297 |
| 626 | 3300005330 | Ga0070690_100290753 | Ga0070690_1002907531 | 297 |
| 627 | 3300005331 | Ga0070670_100002372 | Ga0070670_10000237214 | 297 |
| 628 | 3300005331 | Ga0070670_100404492 | Ga0070670_1004044921 | 297 |
| 629 | 3300005335 | Ga0070666_10038577 | Ga0070666_100385772 | 297 |
| 630 | 3300005338 | Ga0068868_100010385 | Ga0068868_1000103852 | 297 |
| 631 | 3300005338 | Ga0068868_100053432 | Ga0068868_1000534322 | 297 |
| 632 | 3300005340 | Ga0070689_100224106 | Ga0070689_1002241062 | 297 |
| 633 | 3300005343 | Ga0070687_100155325 | Ga0070687_1001553252 | 297 |
| 634 | 3300005347 | Ga0070668_100185480 | Ga0070668_1001854802 | 297 |
| 635 | 3300005354 | Ga0070675_100018757 | Ga0070675_1000187571 | 297 |
| 636 | 3300005355 | Ga0070671_100023116 | Ga0070671_1000231163 | 297 |
| 637 | 3300005364 | Ga0070673_100051077 | Ga0070673_1000510771 | 297 |
| 638 | 3300005364 | Ga0070673_100282809 | Ga0070673_1002828092 | 297 |
| 639 | 3300005444 | Ga0070694_100023303 | Ga0070694_1000233032 | 297 |
| 640 | 3300005456 | Ga0070678_100099566 | Ga0070678_1000995662 | 297 |
| 641 | 3300005456 | Ga0070678_100188719 | Ga0070678_1001887192 | 297 |
| 642 | 3300005466 | Ga0070685_10059630 | Ga0070685_100596302 | 297 |
| 643 | 3300005530 | Ga0070679_100240896 | Ga0070679_1002408962 | 297 |
| 644 | 3300005535 | Ga0070684_100059898 | Ga0070684_1000598983 | 297 |
| 645 | 3300005544 | Ga0070686_100189910 | Ga0070686_1001899102 | 297 |
| 646 | 3300005548 | Ga0070665_100233743 | Ga0070665_1002337432 | 297 |
| 647 | 3300005549 | Ga0070704_100010008 | Ga0070704_1000100083 | 297 |
| 648 | 3300005563 | Ga0068855_100104113 | Ga0068855_1001041132 | 297 |
| 649 | 3300005564 | Ga0070664_100004030 | Ga0070664_1000040304 | 297 |
| 650 | 3300005615 | Ga0070702_100031295 | Ga0070702_1000312952 | 297 |
| 651 | 3300005617 | Ga0068859_100042445 | Ga0068859_1000424452 | 297 |
| 652 | 3300005618 | Ga0068864_100122909 | Ga0068864_1001229093 | 297 |
| 653 | 3300005719 | Ga0068861_100127650 | Ga0068861_1001276502 | 297 |
| 654 | 3300005719 | Ga0068861_100220865 | Ga0068861_1002208652 | 297 |
| 655 | 3300005834 | Ga0068851_10081757 | Ga0068851_100817572 | 297 |
| 656 | 3300005840 | Ga0068870_10051449 | Ga0068870_100514492 | 297 |
| 657 | 3300005840 | Ga0068870_10192874 | Ga0068870_101928741 | 297 |
| 658 | 3300005841 | Ga0068863_100003730 | Ga0068863_1000037306 | 297 |
| 659 | 3300005841 | Ga0068863_100087307 | Ga0068863_1000873072 | 297 |
| 660 | 3300005842 | Ga0068858_100010789 | Ga0068858_1000107893 | 297 |
| 661 | 3300005842 | Ga0068858_100211914 | Ga0068858_1002119142 | 297 |
| 662 | 3300005844 | Ga0068862_100030190 | Ga0068862_1000301901 | 297 |
| 663 | 3300005844 | Ga0068862_100174977 | Ga0068862_1001749772 | 297 |
| 664 | 3300006237 | Ga0097621_100349621 | Ga0097621_1003496211 | 297 |
| 665 | 3300006358 | Ga0068871_100031530 | Ga0068871_1000315303 | 297 |
| 666 | 3300006358 | Ga0068871_100075727 | Ga0068871_1000757272 | 297 |
| 667 | 3300006358 | Ga0068871_100275157 | Ga0068871_1002751572 | 297 |
| 668 | 3300006844 | Ga0075428_100190255 | Ga0075428_1001902551 | 297 |
| 669 | 3300006846 | Ga0075430_100075967 | Ga0075430_1000759672 | 297 |
| 670 | 3300006846 | Ga0075430_100131372 | Ga0075430_1001313722 | 297 |
| 671 | 3300006847 | Ga0075431_100072856 | Ga0075431_1000728564 | 297 |
| 672 | 3300006847 | Ga0075431_100154691 | Ga0075431_1001546912 | 297 |
| 673 | 3300006880 | Ga0075429_100185014 | Ga0075429_1001850142 | 297 |
| 674 | 3300006931 | Ga0097620_100042445 | Ga0097620_1000424452 | 297 |
| 675 | 3300006942 | Ga0099824_1007872 | Ga0099824_100787213 | 297 |
| 676 | 3300006948 | Ga0099826_10005057 | Ga0099826_100050572 | 297 |
| 677 | 3300009094 | Ga0111539_10057862 | Ga0111539_100578622 | 297 |
| 678 | 3300009094 | Ga0111539_10071416 | Ga0111539_100714165 | 297 |
| 679 | 3300009094 | Ga0111539_10120566 | Ga0111539_101205663 | 297 |
| 680 | 3300009094 | Ga0111539_10336516 | Ga0111539_103365162 | 297 |
| 681 | 3300009098 | Ga0105245_10008219 | Ga0105245_100082196 | 297 |
| 682 | 3300009098 | Ga0105245_10327570 | Ga0105245_103275702 | 297 |
| 683 | 3300009101 | Ga0105247_10004007 | Ga0105247_100040077 | 297 |
| 684 | 3300009101 | Ga0105247_10148587 | Ga0105247_101485871 | 297 |
| 685 | 3300009147 | Ga0114129_10069834 | Ga0114129_100698342 | 297 |
| 686 | 3300009174 | Ga0105241_10104068 | Ga0105241_101040682 | 297 |
| 687 | 3300009176 | Ga0105242_10088775 | Ga0105242_100887752 | 297 |
| 688 | 3300009177 | Ga0105248_10016488 | Ga0105248_100164885 | 297 |
| 689 | 3300009177 | Ga0105248_10113758 | Ga0105248_101137583 | 297 |
| 690 | 3300009551 | Ga0105238_10067892 | Ga0105238_100678922 | 297 |
| 691 | 3300010375 | Ga0105239_10056407 | Ga0105239_100564073 | 297 |
| 692 | 3300013100 | Ga0157373_10000023 | Ga0157373_1000002325 | 297 |
| 693 | 3300013296 | Ga0157374_10002677 | Ga0157374_1000267713 | 297 |
| 694 | 3300013296 | Ga0157374_10054267 | Ga0157374_100542674 | 297 |
| 695 | 3300013296 | Ga0157374_10375497 | Ga0157374_103754972 | 297 |
| 696 | 3300013297 | Ga0157378_10074921 | Ga0157378_100749213 | 297 |
| 697 | 3300013308 | Ga0157375_10019639 | Ga0157375_100196392 | 297 |
| 698 | 3300014325 | Ga0163163_10007534 | Ga0163163_100075347 | 297 |
| 699 | 3300014326 | Ga0157380_10002142 | Ga0157380_1000214212 | 297 |
| 700 | 3300014326 | Ga0157380_10116787 | Ga0157380_101167872 | 297 |
| 701 | 3300014745 | Ga0157377_10097218 | Ga0157377_100972182 | 297 |
| 702 | 3300014968 | Ga0157379_10181531 | Ga0157379_101815312 | 297 |
| 703 | 3300014969 | Ga0157376_10320753 | Ga0157376_103207532 | 297 |
| 704 | 3300015261 | Ga0182006_1002701 | Ga0182006_10027014 | 297 |
| 705 | 3300025229 | Ga0209147_103612 | Ga0209147_1036122 | 297 |
| 706 | 3300025728 | Ga0207655_1000003 | Ga0207655_1000003141 | 297 |
| 707 | 3300025893 | Ga0207682_10015311 | Ga0207682_100153113 | 297 |
| 708 | 3300025899 | Ga0207642_10031370 | Ga0207642_100313702 | 297 |
| 709 | 3300025901 | Ga0207688_10032338 | Ga0207688_100323384 | 297 |
| 710 | 3300025903 | Ga0207680_10030105 | Ga0207680_100301052 | 297 |
| 711 | 3300025907 | Ga0207645_10119781 | Ga0207645_101197812 | 297 |
| 712 | 3300025908 | Ga0207643_10046706 | Ga0207643_100467063 | 297 |
| 713 | 3300025911 | Ga0207654_10134043 | Ga0207654_101340432 | 297 |
| 714 | 3300025913 | Ga0207695_10109233 | Ga0207695_101092333 | 297 |
| 715 | 3300025917 | Ga0207660_10028542 | Ga0207660_100285422 | 297 |
| 716 | 3300025923 | Ga0207681_10045203 | Ga0207681_100452032 | 297 |
| 717 | 3300025925 | Ga0207650_10040514 | Ga0207650_100405142 | 297 |
| 718 | 3300025931 | Ga0207644_10003507 | Ga0207644_100035072 | 297 |
| 719 | 3300025933 | Ga0207706_10261322 | Ga0207706_102613222 | 297 |
| 720 | 3300025935 | Ga0207709_10052850 | Ga0207709_100528502 | 297 |
| 721 | 3300025935 | Ga0207709_10149120 | Ga0207709_101491202 | 297 |
| 722 | 3300025936 | Ga0207670_10157127 | Ga0207670_101571272 | 297 |
| 723 | 3300025937 | Ga0207669_10517847 | Ga0207669_105178471 | 297 |
| 724 | 3300025940 | Ga0207691_10136420 | Ga0207691_101364202 | 297 |
| 725 | 3300025941 | Ga0207711_10005883 | Ga0207711_100058833 | 297 |
| 726 | 3300025941 | Ga0207711_10092518 | Ga0207711_100925183 | 297 |
| 727 | 3300025944 | Ga0207661_10080148 | Ga0207661_100801482 | 297 |
| 728 | 3300025960 | Ga0207651_10075588 | Ga0207651_100755881 | 297 |
| 729 | 3300026023 | Ga0207677_10094007 | Ga0207677_100940072 | 297 |
| 730 | 3300026035 | Ga0207703_10012833 | Ga0207703_100128333 | 297 |
| 731 | 3300026075 | Ga0207708_10006356 | Ga0207708_100063562 | 297 |
| 732 | 3300026088 | Ga0207641_10010191 | Ga0207641_100101916 | 297 |
| 733 | 3300026088 | Ga0207641_10041337 | Ga0207641_100413374 | 297 |
| 734 | 3300026089 | Ga0207648_10077587 | Ga0207648_100775872 | 297 |
| 735 | 3300026089 | Ga0207648_10118701 | Ga0207648_101187012 | 297 |
| 736 | 3300026095 | Ga0207676_10005522 | Ga0207676_100055227 | 297 |
| 737 | 3300026095 | Ga0207676_10104749 | Ga0207676_101047492 | 297 |
| 738 | 3300026118 | Ga0207675_100023333 | Ga0207675_1000233337 | 297 |
| 739 | 3300026118 | Ga0207675_100086921 | Ga0207675_1000869212 | 297 |
| 740 | 3300026121 | Ga0207683_10163499 | Ga0207683_101634992 | 297 |
| 741 | 3300026142 | Ga0207698_10062486 | Ga0207698_100624862 | 297 |
| 742 | 3300027361 | Ga0209489_108520 | Ga0209489_10852012 | 297 |
| 743 | 3300027695 | Ga0209966_1005269 | Ga0209966_10052692 | 297 |
| 744 | 3300027876 | Ga0209974_10056085 | Ga0209974_100560851 | 297 |
| 745 | 3300027907 | Ga0207428_10214012 | Ga0207428_102140122 | 297 |
| 746 | 3300028379 | Ga0268266_10208928 | Ga0268266_102089282 | 297 |
| 747 | 3300028381 | Ga0268264_10282555 | Ga0268264_102825552 | 297 |
| 748 | 3300028577 | Ga0265318_10011555 | Ga0265318_100115552 | 297 |
| 749 | 3300031235 | Ga0265330_10030331 | Ga0265330_100303312 | 297 |
| 750 | 3300031238 | Ga0265332_10014637 | Ga0265332_100146373 | 297 |
| 751 | 3300031247 | Ga0265340_10092203 | Ga0265340_100922032 | 297 |
| 752 | 3300031250 | Ga0265331_10008258 | Ga0265331_100082583 | 297 |
| 753 | 3300031344 | Ga0265316_10018778 | Ga0265316_100187785 | 297 |
| 754 | 3300031548 | Ga0307408_100000475 | Ga0307408_1000004755 | 297 |
| 755 | 3300031548 | Ga0307408_100163213 | Ga0307408_1001632131 | 297 |
| 756 | 3300031548 | Ga0307408_100404560 | Ga0307408_1004045601 | 297 |
| 757 | 3300031711 | Ga0265314_10000595 | Ga0265314_1000059537 | 297 |
| 758 | 3300031712 | Ga0265342_10051906 | Ga0265342_100519062 | 297 |
| 759 | 3300031727 | Ga0316576_10004148 | Ga0316576_100041485 | 297 |
| 760 | 3300031824 | Ga0307413_10201004 | Ga0307413_102010042 | 297 |
| 761 | 3300031852 | Ga0307410_10018238 | Ga0307410_100182383 | 297 |
| 762 | 3300031852 | Ga0307410_10020706 | Ga0307410_100207063 | 297 |
| 763 | 3300031901 | Ga0307406_10000062 | Ga0307406_1000006241 | 297 |
| 764 | 3300031903 | Ga0307407_10000440 | Ga0307407_1000044012 | 297 |
| 765 | 3300031903 | Ga0307407_10043850 | Ga0307407_100438502 | 297 |
| 766 | 3300032002 | Ga0307416_100000394 | Ga0307416_1000003942 | 297 |
| 767 | 3300032002 | Ga0307416_100008628 | Ga0307416_1000086283 | 297 |
| 768 | 3300032004 | Ga0307414_10000027 | Ga0307414_10000027122 | 297 |
| 769 | 3300032005 | Ga0307411_10217284 | Ga0307411_102172842 | 297 |
| 770 | 3300033541 | Ga0316596_1027287 | Ga0316596_10272871 | 297 |
| 771 | 3300035172 | Ga0373955_0107256 | Ga0373955_0107256_182_1138 | 297 |
| 772 | 3300035398 | Ga0316574_0031913 | Ga0316574_0031913_1967_2860 | 297 |
| 773 | 3300035398 | Ga0316574_0033376 | Ga0316574_0033376_277_1170 | 297 |
| 774 | 3300035724 | Ga0373933_0015401 | Ga0373933_0015401_1039_1995 | 297 |
| 775 | 3300036401 | Ga0373937_0067615 | Ga0373937_0067615_548_1462 | 297 |
| 776 | 3300036647 | Ga0316582_0043967 | Ga0316582_0043967_287_1180 | 297 |
| 777 | 3300036712 | Ga0316584_0320366 | Ga0316584_0320366_125_1018 | 297 |
| 778 | 3300039437 | Ga0436365_0608669 | Ga0436365_0608669_30_980 | 297 |
| 779 | 3300042438 | Ga0439459_0021161 | Ga0439459_0021161_195_1088 | 297 |
| 780 | 3300044673 | Ga0453683_0153970 | Ga0453683_0153970_511_1431 | 297 |
| 781 | 3300045051 | Ga0451576_0758093 | Ga0451576_0758093_23_916 | 297 |
| 782 | 3300046455 | Ga0495603_0059340 | Ga0495603_0059340_605_1498 | 297 |
| 783 | 3300046459 | Ga0495629_0345730 | Ga0495629_0345730_87_980 | 297 |
| 784 | 3300046514 | Ga0495618_0159939 | Ga0495618_0159939_34_927 | 297 |
| 785 | 3300046517 | Ga0495630_0373600 | Ga0495630_0373600_157_1050 | 297 |
| 786 | 3300046535 | Ga0495586_0251815 | Ga0495586_0251815_41_934 | 297 |
| 787 | 3300046683 | Ga0495658_0056293 | Ga0495658_0056293_216_1109 | 297 |
| 788 | 3300048907 | Ga0496104_0046317 | Ga0496104_0046317_2093_2986 | 297 |
| 789 | 3300048911 | Ga0496108_0037240 | Ga0496108_0037240_1655_2548 | 297 |
| 790 | 3300048913 | Ga0496110_0199281 | Ga0496110_0199281_121_1089 | 297 |
| 791 | 3300048915 | Ga0496112_0009721 | Ga0496112_0009721_1224_2117 | 297 |
| 792 | 3300048916 | Ga0496113_0056701 | Ga0496113_0056701_948_1841 | 297 |
| 793 | 3300048917 | Ga0496114_0003135 | Ga0496114_0003135_2098_2991 | 297 |
| 794 | 3300048929 | Ga0496126_0000123 | Ga0496126_0000123_157120_158016 | 297 |
| 795 | 3300048929 | Ga0496126_0055530 | Ga0496126_0055530_2624_3526 | 297 |
| 796 | 3300049576 | Ga0501040_0048797 | Ga0501040_0048797_1253_2146 | 297 |
| 797 | 3300049586 | Ga0501070_0111884 | Ga0501070_0111884_964_1920 | 297 |
| 798 | 3300049588 | Ga0501072_0306719 | Ga0501072_0306719_319_1212 | 297 |
| 799 | 3300049588 | Ga0501072_0414436 | Ga0501072_0414436_144_1037 | 297 |
| 800 | 3300049671 | Ga0501238_000149 | Ga0501238_000149_8654_9556 | 297 |
| 801 | 3300049758 | Ga0501241_016649 | Ga0501241_016649_362_1264 | 297 |
| 802 | 3300049766 | Ga0501269_001740 | Ga0501269_001740_591_1493 | 297 |
| 803 | 3300049776 | Ga0501280_000708 | Ga0501280_000708_3865_4767 | 297 |
| 804 | 3300050508 | nmdc:mga09592_36737_c1 | nmdc:mga09592_36737_c1_1700_2593 | 297 |
| 805 | 3300050509 | nmdc:mga0qj67_63704_c1 | nmdc:mga0qj67_63704_c1_1117_2064 | 297 |
| 806 | 3300050510 | nmdc:mga06r32_71459_c1 | nmdc:mga06r32_71459_c1_2396_3298 | 297 |
| 807 | 3300050511 | nmdc:mga08y16_158678_c1 | nmdc:mga08y16_158678_c1_728_1642 | 297 |
| 808 | 3300050511 | nmdc:mga08y16_80191_c1 | nmdc:mga08y16_80191_c1_1221_2114 | 297 |
| 809 | 3300050515 | nmdc:mga0a205_361699_c1 | nmdc:mga0a205_361699_c1_404_1297 | 297 |
| 810 | 3300053077 | Ga0495601_0019377 | Ga0495601_0019377_953_1846 | 297 |
| 811 | 3300053096 | Ga0500641_0017281 | Ga0500641_0017281_1679_2572 | 297 |
| 812 | 3300053726 | Ga0500584_009662 | Ga0500584_009662_2703_3605 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2iqt-assembly1.cif.gz_A-2 | crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis | 0.988 | 4 | 297 |
| 2iqt-assembly1.cif.gz_A-2 | crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis | 0.9747 | 4 | 297 |
| 7efs-assembly1.cif.gz_B | fructose-bisphosphate aldolase in artemisia sieversiana pollen | 0.8177 | 1 | 294 |
| 7b2n-assembly1.cif.gz_B | crystal structure of chlamydomonas reinhardtii chloroplastic fructose bisphosphate aldolase | 0.817 | 4 | 294 |
| 6xmh-assembly1.cif.gz_B-2 | human aldolase a wild type | 0.8165 | 1 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FV17_1_294_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.998 | 5 | 297 | 3.20.20.70 |
| af_Q2FV17_1_294_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9879 | 5 | 297 | 3.20.20.70 |
| af_A0A1D6JVQ3_1_141_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8591 | 11 | 142 | 3.20.20.70 |
| af_A0A1D6FD79_26_183_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8297 | 4 | 140 | 3.20.20.70 |
| 3mbdA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.817 | 4 | 294 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432GXV0-F1-model_v4 | Class I fructose-bisphosphate aldolase (EC 4.1.2.13) | 1.005 | 236 | 297 |
GO:0004332
|
| AF-A0A7X8K759-F1-model_v4 | Class I fructose-bisphosphate aldolase (EC 4.1.2.13) | 1.003 | 239 | 295 |
GO:0004332
|
| AF-A0A645JEX5-F1-model_v4 | Fructose-bisphosphate aldolase class 1 (EC 4.1.2.13) | 1.002 | 215 | 297 |
GO:0004332
|
| AF-A0A2V9RUV5-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) | 1 | 5 | 197 |
GO:0004332
GO:0006096 |
| AF-A0A509Y451-F1-model_v4 | deleted | 0.9998 | 213 | 297 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar