F481880

General Info

Members Datasets Scaffolds Average Seq Length
812 380 778 296

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10327570|Ga0105245_103275702
Length 338
Sequence LVLEKKRVLTAHRLDNIAADRENTGLNVLFSFPTPNFEEPTVSEYDKQLQKVKNDKGFIAALDQSGGSTPKALKLYGVNEDAWTNEQGMYDVVHQMRSRIMTSPAFTGKRLLGAILFENTMDRDVAGKPTPTYLWEVKGVVPFLKVDKGLADEKDGVQMMKPMPDLDALLKKAKSKNVFGTKMRSVIKQANAAAIDAVVKQQFEVGKQILAAGLMPIIEPEVDIKTPNKDKAEELLKAAILKELNQLKPDQRVMLKLTIPEKDNLYADLIKHPNVLRVVALSGGYSREESNKRLARQNGMTASFSRALSEGLTKQQSDEEFNKALDASIESIYRASIT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
7 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
8 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
9 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
10 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
11 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
12 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
13 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
16 2818991441 Niallia circulans 3243 Isolate Rhizosphere
17 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
18 2857472729 Cohnella sp. R-74144 Isolate Unclassified
19 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
20 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
21 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
22 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
23 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
24 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
25 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
26 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
27 2919513703 Luteimonas sp. 3794 Isolate Unclassified
28 2919675420 Luteimonas terrae 4099 Isolate Unclassified
29 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
30 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
31 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
32 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
228 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
229 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
247 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
250 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
251 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
252 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
253 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
265 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
266 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
267 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
274 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
282 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
286 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
287 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
288 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
289 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
290 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
291 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
292 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
293 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
294 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
295 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
296 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
302 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
350 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
351 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
352 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
353 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
354 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
357 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
379 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
380 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0.25
Isolates 4.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0.99
Rhizoplane 2.96
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 5.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1200904 2162886007 Bacteria 1316
2 JGI25406J46586_10011250 3300003203 Bacteria 3932
3 rootH2_10036006 3300003320 Unclassified 4796
4 Ga0055535_1009958 3300003761 Bacteria 1595
5 Ga0055530_10000095 3300003791 Bacteria 74707
6 Ga0055530_10024324 3300003791 Bacteria 1720
7 Ga0055531_10002750 3300003794 Bacteria 11546
8 Ga0055531_10004838 3300003794 Bacteria 8035
9 Ga0055541_1004028 3300003841 Bacteria 2705
10 Ga0065712_10034659 3300005290 Bacteria 1416
11 Ga0065715_10113248 3300005293 Bacteria 2496
12 Ga0065707_10001302 3300005295 Bacteria 13694
13 Ga0065707_10247678 3300005295 Bacteria 1135
14 Ga0070676_10044650 3300005328 Bacteria 2580
15 Ga0070676_10046627 3300005328 Bacteria 2528
16 Ga0070676_10114050 3300005328 Bacteria 1687
17 Ga0070690_100072792 3300005330 Bacteria 2235
18 Ga0070690_100189801 3300005330 Bacteria 1424
19 Ga0070690_100290753 3300005330 Bacteria 1168
20 Ga0070670_100002372 3300005331 Bacteria 15519
21 Ga0070670_100016454 3300005331 Bacteria 6351
22 Ga0070670_100036862 3300005331 Bacteria 4207
23 Ga0070670_100069322 3300005331 Bacteria 3027
24 Ga0070670_100088663 3300005331 Bacteria 2659
25 Ga0070670_100404492 3300005331 Bacteria 1205
26 Ga0068869_100009681 3300005334 Bacteria 6257
27 Ga0068869_100070150 3300005334 Bacteria 2592
28 Ga0068869_100104841 3300005334 Bacteria 2144
29 Ga0070666_10007408 3300005335 Bacteria 6764
30 Ga0070666_10021517 3300005335 Bacteria 4182
31 Ga0070666_10038577 3300005335 Bacteria 3179
32 Ga0070666_10340433 3300005335 Bacteria 1072
33 Ga0070680_100201120 3300005336 Bacteria 1680
34 Ga0070682_100007256 3300005337 Bacteria 6247
35 Ga0068868_100010385 3300005338 Bacteria 6738
36 Ga0068868_100010777 3300005338 Bacteria 6629
37 Ga0068868_100053432 3300005338 Bacteria 3182
38 Ga0070660_100081063 3300005339 Bacteria 2547
39 Ga0070660_100098032 3300005339 Bacteria 2320
40 Ga0070660_100214305 3300005339 Bacteria 1564
41 Ga0070689_100224106 3300005340 Bacteria 1543
42 Ga0070689_100452621 3300005340 Bacteria 1093
43 Ga0070691_10002104 3300005341 Bacteria 8806
44 Ga0070687_100155325 3300005343 Bacteria 1347
45 Ga0070692_10038830 3300005345 Bacteria 2429
46 Ga0070668_100003541 3300005347 Bacteria 11518
47 Ga0070668_100008311 3300005347 Bacteria 7704
48 Ga0070668_100009156 3300005347 Bacteria 7346
49 Ga0070668_100025721 3300005347 Bacteria 4464
50 Ga0070668_100043584 3300005347 Bacteria 3441
51 Ga0070668_100093435 3300005347 Bacteria 2374
52 Ga0070668_100115903 3300005347 Bacteria 2136
53 Ga0070668_100185480 3300005347 Bacteria 1701
54 Ga0070669_100054641 3300005353 Bacteria 2925
55 Ga0070669_100063261 3300005353 Bacteria 2723
56 Ga0070675_100013399 3300005354 Bacteria 6444
57 Ga0070675_100018757 3300005354 Bacteria 5507
58 Ga0070675_100087113 3300005354 Bacteria 2611
59 Ga0070671_100007579 3300005355 Bacteria 8678
60 Ga0070671_100023116 3300005355 Bacteria 5082
61 Ga0070671_100024813 3300005355 Bacteria 4912
62 Ga0070671_100025962 3300005355 Bacteria 4810
63 Ga0070674_100003696 3300005356 Bacteria 8621
64 Ga0070674_100046640 3300005356 Bacteria 2966
65 Ga0070674_100130282 3300005356 Bacteria 1874
66 Ga0070674_100154285 3300005356 Bacteria 1736
67 Ga0070674_100159097 3300005356 Bacteria 1712
68 Ga0070674_100236272 3300005356 Bacteria 1429
69 Ga0070673_100000655 3300005364 Bacteria 18982
70 Ga0070673_100051077 3300005364 Bacteria 3236
71 Ga0070673_100134718 3300005364 Bacteria 2078
72 Ga0070673_100174380 3300005364 Bacteria 1837
73 Ga0070673_100276634 3300005364 Bacteria 1471
74 Ga0070673_100282809 3300005364 Bacteria 1455
75 Ga0070659_100046732 3300005366 Bacteria 3393
76 Ga0070659_100061193 3300005366 Bacteria 2975
77 Ga0070659_100089500 3300005366 Bacteria 2466
78 Ga0070659_100180024 3300005366 Bacteria 1734
79 Ga0070667_100022052 3300005367 Bacteria 5284
80 Ga0070667_100049692 3300005367 Bacteria 3533
81 Ga0070667_100144558 3300005367 Bacteria 2085
82 Ga0070667_100163160 3300005367 Bacteria 1964
83 Ga0070709_10056874 3300005434 Bacteria 2475
84 Ga0070714_100047289 3300005435 Bacteria 3654
85 Ga0070714_100102162 3300005435 Bacteria 2527
86 Ga0070713_100000129 3300005436 Bacteria 49577
87 Ga0070713_100011017 3300005436 Bacteria 6563
88 Ga0070713_100227997 3300005436 Bacteria 1692
89 Ga0070710_10025987 3300005437 Bacteria 3106
90 Ga0070701_10018566 3300005438 Bacteria 3271
91 Ga0070701_10128777 3300005438 Bacteria 1436
92 Ga0070711_100053234 3300005439 Bacteria 2788
93 Ga0070705_100059544 3300005440 Bacteria 2262
94 Ga0070700_100107989 3300005441 Bacteria 1845
95 Ga0070694_100023303 3300005444 Bacteria 3980
96 Ga0070708_100210850 3300005445 Bacteria 1820
97 Ga0070663_100002768 3300005455 Bacteria 9944
98 Ga0070663_100058868 3300005455 Bacteria 2760
99 Ga0070663_100384310 3300005455 Bacteria 1144
100 Ga0070678_100016864 3300005456 Bacteria 4685
101 Ga0070678_100058624 3300005456 Bacteria 2827
102 Ga0070678_100087487 3300005456 Bacteria 2380
103 Ga0070678_100099566 3300005456 Bacteria 2249
104 Ga0070678_100111900 3300005456 Bacteria 2137
105 Ga0070678_100188719 3300005456 Bacteria 1693
106 Ga0070662_100027611 3300005457 Bacteria 3942
107 Ga0070662_100032993 3300005457 Bacteria 3643
108 Ga0070681_10036085 3300005458 Bacteria 4966
109 Ga0068867_100008910 3300005459 Bacteria 7080
110 Ga0068867_100012739 3300005459 Bacteria 5951
111 Ga0068867_100060218 3300005459 Bacteria 2816
112 Ga0068867_100130818 3300005459 Bacteria 1950
113 Ga0068867_100144524 3300005459 Bacteria 1862
114 Ga0070685_10059630 3300005466 Bacteria 2229
115 Ga0070685_10075512 3300005466 Bacteria 2008
116 Ga0070706_100159173 3300005467 Unclassified 2108
117 Ga0070707_100016769 3300005468 Bacteria 6877
118 Ga0070699_100000708 3300005518 Bacteria 30920
119 Ga0070679_100018240 3300005530 Bacteria 6806
120 Ga0070679_100148494 3300005530 Bacteria 2321
121 Ga0070679_100240896 3300005530 Bacteria 1766
122 Ga0070684_100059898 3300005535 Bacteria 3329
123 Ga0068853_100009347 3300005539 Bacteria 7903
124 Ga0068853_100026886 3300005539 Bacteria 4834
125 Ga0070672_100003611 3300005543 Bacteria 10031
126 Ga0070672_100037283 3300005543 Bacteria 3708
127 Ga0070672_100335838 3300005543 Bacteria 1286
128 Ga0070686_100189910 3300005544 Bacteria 1465
129 Ga0070693_100008277 3300005547 Bacteria 5116
130 Ga0070665_100036933 3300005548 Bacteria 4912
131 Ga0070665_100042010 3300005548 Bacteria 4596
132 Ga0070665_100056106 3300005548 Bacteria 3950
133 Ga0070665_100233743 3300005548 Bacteria 1839
134 Ga0070704_100010008 3300005549 Bacteria 5760
135 Ga0068855_100104113 3300005563 Bacteria 3265
136 Ga0068855_100214605 3300005563 Bacteria 2161
137 Ga0070664_100004030 3300005564 Bacteria 11799
138 Ga0070664_100121064 3300005564 Bacteria 2291
139 Ga0068854_100012579 3300005578 Bacteria 5545
140 Ga0068854_100025046 3300005578 Bacteria 4093
141 Ga0068856_100004065 3300005614 Bacteria 14642
142 Ga0070702_100003679 3300005615 Bacteria 6902
143 Ga0070702_100031295 3300005615 Bacteria 2909
144 Ga0070702_100068191 3300005615 Bacteria 2092
145 Ga0068852_100039684 3300005616 Bacteria 3965
146 Ga0068852_100041014 3300005616 Bacteria 3909
147 Ga0068852_100157893 3300005616 Bacteria 2115
148 Ga0068852_100183993 3300005616 Bacteria 1966
149 Ga0068852_100262884 3300005616 Bacteria 1658
150 Ga0068859_100025822 3300005617 Bacteria 5894
151 Ga0068859_100032362 3300005617 Bacteria 5254
152 Ga0068859_100035474 3300005617 Bacteria 5004
153 Ga0068859_100042445 3300005617 Bacteria 4568
154 Ga0068859_100079439 3300005617 Bacteria 3321
155 Ga0068859_100674452 3300005617 Bacteria 1125
156 Ga0068864_100027348 3300005618 Bacteria 4817
157 Ga0068864_100095074 3300005618 Bacteria 2635
158 Ga0068864_100116887 3300005618 Bacteria 2380
159 Ga0068864_100122909 3300005618 Bacteria 2323
160 Ga0068864_100149781 3300005618 Bacteria 2112
161 Ga0068864_100283518 3300005618 Bacteria 1547
162 Ga0068866_10118921 3300005718 Bacteria 1486
163 Ga0068861_100003730 3300005719 Bacteria 10161
164 Ga0068861_100095142 3300005719 Bacteria 2358
165 Ga0068861_100127650 3300005719 Bacteria 2060
166 Ga0068861_100220865 3300005719 Bacteria 1602
167 Ga0068851_10001051 3300005834 Bacteria 11959
168 Ga0068851_10009294 3300005834 Bacteria 4564
169 Ga0068851_10077806 3300005834 Bacteria 1727
170 Ga0068851_10081757 3300005834 Bacteria 1688
171 Ga0068870_10001962 3300005840 Bacteria 8504
172 Ga0068870_10051449 3300005840 Bacteria 2180
173 Ga0068870_10192874 3300005840 Bacteria 1230
174 Ga0068863_100003730 3300005841 Bacteria 15066
175 Ga0068863_100016873 3300005841 Bacteria 7003
176 Ga0068863_100087307 3300005841 Bacteria 2955
177 Ga0068858_100010789 3300005842 Bacteria 8636
178 Ga0068858_100020301 3300005842 Bacteria 6213
179 Ga0068858_100076998 3300005842 Bacteria 3098
180 Ga0068858_100145629 3300005842 Bacteria 2225
181 Ga0068858_100211914 3300005842 Bacteria 1833
182 Ga0068858_100402097 3300005842 Bacteria 1316
183 Ga0068858_100585921 3300005842 Bacteria 1081
184 Ga0068860_100022098 3300005843 Bacteria 6158
185 Ga0068860_100126704 3300005843 Bacteria 2447
186 Ga0068860_100198483 3300005843 Bacteria 1944
187 Ga0068860_100515916 3300005843 Bacteria 1195
188 Ga0068862_100008255 3300005844 Bacteria 8614
189 Ga0068862_100011911 3300005844 Bacteria 7183
190 Ga0068862_100030190 3300005844 Bacteria 4567
191 Ga0068862_100174977 3300005844 Bacteria 1924
192 Ga0068862_100178804 3300005844 Bacteria 1903
193 Ga0068862_100485875 3300005844 Bacteria 1170
194 Ga0081455_10042044 3300005937 Bacteria 4013
195 Ga0081455_10086820 3300005937 Bacteria 2547
196 Ga0081539_10000927 3300005985 Bacteria 55152
197 Ga0081539_10045116 3300005985 Bacteria 2538
198 Ga0070717_10012513 3300006028 Bacteria 6473
199 Ga0070717_10070126 3300006028 Bacteria 2920
200 Ga0070717_10080300 3300006028 Bacteria 2736
201 Ga0070717_10216537 3300006028 Bacteria 1682
202 Ga0070717_10620385 3300006028 Bacteria 981
203 Ga0075365_10118627 3300006038 Bacteria 1823
204 Ga0075365_10193734 3300006038 Bacteria 1423
205 Ga0075365_10204591 3300006038 Bacteria 1383
206 Ga0070712_100201659 3300006175 Bacteria 1563
207 Ga0075367_10039793 3300006178 Bacteria 2742
208 Ga0075367_10283228 3300006178 Bacteria 1042
209 Ga0097621_100014203 3300006237 Bacteria 5954
210 Ga0097621_100030796 3300006237 Bacteria 4252
211 Ga0097621_100349621 3300006237 Bacteria 1314
212 Ga0068871_100022746 3300006358 Bacteria 4838
213 Ga0068871_100031530 3300006358 Bacteria 4181
214 Ga0068871_100043670 3300006358 Bacteria 3602
215 Ga0068871_100047252 3300006358 Bacteria 3470
216 Ga0068871_100075727 3300006358 Bacteria 2778
217 Ga0068871_100275157 3300006358 Bacteria 1471
218 Ga0075428_100190255 3300006844 Bacteria 2220
219 Ga0075428_100261056 3300006844 Bacteria 1865
220 Ga0075430_100075967 3300006846 Bacteria 2816
221 Ga0075430_100131372 3300006846 Bacteria 2087
222 Ga0075430_100335223 3300006846 Bacteria 1250
223 Ga0075431_100036988 3300006847 Bacteria 5028
224 Ga0075431_100072856 3300006847 Bacteria 3544
225 Ga0075431_100154691 3300006847 Bacteria 2360
226 Ga0075433_10011974 3300006852 Bacteria 6993
227 Ga0075434_100008016 3300006871 Bacteria 9788
228 Ga0075429_100150497 3300006880 Bacteria 2038
229 Ga0075429_100185014 3300006880 Bacteria 1825
230 Ga0068865_100008038 3300006881 Bacteria 6512
231 Ga0075436_100010195 3300006914 Bacteria 6435
232 Ga0097620_100025822 3300006931 Bacteria 5894
233 Ga0097620_100032362 3300006931 Bacteria 5254
234 Ga0097620_100035474 3300006931 Bacteria 5004
235 Ga0097620_100042445 3300006931 Bacteria 4568
236 Ga0097620_100079438 3300006931 Bacteria 3321
237 Ga0097620_100674499 3300006931 Bacteria 1125
238 Ga0099824_1007872 3300006942 Bacteria 13879
239 Ga0079104_1000146 3300006946 Bacteria 99148
240 Ga0079104_1016660 3300006946 Bacteria 2140
241 Ga0079104_1023901 3300006946 Bacteria 1618
242 Ga0099826_10005057 3300006948 Bacteria 9372
243 Ga0075435_100012598 3300007076 Bacteria 6264
244 Ga0105251_10055930 3300009011 Bacteria 1869
245 Ga0105250_10000006 3300009092 Bacteria 390071
246 Ga0105240_10010715 3300009093 Bacteria 12862
247 Ga0105240_10017187 3300009093 Bacteria 9759
248 Ga0105240_10089075 3300009093 Bacteria 3775
249 Ga0111539_10057862 3300009094 Bacteria 4602
250 Ga0111539_10071416 3300009094 Bacteria 4096
251 Ga0111539_10120566 3300009094 Bacteria 3073
252 Ga0111539_10307347 3300009094 Bacteria 1845
253 Ga0111539_10336516 3300009094 Bacteria 1757
254 Ga0111539_10683653 3300009094 Bacteria 1195
255 Ga0105245_10008219 3300009098 Bacteria 9124
256 Ga0105245_10026816 3300009098 Bacteria 5073
257 Ga0105245_10327570 3300009098 Bacteria 1511
258 Ga0105245_10448387 3300009098 Bacteria 1298
259 Ga0105247_10004007 3300009101 Bacteria 9476
260 Ga0105247_10148587 3300009101 Bacteria 1542
261 Ga0114129_10069834 3300009147 Bacteria 4897
262 Ga0114129_10520896 3300009147 Bacteria 1550
263 Ga0105243_10034179 3300009148 Bacteria 3934
264 Ga0105241_10025396 3300009174 Bacteria 4402
265 Ga0105241_10104068 3300009174 Bacteria 2261
266 Ga0105241_10195305 3300009174 Bacteria 1687
267 Ga0105242_10088775 3300009176 Bacteria 2598
268 Ga0105248_10016488 3300009177 Bacteria 8132
269 Ga0105248_10113758 3300009177 Bacteria 3052
270 Ga0105248_10218452 3300009177 Bacteria 2146
271 Ga0105237_10013036 3300009545 Bacteria 8728
272 Ga0105237_10046598 3300009545 Bacteria 4360
273 Ga0105237_10209728 3300009545 Bacteria 1948
274 Ga0105238_10067892 3300009551 Bacteria 3566
275 Ga0105238_10142509 3300009551 Bacteria 2373
276 Ga0105249_10014648 3300009553 Bacteria 6932
277 Ga0105249_10107042 3300009553 Bacteria 2638
278 Ga0105249_10259151 3300009553 Bacteria 1727
279 Ga0105239_10000037 3300010375 Bacteria 206779
280 Ga0105239_10056407 3300010375 Bacteria 4309
281 Ga0105239_10111081 3300010375 Bacteria 3038
282 Ga0105239_10648910 3300010375 Bacteria 1205
283 Ga0105246_10007529 3300011119 Bacteria 6678
284 Ga0157373_10000023 3300013100 Bacteria 164200
285 Ga0157373_10080711 3300013100 Bacteria 2294
286 Ga0157371_10008583 3300013102 Bacteria 8122
287 Ga0157371_10039729 3300013102 Bacteria 3364
288 Ga0157371_10131106 3300013102 Bacteria 1783
289 Ga0157371_10165535 3300013102 Bacteria 1579
290 Ga0157370_10003921 3300013104 Bacteria 17335
291 Ga0157370_10013827 3300013104 Bacteria 8291
292 Ga0157369_10050251 3300013105 Bacteria 4516
293 Ga0157374_10002677 3300013296 Bacteria 14989
294 Ga0157374_10016721 3300013296 Bacteria 6454
295 Ga0157374_10054267 3300013296 Bacteria 3738
296 Ga0157374_10074957 3300013296 Bacteria 3197
297 Ga0157374_10375497 3300013296 Bacteria 1416
298 Ga0157378_10000631 3300013297 Bacteria 33043
299 Ga0157378_10060000 3300013297 Bacteria 3394
300 Ga0157378_10074921 3300013297 Bacteria 3046
301 Ga0163162_10005487 3300013306 Bacteria 12255
302 Ga0157375_10019639 3300013308 Bacteria 6152
303 Ga0157375_10061837 3300013308 Bacteria 3719
304 Ga0157375_10108044 3300013308 Bacteria 2876
305 Ga0157375_10155169 3300013308 Bacteria 2428
306 Ga0157375_10286061 3300013308 Bacteria 1812
307 Ga0163163_10007534 3300014325 Bacteria 9609
308 Ga0157380_10002142 3300014326 Bacteria 13248
309 Ga0157380_10002279 3300014326 Bacteria 12894
310 Ga0157380_10008389 3300014326 Bacteria 7371
311 Ga0157380_10032855 3300014326 Bacteria 3993
312 Ga0157380_10033683 3300014326 Bacteria 3946
313 Ga0157380_10078277 3300014326 Bacteria 2697
314 Ga0157380_10080884 3300014326 Bacteria 2656
315 Ga0157380_10116787 3300014326 Bacteria 2253
316 Ga0157377_10097218 3300014745 Bacteria 1748
317 Ga0157377_10280655 3300014745 Bacteria 1092
318 Ga0157379_10000830 3300014968 Bacteria 25057
319 Ga0157379_10039058 3300014968 Bacteria 4235
320 Ga0157379_10181531 3300014968 Bacteria 1901
321 Ga0157379_10253425 3300014968 Bacteria 1598
322 Ga0157376_10041860 3300014969 Bacteria 3753
323 Ga0157376_10051232 3300014969 Bacteria 3429
324 Ga0157376_10061915 3300014969 Bacteria 3147
325 Ga0157376_10096073 3300014969 Bacteria 2578
326 Ga0157376_10320753 3300014969 Bacteria 1473
327 Ga0182006_1002701 3300015261 Bacteria 9523
328 Ga0182006_1017283 3300015261 Bacteria 3066
329 Ga0182006_1017297 3300015261 Bacteria 3065
330 Ga0163161_10287141 3300017792 Bacteria 1292
331 Ga0163161_10511148 3300017792 Bacteria 980
332 Ga0206353_11795824 3300020082 Bacteria 1397
333 Ga0209566_100052 3300025225 Bacteria 231848
334 Ga0209147_103612 3300025229 Bacteria 2909
335 Ga0209258_101156 3300025242 Bacteria 10794
336 Ga0209675_1000025 3300025291 Bacteria 294102
337 Ga0209676_1000198 3300025292 Bacteria 134708
338 Ga0209676_1000362 3300025292 Bacteria 85770
339 Ga0209676_1003189 3300025292 Bacteria 10409
340 Ga0209676_1041396 3300025292 Bacteria 1288
341 Ga0209025_1019137 3300025294 Bacteria 3826
342 Ga0209025_1041993 3300025294 Bacteria 1949
343 Ga0209050_1000849 3300025298 Bacteria 41596
344 Ga0209050_1003508 3300025298 Bacteria 11474
345 Ga0209257_1000860 3300025304 Bacteria 43237
346 Ga0209257_1001370 3300025304 Bacteria 29369
347 Ga0209257_1003116 3300025304 Bacteria 14836
348 Ga0207697_10004336 3300025315 Bacteria 6790
349 Ga0207696_1000069 3300025711 Bacteria 227744
350 Ga0207655_1000003 3300025728 Bacteria 1081376
351 Ga0207682_10000798 3300025893 Bacteria 14551
352 Ga0207682_10002137 3300025893 Bacteria 8961
353 Ga0207682_10015311 3300025893 Bacteria 2984
354 Ga0207642_10025189 3300025899 Bacteria 2403
355 Ga0207642_10031370 3300025899 Bacteria 2225
356 Ga0207642_10246690 3300025899 Bacteria 1011
357 Ga0207710_10015418 3300025900 Bacteria 3229
358 Ga0207688_10032338 3300025901 Bacteria 2891
359 Ga0207688_10048236 3300025901 Bacteria 2379
360 Ga0207688_10066672 3300025901 Bacteria 2036
361 Ga0207680_10030105 3300025903 Bacteria 3057
362 Ga0207680_10108620 3300025903 Bacteria 1795
363 Ga0207647_10146562 3300025904 Bacteria 1381
364 Ga0207647_10167662 3300025904 Bacteria 1279
365 Ga0207699_10004323 3300025906 Bacteria 6796
366 Ga0207645_10001048 3300025907 Bacteria 22872
367 Ga0207645_10047151 3300025907 Bacteria 2752
368 Ga0207645_10055042 3300025907 Bacteria 2540
369 Ga0207645_10094092 3300025907 Bacteria 1929
370 Ga0207645_10119781 3300025907 Bacteria 1708
371 Ga0207643_10000594 3300025908 Bacteria 22954
372 Ga0207643_10046706 3300025908 Bacteria 2448
373 Ga0207643_10123129 3300025908 Bacteria 1538
374 Ga0207654_10134043 3300025911 Bacteria 1571
375 Ga0207695_10001017 3300025913 Bacteria 49429
376 Ga0207695_10031430 3300025913 Bacteria 5823
377 Ga0207695_10046636 3300025913 Bacteria 4592
378 Ga0207695_10109233 3300025913 Bacteria 2748
379 Ga0207671_10004808 3300025914 Bacteria 12723
380 Ga0207671_10052375 3300025914 Bacteria 3025
381 Ga0207671_10091997 3300025914 Bacteria 2286
382 Ga0207693_10024239 3300025915 Bacteria 4817
383 Ga0207663_10016077 3300025916 Bacteria 4141
384 Ga0207660_10007800 3300025917 Bacteria 6928
385 Ga0207660_10028542 3300025917 Bacteria 3817
386 Ga0207662_10155727 3300025918 Bacteria 1456
387 Ga0207657_10022327 3300025919 Bacteria 5924
388 Ga0207657_10076906 3300025919 Bacteria 2815
389 Ga0207657_10085036 3300025919 Bacteria 2651
390 Ga0207649_10002784 3300025920 Bacteria 9659
391 Ga0207652_10122608 3300025921 Bacteria 2313
392 Ga0207652_10354277 3300025921 Bacteria 1325
393 Ga0207646_10001356 3300025922 Bacteria 30379
394 Ga0207681_10012027 3300025923 Bacteria 5331
395 Ga0207681_10045203 3300025923 Bacteria 2955
396 Ga0207681_10080936 3300025923 Bacteria 2292
397 Ga0207681_10186577 3300025923 Bacteria 1583
398 Ga0207694_10248910 3300025924 Bacteria 1454
399 Ga0207650_10001016 3300025925 Bacteria 21075
400 Ga0207650_10001564 3300025925 Bacteria 16366
401 Ga0207650_10003470 3300025925 Bacteria 10830
402 Ga0207650_10040514 3300025925 Bacteria 3409
403 Ga0207659_10002573 3300025926 Bacteria 10802
404 Ga0207659_10011881 3300025926 Bacteria 5516
405 Ga0207659_10019574 3300025926 Bacteria 4459
406 Ga0207659_10236941 3300025926 Bacteria 1474
407 Ga0207687_10030832 3300025927 Bacteria 3619
408 Ga0207700_10000044 3300025928 Bacteria 89454
409 Ga0207700_10001414 3300025928 Bacteria 13622
410 Ga0207700_10071401 3300025928 Bacteria 2673
411 Ga0207664_10005921 3300025929 Bacteria 8365
412 Ga0207664_10036227 3300025929 Bacteria 3813
413 Ga0207664_10449804 3300025929 Bacteria 1150
414 Ga0207644_10002140 3300025931 Bacteria 12809
415 Ga0207644_10003507 3300025931 Bacteria 10153
416 Ga0207644_10089931 3300025931 Bacteria 2286
417 Ga0207690_10074617 3300025932 Bacteria 2349
418 Ga0207690_10194039 3300025932 Bacteria 1538
419 Ga0207690_10227839 3300025932 Bacteria 1429
420 Ga0207706_10006526 3300025933 Bacteria 10815
421 Ga0207706_10015081 3300025933 Bacteria 6995
422 Ga0207706_10022657 3300025933 Bacteria 5637
423 Ga0207706_10261322 3300025933 Bacteria 1511
424 Ga0207709_10052850 3300025935 Bacteria 2497
425 Ga0207709_10081325 3300025935 Bacteria 2088
426 Ga0207709_10149120 3300025935 Bacteria 1618
427 Ga0207670_10051408 3300025936 Bacteria 2767
428 Ga0207670_10157127 3300025936 Bacteria 1694
429 Ga0207670_10380867 3300025936 Bacteria 1124
430 Ga0207669_10002485 3300025937 Bacteria 7864
431 Ga0207669_10007588 3300025937 Bacteria 5031
432 Ga0207669_10067523 3300025937 Bacteria 2229
433 Ga0207669_10077647 3300025937 Bacteria 2113
434 Ga0207669_10517847 3300025937 Bacteria 957
435 Ga0207704_10030885 3300025938 Bacteria 3010
436 Ga0207704_10190312 3300025938 Bacteria 1492
437 Ga0207665_10384990 3300025939 Bacteria 1065
438 Ga0207691_10000180 3300025940 Bacteria 59800
439 Ga0207691_10003262 3300025940 Bacteria 15803
440 Ga0207691_10007125 3300025940 Bacteria 10793
441 Ga0207691_10038037 3300025940 Bacteria 4452
442 Ga0207691_10054083 3300025940 Bacteria 3663
443 Ga0207691_10060715 3300025940 Bacteria 3435
444 Ga0207691_10120971 3300025940 Bacteria 2320
445 Ga0207691_10136420 3300025940 Bacteria 2164
446 Ga0207711_10005883 3300025941 Bacteria 10354
447 Ga0207711_10092518 3300025941 Bacteria 2661
448 Ga0207711_10142554 3300025941 Bacteria 2157
449 Ga0207689_10001431 3300025942 Bacteria 22792
450 Ga0207689_10024871 3300025942 Bacteria 5020
451 Ga0207689_10049684 3300025942 Bacteria 3460
452 Ga0207689_10199433 3300025942 Bacteria 1652
453 Ga0207661_10003516 3300025944 Bacteria 10885
454 Ga0207661_10080148 3300025944 Bacteria 2693
455 Ga0207679_10043675 3300025945 Bacteria 3229
456 Ga0207667_10360925 3300025949 Bacteria 1481
457 Ga0207651_10074105 3300025960 Bacteria 2423
458 Ga0207651_10075588 3300025960 Bacteria 2404
459 Ga0207651_10141206 3300025960 Bacteria 1861
460 Ga0207651_10401937 3300025960 Bacteria 1165
461 Ga0207668_10000060 3300025972 Bacteria 89732
462 Ga0207668_10007605 3300025972 Bacteria 6450
463 Ga0207668_10050245 3300025972 Bacteria 2872
464 Ga0207668_10092305 3300025972 Bacteria 2228
465 Ga0207658_10023664 3300025986 Bacteria 4290
466 Ga0207658_10041264 3300025986 Bacteria 3341
467 Ga0207658_10076747 3300025986 Bacteria 2547
468 Ga0207658_10418344 3300025986 Bacteria 1181
469 Ga0207677_10072693 3300026023 Bacteria 2432
470 Ga0207677_10094007 3300026023 Bacteria 2187
471 Ga0207677_10551133 3300026023 Bacteria 1005
472 Ga0207703_10012833 3300026035 Bacteria 6533
473 Ga0207703_10041853 3300026035 Bacteria 3673
474 Ga0207703_10069667 3300026035 Bacteria 2901
475 Ga0207703_10371529 3300026035 Bacteria 1321
476 Ga0207639_10082507 3300026041 Bacteria 2548
477 Ga0207639_10109132 3300026041 Bacteria 2251
478 Ga0207678_10001818 3300026067 Bacteria 19546
479 Ga0207678_10008182 3300026067 Bacteria 9223
480 Ga0207678_10214587 3300026067 Bacteria 1647
481 Ga0207708_10006356 3300026075 Bacteria 8756
482 Ga0207708_10034973 3300026075 Bacteria 3822
483 Ga0207708_10053197 3300026075 Bacteria 3084
484 Ga0207708_10127160 3300026075 Bacteria 1990
485 Ga0207702_10001992 3300026078 Bacteria 19810
486 Ga0207702_10021932 3300026078 Bacteria 5289
487 Ga0207641_10010191 3300026088 Bacteria 7729
488 Ga0207641_10031263 3300026088 Bacteria 4415
489 Ga0207641_10041337 3300026088 Bacteria 3863
490 Ga0207648_10005794 3300026089 Bacteria 12379
491 Ga0207648_10012777 3300026089 Bacteria 7845
492 Ga0207648_10017845 3300026089 Bacteria 6440
493 Ga0207648_10048341 3300026089 Bacteria 3725
494 Ga0207648_10077587 3300026089 Bacteria 2896
495 Ga0207648_10111844 3300026089 Bacteria 2398
496 Ga0207648_10118701 3300026089 Bacteria 2325
497 Ga0207648_10170115 3300026089 Bacteria 1926
498 Ga0207676_10000896 3300026095 Bacteria 23105
499 Ga0207676_10005522 3300026095 Bacteria 8948
500 Ga0207676_10060724 3300026095 Bacteria 2991
501 Ga0207676_10104749 3300026095 Bacteria 2353
502 Ga0207676_10112461 3300026095 Bacteria 2281
503 Ga0207676_10155031 3300026095 Bacteria 1977
504 Ga0207674_10030489 3300026116 Bacteria 5668
505 Ga0207675_100015760 3300026118 Bacteria 7048
506 Ga0207675_100023333 3300026118 Bacteria 5754
507 Ga0207675_100039045 3300026118 Bacteria 4431
508 Ga0207675_100086921 3300026118 Bacteria 2936
509 Ga0207675_100450507 3300026118 Bacteria 1275
510 Ga0207675_100594747 3300026118 Bacteria 1109
511 Ga0207683_10000146 3300026121 Bacteria 58543
512 Ga0207683_10001721 3300026121 Bacteria 19553
513 Ga0207683_10001789 3300026121 Bacteria 19023
514 Ga0207683_10065769 3300026121 Bacteria 3197
515 Ga0207683_10163499 3300026121 Bacteria 2013
516 Ga0207683_10180368 3300026121 Bacteria 1915
517 Ga0207683_10346564 3300026121 Bacteria 1363
518 Ga0207698_10002118 3300026142 Bacteria 11709
519 Ga0207698_10026942 3300026142 Bacteria 4073
520 Ga0207698_10062486 3300026142 Bacteria 2908
521 Ga0209281_1000045 3300027111 Bacteria 328124
522 Ga0209281_1004536 3300027111 Bacteria 4131
523 Ga0209489_108520 3300027361 Bacteria 13879
524 Ga0210002_1018120 3300027617 Bacteria 1124
525 Ga0209971_1003179 3300027682 Bacteria 3915
526 Ga0209966_1005269 3300027695 Bacteria 2218
527 Ga0209974_10014042 3300027876 Bacteria 2668
528 Ga0209974_10056085 3300027876 Bacteria 1329
529 Ga0209974_10109539 3300027876 Bacteria 971
530 Ga0207428_10015402 3300027907 Bacteria 6615
531 Ga0207428_10214012 3300027907 Bacteria 1447
532 Ga0268266_10028457 3300028379 Bacteria 4750
533 Ga0268266_10208928 3300028379 Bacteria 1790
534 Ga0268266_10287376 3300028379 Bacteria 1530
535 Ga0268265_10007031 3300028380 Bacteria 7610
536 Ga0268265_10050752 3300028380 Bacteria 3127
537 Ga0268264_10008954 3300028381 Bacteria 8308
538 Ga0268264_10018610 3300028381 Bacteria 5679
539 Ga0268264_10086517 3300028381 Bacteria 2693
540 Ga0268264_10095159 3300028381 Bacteria 2577
541 Ga0268264_10207103 3300028381 Bacteria 1798
542 Ga0268264_10282555 3300028381 Bacteria 1555
543 Ga0265334_10016887 3300028573 Bacteria 3018
544 Ga0265318_10011555 3300028577 Bacteria 3795
545 Ga0265338_10015955 3300028800 Bacteria 8213
546 Ga0265330_10030331 3300031235 Bacteria 2429
547 Ga0265332_10014637 3300031238 Bacteria 3468
548 Ga0265340_10092203 3300031247 Bacteria 1415
549 Ga0265331_10008258 3300031250 Bacteria 5934
550 Ga0265316_10018778 3300031344 Bacteria 5935
551 Ga0307408_100000475 3300031548 Bacteria 35093
552 Ga0307408_100163213 3300031548 Bacteria 1771
553 Ga0307408_100404560 3300031548 Bacteria 1173
554 Ga0307408_100438842 3300031548 Bacteria 1130
555 Ga0316575_10076015 3300031665 Bacteria 1352
556 Ga0316579_10005942 3300031691 Bacteria 4950
557 Ga0265314_10000595 3300031711 Bacteria 45508
558 Ga0265342_10051906 3300031712 Bacteria 2445
559 Ga0316576_10004148 3300031727 Bacteria 8646
560 Ga0316576_10087355 3300031727 Bacteria 2320
561 Ga0316576_10125682 3300031727 Bacteria 1927
562 Ga0316576_10145717 3300031727 Bacteria 1783
563 Ga0316578_10017721 3300031728 Bacteria 3882
564 Ga0316578_10166068 3300031728 Bacteria 1330
565 Ga0307405_10010037 3300031731 Bacteria 4885
566 Ga0316577_10028417 3300031733 Bacteria 3120
567 Ga0316577_10072127 3300031733 Bacteria 1927
568 Ga0316577_10122595 3300031733 Bacteria 1461
569 Ga0307413_10014744 3300031824 Bacteria 3982
570 Ga0307413_10201004 3300031824 Bacteria 1439
571 Ga0307410_10005332 3300031852 Bacteria 6791
572 Ga0307410_10009576 3300031852 Bacteria 5442
573 Ga0307410_10018238 3300031852 Bacteria 4237
574 Ga0307410_10020706 3300031852 Bacteria 4030
575 Ga0307406_10000062 3300031901 Bacteria 60112
576 Ga0307406_10030734 3300031901 Bacteria 3264
577 Ga0307407_10000440 3300031903 Bacteria 12687
578 Ga0307407_10001616 3300031903 Bacteria 8325
579 Ga0307407_10043850 3300031903 Bacteria 2517
580 Ga0307412_10111294 3300031911 Bacteria 1956
581 Ga0307412_10151594 3300031911 Bacteria 1711
582 Ga0307409_100007763 3300031995 Bacteria 6451
583 Ga0307409_100078235 3300031995 Bacteria 2660
584 Ga0307409_100089516 3300031995 Bacteria 2516
585 Ga0307409_100275035 3300031995 Bacteria 1553
586 Ga0307416_100000394 3300032002 Bacteria 22418
587 Ga0307416_100008628 3300032002 Bacteria 6596
588 Ga0307416_100910466 3300032002 Bacteria 980
589 Ga0307414_10000027 3300032004 Bacteria 192277
590 Ga0307414_10026665 3300032004 Bacteria 3722
591 Ga0307414_10048545 3300032004 Bacteria 2929
592 Ga0307414_10052365 3300032004 Bacteria 2840
593 Ga0307414_10085742 3300032004 Bacteria 2321
594 Ga0307411_10037604 3300032005 Bacteria 3045
595 Ga0307411_10217284 3300032005 Bacteria 1480
596 Ga0307415_100057771 3300032126 Bacteria 2668
597 Ga0307415_100150460 3300032126 Bacteria 1791
598 Ga0316583_10030367 3300032133 Bacteria 1925
599 Ga0316585_10025747 3300032137 Bacteria 1826
600 Ga0316580_10002895 3300032139 Bacteria 4804
601 Ga0316580_10041620 3300032139 Bacteria 1419
602 Ga0316596_1027287 3300033541 Bacteria 1473
603 Ga0373955_0107256 3300035172 Bacteria 1611
604 Ga0316574_0000018 3300035398 Bacteria 40938
605 Ga0316574_0006270 3300035398 Bacteria 6413
606 Ga0316574_0030139 3300035398 Bacteria 3283
607 Ga0316574_0031913 3300035398 Bacteria 3198
608 Ga0316574_0033376 3300035398 Bacteria 3133
609 Ga0316574_0035454 3300035398 Bacteria 3049
610 Ga0316574_0132803 3300035398 Bacteria 1602
611 Ga0316574_0241715 3300035398 Bacteria 1154
612 Ga0373931_0039649 3300035691 Bacteria 2468
613 Ga0373933_0015401 3300035724 Bacteria 4261
614 Ga0373937_0067615 3300036401 Bacteria 3292
615 Ga0316582_0035066 3300036647 Bacteria 3095
616 Ga0316582_0043967 3300036647 Bacteria 2805
617 Ga0316582_0151651 3300036647 Bacteria 1567
618 Ga0316582_0236407 3300036647 Bacteria 1251
619 Ga0316584_0034958 3300036712 Bacteria 3727
620 Ga0316584_0067765 3300036712 Bacteria 2675
621 Ga0316584_0080062 3300036712 Bacteria 2448
622 Ga0316584_0095372 3300036712 Bacteria 2227
623 Ga0316584_0127517 3300036712 Bacteria 1900
624 Ga0316584_0320366 3300036712 Bacteria 1119
625 Ga0316584_0324251 3300036712 Bacteria 1110
626 Ga0373925_0019723 3300037068 Bacteria 4907
627 Ga0395899_0010439 3300037312 Bacteria 7114
628 Ga0395899_0014021 3300037312 Bacteria 6119
629 Ga0395900_0029177 3300037418 Bacteria 5658
630 Ga0395900_0115958 3300037418 Bacteria 2749
631 Ga0395900_0246709 3300037418 Bacteria 1789
632 Ga0395898_0009056 3300037466 Bacteria 10481
633 Ga0395898_0252324 3300037466 Bacteria 1682
634 Ga0395905_0115294 3300037471 Bacteria 2525
635 Ga0395905_0427804 3300037471 Bacteria 1220
636 Ga0395901_0022229 3300038443 Bacteria 6497
637 Ga0395901_0055805 3300038443 Bacteria 4109
638 Ga0395901_0083749 3300038443 Bacteria 3334
639 Ga0395901_0168108 3300038443 Bacteria 2301
640 Ga0395901_0628756 3300038443 Bacteria 1079
641 Ga0400486_08083 3300038742 Bacteria 5590
642 Ga0400483_016889 3300039062 Bacteria 7256
643 Ga0400483_147849 3300039062 Bacteria 9474
644 Ga0400483_194805 3300039062 Bacteria 6341
645 Ga0400483_203034 3300039062 Bacteria 3617
646 Ga0436365_0011767 3300039437 Bacteria 7798
647 Ga0436365_0608669 3300039437 Bacteria 1249
648 Ga0436363_0917267 3300039450 Bacteria 2766
649 Ga0436363_1703617 3300039450 Bacteria 1642
650 Ga0451841_0883964 3300041498 Bacteria 2308
651 Ga0451845_0381021 3300041501 Bacteria 1428
652 Ga0451849_0418948 3300041505 Bacteria 1313
653 Ga0451851_0575292 3300041507 Bacteria 1915
654 Ga0439445_0000682 3300042004 Bacteria 7053
655 Ga0439450_038040 3300042008 Bacteria 1108
656 Ga0439452_037084 3300042010 Bacteria 1164
657 Ga0450923_045122 3300042125 Bacteria 935
658 Ga0439459_0021161 3300042438 Bacteria 1247
659 Ga0439464_0023228 3300042439 Bacteria 1711
660 Ga0439464_0040721 3300042439 Bacteria 1324
661 Ga0439460_0041204 3300042461 Bacteria 1356
662 Ga0453683_0119545 3300044673 Bacteria 1658
663 Ga0453683_0153970 3300044673 Bacteria 1453
664 Ga0466966_0043210 3300044684 Bacteria 2890
665 Ga0466961_0171589 3300044693 Bacteria 1349
666 Ga0466963_0066008 3300044694 Bacteria 2427
667 Ga0466964_0007088 3300044706 Bacteria 4193
668 Ga0453684_0161279 3300044712 Bacteria 2652
669 Ga0466970_0042262 3300044765 Bacteria 2424
670 Ga0466970_0210179 3300044765 Bacteria 1084
671 Ga0466959_0037588 3300045049 Bacteria 3578
672 Ga0451576_0000007 3300045051 Bacteria 782228
673 Ga0451576_0758093 3300045051 Bacteria 1019
674 Ga0466967_0097591 3300045976 Bacteria 2682
675 Ga0495603_0059340 3300046455 Bacteria 2262
676 Ga0495629_0146620 3300046459 Bacteria 1641
677 Ga0495629_0345730 3300046459 Bacteria 1015
678 Ga0495618_0159939 3300046514 Bacteria 1436
679 Ga0495630_0373600 3300046517 Bacteria 1092
680 Ga0495642_0072212 3300046528 Bacteria 1445
681 Ga0495642_0095299 3300046528 Bacteria 1263
682 Ga0495640_0178135 3300046533 Bacteria 1356
683 Ga0495586_0251815 3300046535 Bacteria 1008
684 Ga0495621_0005070 3300046539 Bacteria 3757
685 Ga0495633_0079868 3300046558 Bacteria 1523
686 Ga0495668_0035028 3300046616 Bacteria 2814
687 Ga0495625_0000362 3300046660 Bacteria 69497
688 Ga0495635_0170574 3300046663 Bacteria 1480
689 Ga0495659_0029872 3300046664 Bacteria 1894
690 Ga0495658_0056293 3300046683 Bacteria 2242
691 Ga0495658_0160091 3300046683 Bacteria 1388
692 Ga0495670_0090065 3300046691 Bacteria 1569
693 Ga0495670_0190264 3300046691 Bacteria 1085
694 Ga0495600_0013633 3300046809 Bacteria 5113
695 Ga0495684_0024548 3300047471 Bacteria 4641
696 Ga0495615_0055313 3300048090 Bacteria 1033
697 Ga0496100_0234764 3300048903 Bacteria 1351
698 Ga0496102_0161621 3300048905 Bacteria 2107
699 Ga0496104_0014412 3300048907 Bacteria 7142
700 Ga0496104_0046317 3300048907 Bacteria 4095
701 Ga0496105_0006061 3300048908 Bacteria 9250
702 Ga0496105_0028078 3300048908 Bacteria 4602
703 Ga0496106_0009636 3300048909 Bacteria 7133
704 Ga0496107_0003209 3300048910 Bacteria 10881
705 Ga0496108_0037240 3300048911 Bacteria 4051
706 Ga0496109_0047196 3300048912 Bacteria 3915
707 Ga0496110_0017616 3300048913 Bacteria 5972
708 Ga0496110_0199281 3300048913 Bacteria 1819
709 Ga0496110_0270079 3300048913 Bacteria 1548
710 Ga0496111_0001084 3300048914 Bacteria 15034
711 Ga0496112_0009721 3300048915 Bacteria 8681
712 Ga0496113_0004957 3300048916 Bacteria 8246
713 Ga0496113_0056701 3300048916 Bacteria 2942
714 Ga0496114_0003135 3300048917 Bacteria 12684
715 Ga0496114_0021201 3300048917 Bacteria 5284
716 Ga0496115_0024228 3300048918 Bacteria 4715
717 Ga0496115_0088840 3300048918 Bacteria 2523
718 Ga0496115_0177399 3300048918 Bacteria 1762
719 Ga0496115_0273823 3300048918 Unclassified 1386
720 Ga0496115_0391865 3300048918 Bacteria 1128
721 Ga0496118_0082097 3300048921 Bacteria 2260
722 Ga0496121_0009176 3300048924 Bacteria 11433
723 Ga0496121_0026347 3300048924 Bacteria 5482
724 Ga0496121_0035138 3300048924 Bacteria 4496
725 Ga0496123_0128533 3300048926 Bacteria 1409
726 Ga0496126_0000123 3300048929 Bacteria 182726
727 Ga0496126_0015086 3300048929 Bacteria 7785
728 Ga0496126_0024582 3300048929 Bacteria 5813
729 Ga0496126_0055530 3300048929 Bacteria 3583
730 Ga0496126_0180615 3300048929 Bacteria 1793
731 Ga0501033_0006962 3300049570 Bacteria 8829
732 Ga0501034_0002561 3300049571 Bacteria 21656
733 Ga0501034_0308997 3300049571 Bacteria 1516
734 Ga0501034_0318569 3300049571 Bacteria 1488
735 Ga0501036_0395699 3300049572 Bacteria 1153
736 Ga0501040_0048797 3300049576 Bacteria 2894
737 Ga0501047_0177112 3300049581 Bacteria 2000
738 Ga0501070_0111884 3300049586 Bacteria 2257
739 Ga0501072_0306719 3300049588 Bacteria 1262
740 Ga0501072_0414436 3300049588 Bacteria 1068
741 Ga0501233_056965 3300049668 Bacteria 961
742 Ga0501238_000149 3300049671 Bacteria 10810
743 Ga0501241_016649 3300049758 Bacteria 1341
744 Ga0501269_001740 3300049766 Bacteria 2779
745 Ga0501280_000708 3300049776 Bacteria 7365
746 Ga0501282_005616 3300049778 Bacteria 1342
747 Ga0501282_006148 3300049778 Bacteria 1284
748 Ga0501044_0006427 3300049823 Bacteria 12984
749 Ga0501044_0517754 3300049823 Bacteria 1093
750 nmdc:mga00v17_48861_c1 3300050491 Bacteria 2565
751 nmdc:mga0yw44_105839_c1 3300050492 Bacteria 1797
752 nmdc:mga0yw44_124646_c1 3300050492 Bacteria 1662
753 nmdc:mga06z11_29810_c1 3300050494 Bacteria 2632
754 nmdc:mga07m45_142566_c1 3300050496 Bacteria 1388
755 nmdc:mga05p37_325549_c1 3300050507 Bacteria 1817
756 nmdc:mga09592_223429_c1 3300050508 Bacteria 1631
757 nmdc:mga09592_36737_c1 3300050508 Bacteria 4104
758 nmdc:mga0qj67_63704_c1 3300050509 Bacteria 2932
759 nmdc:mga06r32_6485_c1 3300050510 Bacteria 10514
760 nmdc:mga06r32_71459_c1 3300050510 Bacteria 3358
761 nmdc:mga08y16_158678_c1 3300050511 Bacteria 2350
762 nmdc:mga08y16_528942_c1 3300050511 Bacteria 1195
763 nmdc:mga08y16_80191_c1 3300050511 Bacteria 3403
764 nmdc:mga0n895_19450_c1 3300050512 Bacteria 6313
765 nmdc:mga0rr50_6191_c1 3300050513 Bacteria 7250
766 nmdc:mga08x19_76538_c1 3300050514 Bacteria 2190
767 nmdc:mga0a205_361699_c1 3300050515 Bacteria 1318
768 nmdc:mga0a205_601820_c1 3300050515 Bacteria 952
769 Ga0495601_0019377 3300053077 Bacteria 4150
770 Ga0500635_0002767 3300053080 Bacteria 4356
771 Ga0495619_0126831 3300053085 Bacteria 1752
772 Ga0500646_0047985 3300053090 Bacteria 1223
773 Ga0500641_0017281 3300053096 Bacteria 2696
774 Ga0500559_0015243 3300053136 Bacteria 3246
775 Ga0500568_0000724 3300053139 Bacteria 23628
776 Ga0500568_0003410 3300053139 Bacteria 8874
777 Ga0500584_009662 3300053726 Bacteria 4294
778 Ga0501084_0000216 3300054114 Bacteria 44550

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10003921 Ga0157370_100039212 243
2 3300027876 Ga0209974_10109539 Ga0209974_101095391 262
3 3300032004 Ga0307414_10085742 Ga0307414_100857422 269
4 3300006038 Ga0075365_10118627 Ga0075365_101186272 271
5 3300044765 Ga0466970_0210179 Ga0466970_0210179_28_987 271
6 3300005356 Ga0070674_100154285 Ga0070674_1001542852 272
7 3300005330 Ga0070690_100189801 Ga0070690_1001898011 273
8 3300005335 Ga0070666_10007408 Ga0070666_100074086 273
9 3300005347 Ga0070668_100003541 Ga0070668_10000354111 273
10 3300005354 Ga0070675_100087113 Ga0070675_1000871135 273
11 3300005364 Ga0070673_100000655 Ga0070673_10000065515 273
12 3300005456 Ga0070678_100111900 Ga0070678_1001119002 273
13 3300005459 Ga0068867_100012739 Ga0068867_1000127393 273
14 3300005466 Ga0070685_10075512 Ga0070685_100755121 273
15 3300005468 Ga0070707_100016769 Ga0070707_1000167694 273
16 3300005539 Ga0068853_100009347 Ga0068853_1000093479 273
17 3300005543 Ga0070672_100037283 Ga0070672_1000372833 273
18 3300005834 Ga0068851_10001051 Ga0068851_1000105114 273
19 3300005843 Ga0068860_100198483 Ga0068860_1001984833 273
20 3300006237 Ga0097621_100030796 Ga0097621_1000307962 273
21 3300006358 Ga0068871_100047252 Ga0068871_1000472523 273
22 3300013297 Ga0157378_10060000 Ga0157378_100600003 273
23 3300013308 Ga0157375_10061837 Ga0157375_100618373 273
24 3300014969 Ga0157376_10041860 Ga0157376_100418602 273
25 3300025893 Ga0207682_10000798 Ga0207682_100007983 273
26 3300025903 Ga0207680_10108620 Ga0207680_101086203 273
27 3300025907 Ga0207645_10001048 Ga0207645_1000104819 273
28 3300025926 Ga0207659_10011881 Ga0207659_100118813 273
29 3300025931 Ga0207644_10002140 Ga0207644_100021403 273
30 3300025937 Ga0207669_10002485 Ga0207669_1000248511 273
31 3300025940 Ga0207691_10000180 Ga0207691_1000018050 273
32 3300025942 Ga0207689_10199433 Ga0207689_101994332 273
33 3300026041 Ga0207639_10082507 Ga0207639_100825073 273
34 3300026089 Ga0207648_10005794 Ga0207648_1000579414 273
35 3300026095 Ga0207676_10155031 Ga0207676_101550312 273
36 3300026121 Ga0207683_10000146 Ga0207683_1000014621 273
37 3300028379 Ga0268266_10287376 Ga0268266_102873762 273
38 3300050492 nmdc:mga0yw44_124646_c1 nmdc:mga0yw44_124646_c1_19_1044 273
39 3300048924 Ga0496121_0026347 Ga0496121_0026347_598_1494 274
40 3300006946 Ga0079104_1016660 Ga0079104_10166601 275
41 3300053136 Ga0500559_0015243 Ga0500559_0015243_1171_2067 275
42 3300005295 Ga0065707_10001302 Ga0065707_100013026 276
43 3300005434 Ga0070709_10056874 Ga0070709_100568743 276
44 3300005435 Ga0070714_100102162 Ga0070714_1001021622 276
45 3300005436 Ga0070713_100227997 Ga0070713_1002279972 276
46 3300005437 Ga0070710_10025987 Ga0070710_100259872 276
47 3300005439 Ga0070711_100053234 Ga0070711_1000532342 276
48 3300006028 Ga0070717_10080300 Ga0070717_100803002 276
49 3300006175 Ga0070712_100201659 Ga0070712_1002016592 276
50 3300009092 Ga0105250_10000006 Ga0105250_10000006130 276
51 3300014968 Ga0157379_10000830 Ga0157379_100008304 276
52 3300025711 Ga0207696_1000069 Ga0207696_1000069130 276
53 3300025906 Ga0207699_10004323 Ga0207699_100043233 276
54 3300025915 Ga0207693_10024239 Ga0207693_100242395 276
55 3300025928 Ga0207700_10071401 Ga0207700_100714014 276
56 3300025929 Ga0207664_10005921 Ga0207664_100059217 276
57 3300027111 Ga0209281_1004536 Ga0209281_10045362 276
58 3300048929 Ga0496126_0015086 Ga0496126_0015086_976_1872 276
59 3300006946 Ga0079104_1000146 Ga0079104_100014670 277
60 3300015261 Ga0182006_1017283 Ga0182006_10172832 277
61 3300015261 Ga0182006_1017297 Ga0182006_10172972 277
62 3300027111 Ga0209281_1000045 Ga0209281_1000045124 277
63 3300032139 Ga0316580_10041620 Ga0316580_100416201 278
64 3300041498 Ga0451841_0883964 Ga0451841_0883964_631_1524 278
65 3300041501 Ga0451845_0381021 Ga0451845_0381021_442_1335 278
66 3300041505 Ga0451849_0418948 Ga0451849_0418948_357_1250 278
67 3300041507 Ga0451851_0575292 Ga0451851_0575292_947_1840 278
68 3300048908 Ga0496105_0028078 Ga0496105_0028078_2015_2851 278
69 3300025907 Ga0207645_10055042 Ga0207645_100550422 279
70 3300005985 Ga0081539_10045116 Ga0081539_100451162 280
71 3300009011 Ga0105251_10055930 Ga0105251_100559301 280
72 3300005347 Ga0070668_100093435 Ga0070668_1000934352 281
73 3300031733 Ga0316577_10028417 Ga0316577_100284172 282
74 3300036647 Ga0316582_0151651 Ga0316582_0151651_279_1172 282
75 3300036712 Ga0316584_0324251 Ga0316584_0324251_181_1074 282
76 3300003320 rootH2_10036006 rootH2_100360064 283
77 3300006178 Ga0075367_10283228 Ga0075367_102832281 284
78 3300005617 Ga0068859_100035474 Ga0068859_1000354744 285
79 3300006931 Ga0097620_100035474 Ga0097620_1000354744 285
80 3300013104 Ga0157370_10013827 Ga0157370_1001382710 286
81 3300053080 Ga0500635_0002767 Ga0500635_0002767_2024_2956 287
82 3300053090 Ga0500646_0047985 Ga0500646_0047985_163_1095 287
83 3300049778 Ga0501282_005616 Ga0501282_005616_161_1057 289
84 3300005355 Ga0070671_100024813 Ga0070671_1000248134 290
85 3300005366 Ga0070659_100046732 Ga0070659_1000467322 290
86 3300005455 Ga0070663_100058868 Ga0070663_1000588683 290
87 3300005616 Ga0068852_100262884 Ga0068852_1002628842 290
88 3300025932 Ga0207690_10074617 Ga0207690_100746172 290
89 3300031727 Ga0316576_10125682 Ga0316576_101256822 290
90 3300046664 Ga0495659_0029872 Ga0495659_0029872_681_1553 290
91 3300048090 Ga0495615_0055313 Ga0495615_0055313_56_943 290
92 3300050507 nmdc:mga05p37_325549_c1 nmdc:mga05p37_325549_c1_230_1114 290
93 iso_pu_bacteria 2818991441 2819570210 290
94 iso_pu_bacteria 3006969106 3006970355 290
95 3300036647 Ga0316582_0236407 Ga0316582_0236407_326_1201 291
96 3300037418 Ga0395900_0115958 Ga0395900_0115958_957_1832 291
97 iso_pu_bacteria 2519899754 2520880368 291
98 iso_pu_bacteria 2643221563 2643835659 291
99 iso_pu_bacteria 2643221608 2644056585 291
100 iso_pu_bacteria 2852653556 2852655214 291
101 iso_pu_bacteria 2857472729 2857474403 291
102 iso_pu_bacteria 2882806704 2882807950 291
103 iso_pu_bacteria 2895880812 2895882595 291
104 iso_pu_bacteria 2907202186 2907204250 291
105 iso_pu_bacteria 3006988479 3006990362 291
106 iso_pu_bacteria 8055632911 8055637247 291
107 iso_pu_bacteria 2881359912 2881361323 292
108 3300005937 Ga0081455_10086820 Ga0081455_100868203 293
109 3300006038 Ga0075365_10193734 Ga0075365_101937341 293
110 3300031995 Ga0307409_100275035 Ga0307409_1002750352 293
111 iso_pu_bacteria 2919513703 2919514161 293
112 iso_pu_bacteria 2919675420 2919676067 293
113 3300005331 Ga0070670_100088663 Ga0070670_1000886632 294
114 3300005334 Ga0068869_100104841 Ga0068869_1001048411 294
115 3300005339 Ga0070660_100098032 Ga0070660_1000980323 294
116 3300005339 Ga0070660_100214305 Ga0070660_1002143052 294
117 3300005347 Ga0070668_100008311 Ga0070668_1000083118 294
118 3300005356 Ga0070674_100130282 Ga0070674_1001302822 294
119 3300005366 Ga0070659_100089500 Ga0070659_1000895003 294
120 3300005367 Ga0070667_100144558 Ga0070667_1001445582 294
121 3300005457 Ga0070662_100027611 Ga0070662_1000276112 294
122 3300005459 Ga0068867_100060218 Ga0068867_1000602182 294
123 3300005530 Ga0070679_100148494 Ga0070679_1001484942 294
124 3300005539 Ga0068853_100026886 Ga0068853_1000268865 294
125 3300005548 Ga0070665_100056106 Ga0070665_1000561062 294
126 3300005616 Ga0068852_100183993 Ga0068852_1001839932 294
127 3300005618 Ga0068864_100116887 Ga0068864_1001168873 294
128 3300005842 Ga0068858_100585921 Ga0068858_1005859212 294
129 3300005937 Ga0081455_10042044 Ga0081455_100420447 294
130 3300006038 Ga0075365_10204591 Ga0075365_102045912 294
131 3300009093 Ga0105240_10010715 Ga0105240_100107157 294
132 3300009147 Ga0114129_10520896 Ga0114129_105208962 294
133 3300009545 Ga0105237_10013036 Ga0105237_1001303612 294
134 3300010375 Ga0105239_10000037 Ga0105239_10000037191 294
135 3300013102 Ga0157371_10008583 Ga0157371_100085837 294
136 3300013102 Ga0157371_10039729 Ga0157371_100397294 294
137 3300013102 Ga0157371_10131106 Ga0157371_101311062 294
138 3300017792 Ga0163161_10287141 Ga0163161_102871411 294
139 3300025899 Ga0207642_10246690 Ga0207642_102466901 294
140 3300025908 Ga0207643_10123129 Ga0207643_101231292 294
141 3300025913 Ga0207695_10001017 Ga0207695_100010177 294
142 3300025913 Ga0207695_10046636 Ga0207695_100466362 294
143 3300025914 Ga0207671_10004808 Ga0207671_1000480811 294
144 3300025919 Ga0207657_10085036 Ga0207657_100850363 294
145 3300025921 Ga0207652_10354277 Ga0207652_103542772 294
146 3300025923 Ga0207681_10186577 Ga0207681_101865773 294
147 3300025933 Ga0207706_10022657 Ga0207706_100226575 294
148 3300025938 Ga0207704_10030885 Ga0207704_100308851 294
149 3300025940 Ga0207691_10038037 Ga0207691_100380373 294
150 3300025940 Ga0207691_10054083 Ga0207691_100540834 294
151 3300025942 Ga0207689_10049684 Ga0207689_100496845 294
152 3300025972 Ga0207668_10000060 Ga0207668_1000006074 294
153 3300026067 Ga0207678_10008182 Ga0207678_100081825 294
154 3300026089 Ga0207648_10012777 Ga0207648_100127774 294
155 3300026116 Ga0207674_10030489 Ga0207674_100304895 294
156 3300026121 Ga0207683_10346564 Ga0207683_103465642 294
157 3300027876 Ga0209974_10014042 Ga0209974_100140422 294
158 3300031728 Ga0316578_10166068 Ga0316578_101660682 294
159 3300031731 Ga0307405_10010037 Ga0307405_100100373 294
160 3300031852 Ga0307410_10005332 Ga0307410_100053328 294
161 3300031903 Ga0307407_10001616 Ga0307407_100016168 294
162 3300031911 Ga0307412_10111294 Ga0307412_101112942 294
163 3300031911 Ga0307412_10151594 Ga0307412_101515943 294
164 3300032004 Ga0307414_10048545 Ga0307414_100485454 294
165 3300035398 Ga0316574_0035454 Ga0316574_0035454_1870_2787 294
166 3300036647 Ga0316582_0035066 Ga0316582_0035066_38_955 294
167 3300036712 Ga0316584_0080062 Ga0316584_0080062_85_969 294
168 3300036712 Ga0316584_0127517 Ga0316584_0127517_76_993 294
169 3300042125 Ga0450923_045122 Ga0450923_045122_22_921 294
170 3300044693 Ga0466961_0171589 Ga0466961_0171589_355_1254 294
171 3300044694 Ga0466963_0066008 Ga0466963_0066008_133_1032 294
172 3300044706 Ga0466964_0007088 Ga0466964_0007088_1982_2881 294
173 3300044765 Ga0466970_0042262 Ga0466970_0042262_1402_2301 294
174 3300045976 Ga0466967_0097591 Ga0466967_0097591_1681_2580 294
175 3300046528 Ga0495642_0095299 Ga0495642_0095299_53_940 294
176 3300048918 Ga0496115_0088840 Ga0496115_0088840_507_1397 294
177 3300048918 Ga0496115_0273823 Ga0496115_0273823_442_1332 294
178 3300048921 Ga0496118_0082097 Ga0496118_0082097_872_1768 294
179 3300048924 Ga0496121_0009176 Ga0496121_0009176_1588_2484 294
180 3300048929 Ga0496126_0024582 Ga0496126_0024582_504_1400 294
181 3300048929 Ga0496126_0180615 Ga0496126_0180615_593_1483 294
182 3300049570 Ga0501033_0006962 Ga0501033_0006962_1263_2147 294
183 3300049581 Ga0501047_0177112 Ga0501047_0177112_788_1672 294
184 3300049668 Ga0501233_056965 Ga0501233_056965_44_943 294
185 3300049823 Ga0501044_0006427 Ga0501044_0006427_1484_2368 294
186 3300049823 Ga0501044_0517754 Ga0501044_0517754_46_933 294
187 3300050492 nmdc:mga0yw44_105839_c1 nmdc:mga0yw44_105839_c1_317_1201 294
188 3300050496 nmdc:mga07m45_142566_c1 nmdc:mga07m45_142566_c1_440_1327 294
189 3300053139 Ga0500568_0003410 Ga0500568_0003410_7821_8732 294
190 iso_pu_bacteria 2643221600 2644012242 294
191 iso_pu_bacteria 2643221716 2644641524 294
192 iso_pu_bacteria 2643221725 2644682366 294
193 iso_pu_bacteria 2739367857 2740000475 294
194 iso_pu_bacteria 2739367858 2740005291 294
195 iso_pu_bacteria 2802428842 2802651138 294
196 iso_pu_bacteria 2816332280 2817414026 294
197 iso_pu_bacteria 2903895155 2903896569 294
198 iso_pu_bacteria 2904555929 2904557657 294
199 iso_pu_bacteria 2919191525 2919195828 294
200 iso_pu_bacteria 2958458903 2958461781 294
201 iso_pu_bacteria 2977268062 2977272549 294
202 iso_pu_bacteria 8054307821 8054310983 294
203 iso_pu_bacteria 8055419101 8055420243 294
204 3300003203 JGI25406J46586_10011250 JGI25406J46586_100112503 295
205 3300003761 Ga0055535_1009958 Ga0055535_10099581 295
206 3300003791 Ga0055530_10000095 Ga0055530_1000009566 295
207 3300003791 Ga0055530_10024324 Ga0055530_100243242 295
208 3300003794 Ga0055531_10002750 Ga0055531_100027509 295
209 3300003794 Ga0055531_10004838 Ga0055531_100048389 295
210 3300003841 Ga0055541_1004028 Ga0055541_10040282 295
211 3300005295 Ga0065707_10247678 Ga0065707_102476782 295
212 3300005328 Ga0070676_10044650 Ga0070676_100446503 295
213 3300005328 Ga0070676_10114050 Ga0070676_101140502 295
214 3300005331 Ga0070670_100036862 Ga0070670_1000368622 295
215 3300005331 Ga0070670_100069322 Ga0070670_1000693223 295
216 3300005334 Ga0068869_100009681 Ga0068869_1000096815 295
217 3300005334 Ga0068869_100070150 Ga0068869_1000701503 295
218 3300005335 Ga0070666_10021517 Ga0070666_100215174 295
219 3300005335 Ga0070666_10340433 Ga0070666_103404331 295
220 3300005336 Ga0070680_100201120 Ga0070680_1002011202 295
221 3300005337 Ga0070682_100007256 Ga0070682_1000072562 295
222 3300005338 Ga0068868_100010777 Ga0068868_1000107772 295
223 3300005339 Ga0070660_100081063 Ga0070660_1000810632 295
224 3300005340 Ga0070689_100452621 Ga0070689_1004526212 295
225 3300005341 Ga0070691_10002104 Ga0070691_100021045 295
226 3300005345 Ga0070692_10038830 Ga0070692_100388303 295
227 3300005347 Ga0070668_100025721 Ga0070668_1000257214 295
228 3300005347 Ga0070668_100043584 Ga0070668_1000435842 295
229 3300005347 Ga0070668_100115903 Ga0070668_1001159032 295
230 3300005353 Ga0070669_100054641 Ga0070669_1000546412 295
231 3300005354 Ga0070675_100013399 Ga0070675_1000133995 295
232 3300005355 Ga0070671_100007579 Ga0070671_1000075795 295
233 3300005356 Ga0070674_100046640 Ga0070674_1000466403 295
234 3300005356 Ga0070674_100159097 Ga0070674_1001590971 295
235 3300005356 Ga0070674_100236272 Ga0070674_1002362722 295
236 3300005364 Ga0070673_100134718 Ga0070673_1001347183 295
237 3300005364 Ga0070673_100174380 Ga0070673_1001743802 295
238 3300005366 Ga0070659_100061193 Ga0070659_1000611932 295
239 3300005367 Ga0070667_100022052 Ga0070667_1000220524 295
240 3300005367 Ga0070667_100049692 Ga0070667_1000496923 295
241 3300005367 Ga0070667_100163160 Ga0070667_1001631602 295
242 3300005435 Ga0070714_100047289 Ga0070714_1000472892 295
243 3300005436 Ga0070713_100000129 Ga0070713_10000012944 295
244 3300005436 Ga0070713_100011017 Ga0070713_1000110175 295
245 3300005438 Ga0070701_10018566 Ga0070701_100185664 295
246 3300005438 Ga0070701_10128777 Ga0070701_101287772 295
247 3300005440 Ga0070705_100059544 Ga0070705_1000595441 295
248 3300005441 Ga0070700_100107989 Ga0070700_1001079893 295
249 3300005445 Ga0070708_100210850 Ga0070708_1002108502 295
250 3300005455 Ga0070663_100002768 Ga0070663_1000027688 295
251 3300005455 Ga0070663_100384310 Ga0070663_1003843101 295
252 3300005456 Ga0070678_100016864 Ga0070678_1000168645 295
253 3300005456 Ga0070678_100058624 Ga0070678_1000586242 295
254 3300005456 Ga0070678_100087487 Ga0070678_1000874873 295
255 3300005458 Ga0070681_10036085 Ga0070681_100360853 295
256 3300005459 Ga0068867_100008910 Ga0068867_1000089103 295
257 3300005459 Ga0068867_100144524 Ga0068867_1001445242 295
258 3300005467 Ga0070706_100159173 Ga0070706_1001591733 295
259 3300005518 Ga0070699_100000708 Ga0070699_10000070810 295
260 3300005530 Ga0070679_100018240 Ga0070679_1000182403 295
261 3300005543 Ga0070672_100335838 Ga0070672_1003358382 295
262 3300005547 Ga0070693_100008277 Ga0070693_1000082772 295
263 3300005548 Ga0070665_100036933 Ga0070665_1000369334 295
264 3300005548 Ga0070665_100042010 Ga0070665_1000420103 295
265 3300005563 Ga0068855_100214605 Ga0068855_1002146053 295
266 3300005564 Ga0070664_100121064 Ga0070664_1001210642 295
267 3300005578 Ga0068854_100012579 Ga0068854_1000125791 295
268 3300005578 Ga0068854_100025046 Ga0068854_1000250462 295
269 3300005614 Ga0068856_100004065 Ga0068856_10000406516 295
270 3300005615 Ga0070702_100003679 Ga0070702_1000036794 295
271 3300005615 Ga0070702_100068191 Ga0070702_1000681912 295
272 3300005616 Ga0068852_100039684 Ga0068852_1000396844 295
273 3300005616 Ga0068852_100041014 Ga0068852_1000410145 295
274 3300005616 Ga0068852_100157893 Ga0068852_1001578931 295
275 3300005617 Ga0068859_100032362 Ga0068859_1000323622 295
276 3300005617 Ga0068859_100079439 Ga0068859_1000794393 295
277 3300005617 Ga0068859_100674452 Ga0068859_1006744521 295
278 3300005618 Ga0068864_100027348 Ga0068864_1000273482 295
279 3300005618 Ga0068864_100149781 Ga0068864_1001497813 295
280 3300005618 Ga0068864_100283518 Ga0068864_1002835182 295
281 3300005718 Ga0068866_10118921 Ga0068866_101189211 295
282 3300005719 Ga0068861_100003730 Ga0068861_10000373012 295
283 3300005719 Ga0068861_100095142 Ga0068861_1000951422 295
284 3300005834 Ga0068851_10009294 Ga0068851_100092942 295
285 3300005834 Ga0068851_10077806 Ga0068851_100778063 295
286 3300005840 Ga0068870_10001962 Ga0068870_100019625 295
287 3300005841 Ga0068863_100016873 Ga0068863_1000168732 295
288 3300005842 Ga0068858_100020301 Ga0068858_1000203015 295
289 3300005842 Ga0068858_100076998 Ga0068858_1000769983 295
290 3300005842 Ga0068858_100145629 Ga0068858_1001456293 295
291 3300005842 Ga0068858_100402097 Ga0068858_1004020972 295
292 3300005843 Ga0068860_100022098 Ga0068860_1000220983 295
293 3300005843 Ga0068860_100126704 Ga0068860_1001267043 295
294 3300005843 Ga0068860_100515916 Ga0068860_1005159161 295
295 3300005844 Ga0068862_100011911 Ga0068862_1000119115 295
296 3300005844 Ga0068862_100178804 Ga0068862_1001788042 295
297 3300005844 Ga0068862_100485875 Ga0068862_1004858751 295
298 3300005985 Ga0081539_10000927 Ga0081539_1000092730 295
299 3300006028 Ga0070717_10012513 Ga0070717_100125134 295
300 3300006028 Ga0070717_10070126 Ga0070717_100701262 295
301 3300006028 Ga0070717_10216537 Ga0070717_102165372 295
302 3300006028 Ga0070717_10620385 Ga0070717_106203851 295
303 3300006178 Ga0075367_10039793 Ga0075367_100397932 295
304 3300006237 Ga0097621_100014203 Ga0097621_1000142035 295
305 3300006358 Ga0068871_100022746 Ga0068871_1000227463 295
306 3300006358 Ga0068871_100043670 Ga0068871_1000436704 295
307 3300006846 Ga0075430_100335223 Ga0075430_1003352231 295
308 3300006852 Ga0075433_10011974 Ga0075433_100119745 295
309 3300006871 Ga0075434_100008016 Ga0075434_1000080163 295
310 3300006880 Ga0075429_100150497 Ga0075429_1001504972 295
311 3300006881 Ga0068865_100008038 Ga0068865_1000080383 295
312 3300006914 Ga0075436_100010195 Ga0075436_1000101955 295
313 3300006931 Ga0097620_100032362 Ga0097620_1000323625 295
314 3300006931 Ga0097620_100079438 Ga0097620_1000794383 295
315 3300006931 Ga0097620_100674499 Ga0097620_1006744991 295
316 3300006946 Ga0079104_1023901 Ga0079104_10239012 295
317 3300007076 Ga0075435_100012598 Ga0075435_1000125983 295
318 3300009093 Ga0105240_10017187 Ga0105240_100171873 295
319 3300009093 Ga0105240_10089075 Ga0105240_100890753 295
320 3300009094 Ga0111539_10307347 Ga0111539_103073473 295
321 3300009094 Ga0111539_10683653 Ga0111539_106836531 295
322 3300009098 Ga0105245_10026816 Ga0105245_100268161 295
323 3300009098 Ga0105245_10448387 Ga0105245_104483871 295
324 3300009148 Ga0105243_10034179 Ga0105243_100341793 295
325 3300009174 Ga0105241_10025396 Ga0105241_100253964 295
326 3300009174 Ga0105241_10195305 Ga0105241_101953051 295
327 3300009545 Ga0105237_10046598 Ga0105237_100465985 295
328 3300009545 Ga0105237_10209728 Ga0105237_102097281 295
329 3300009551 Ga0105238_10142509 Ga0105238_101425093 295
330 3300009553 Ga0105249_10014648 Ga0105249_100146485 295
331 3300009553 Ga0105249_10107042 Ga0105249_101070422 295
332 3300010375 Ga0105239_10111081 Ga0105239_101110811 295
333 3300010375 Ga0105239_10648910 Ga0105239_106489102 295
334 3300011119 Ga0105246_10007529 Ga0105246_100075294 295
335 3300013100 Ga0157373_10080711 Ga0157373_100807112 295
336 3300013102 Ga0157371_10165535 Ga0157371_101655352 295
337 3300013296 Ga0157374_10016721 Ga0157374_100167215 295
338 3300013296 Ga0157374_10074957 Ga0157374_100749573 295
339 3300013297 Ga0157378_10000631 Ga0157378_1000063126 295
340 3300013306 Ga0163162_10005487 Ga0163162_100054876 295
341 3300013308 Ga0157375_10108044 Ga0157375_101080443 295
342 3300013308 Ga0157375_10155169 Ga0157375_101551692 295
343 3300013308 Ga0157375_10286061 Ga0157375_102860612 295
344 3300014326 Ga0157380_10032855 Ga0157380_100328554 295
345 3300014326 Ga0157380_10078277 Ga0157380_100782772 295
346 3300014326 Ga0157380_10080884 Ga0157380_100808843 295
347 3300014745 Ga0157377_10280655 Ga0157377_102806551 295
348 3300014968 Ga0157379_10039058 Ga0157379_100390582 295
349 3300014968 Ga0157379_10253425 Ga0157379_102534252 295
350 3300014969 Ga0157376_10051232 Ga0157376_100512324 295
351 3300014969 Ga0157376_10061915 Ga0157376_100619153 295
352 3300014969 Ga0157376_10096073 Ga0157376_100960733 295
353 3300017792 Ga0163161_10511148 Ga0163161_105111481 295
354 3300020082 Ga0206353_11795824 Ga0206353_117958242 295
355 3300025225 Ga0209566_100052 Ga0209566_10005280 295
356 3300025242 Ga0209258_101156 Ga0209258_1011563 295
357 3300025291 Ga0209675_1000025 Ga0209675_1000025124 295
358 3300025292 Ga0209676_1000198 Ga0209676_100019852 295
359 3300025292 Ga0209676_1000362 Ga0209676_100036267 295
360 3300025292 Ga0209676_1003189 Ga0209676_10031897 295
361 3300025292 Ga0209676_1041396 Ga0209676_10413962 295
362 3300025294 Ga0209025_1019137 Ga0209025_10191373 295
363 3300025294 Ga0209025_1041993 Ga0209025_10419931 295
364 3300025298 Ga0209050_1000849 Ga0209050_100084925 295
365 3300025298 Ga0209050_1003508 Ga0209050_10035089 295
366 3300025304 Ga0209257_1000860 Ga0209257_10008607 295
367 3300025304 Ga0209257_1001370 Ga0209257_100137011 295
368 3300025304 Ga0209257_1003116 Ga0209257_100311619 295
369 3300025899 Ga0207642_10025189 Ga0207642_100251893 295
370 3300025900 Ga0207710_10015418 Ga0207710_100154183 295
371 3300025901 Ga0207688_10048236 Ga0207688_100482362 295
372 3300025901 Ga0207688_10066672 Ga0207688_100666723 295
373 3300025904 Ga0207647_10146562 Ga0207647_101465622 295
374 3300025904 Ga0207647_10167662 Ga0207647_101676622 295
375 3300025907 Ga0207645_10047151 Ga0207645_100471513 295
376 3300025907 Ga0207645_10094092 Ga0207645_100940922 295
377 3300025908 Ga0207643_10000594 Ga0207643_100005945 295
378 3300025913 Ga0207695_10031430 Ga0207695_100314305 295
379 3300025914 Ga0207671_10052375 Ga0207671_100523753 295
380 3300025914 Ga0207671_10091997 Ga0207671_100919972 295
381 3300025916 Ga0207663_10016077 Ga0207663_100160774 295
382 3300025917 Ga0207660_10007800 Ga0207660_100078003 295
383 3300025918 Ga0207662_10155727 Ga0207662_101557272 295
384 3300025919 Ga0207657_10022327 Ga0207657_100223272 295
385 3300025919 Ga0207657_10076906 Ga0207657_100769063 295
386 3300025920 Ga0207649_10002784 Ga0207649_100027842 295
387 3300025921 Ga0207652_10122608 Ga0207652_101226083 295
388 3300025922 Ga0207646_10001356 Ga0207646_100013565 295
389 3300025923 Ga0207681_10080936 Ga0207681_100809362 295
390 3300025924 Ga0207694_10248910 Ga0207694_102489102 295
391 3300025925 Ga0207650_10001016 Ga0207650_1000101615 295
392 3300025926 Ga0207659_10019574 Ga0207659_100195744 295
393 3300025926 Ga0207659_10236941 Ga0207659_102369412 295
394 3300025927 Ga0207687_10030832 Ga0207687_100308323 295
395 3300025928 Ga0207700_10000044 Ga0207700_1000004464 295
396 3300025928 Ga0207700_10001414 Ga0207700_1000141414 295
397 3300025929 Ga0207664_10036227 Ga0207664_100362272 295
398 3300025929 Ga0207664_10449804 Ga0207664_104498041 295
399 3300025932 Ga0207690_10194039 Ga0207690_101940392 295
400 3300025932 Ga0207690_10227839 Ga0207690_102278392 295
401 3300025933 Ga0207706_10015081 Ga0207706_100150811 295
402 3300025935 Ga0207709_10081325 Ga0207709_100813252 295
403 3300025936 Ga0207670_10051408 Ga0207670_100514082 295
404 3300025936 Ga0207670_10380867 Ga0207670_103808672 295
405 3300025937 Ga0207669_10067523 Ga0207669_100675232 295
406 3300025937 Ga0207669_10077647 Ga0207669_100776472 295
407 3300025938 Ga0207704_10190312 Ga0207704_101903122 295
408 3300025939 Ga0207665_10384990 Ga0207665_103849902 295
409 3300025940 Ga0207691_10007125 Ga0207691_100071253 295
410 3300025940 Ga0207691_10060715 Ga0207691_100607152 295
411 3300025940 Ga0207691_10120971 Ga0207691_101209712 295
412 3300025941 Ga0207711_10142554 Ga0207711_101425542 295
413 3300025942 Ga0207689_10001431 Ga0207689_100014315 295
414 3300025942 Ga0207689_10024871 Ga0207689_100248715 295
415 3300025944 Ga0207661_10003516 Ga0207661_100035163 295
416 3300025949 Ga0207667_10360925 Ga0207667_103609252 295
417 3300025960 Ga0207651_10074105 Ga0207651_100741052 295
418 3300025960 Ga0207651_10141206 Ga0207651_101412063 295
419 3300025972 Ga0207668_10007605 Ga0207668_100076052 295
420 3300025986 Ga0207658_10023664 Ga0207658_100236644 295
421 3300025986 Ga0207658_10076747 Ga0207658_100767471 295
422 3300025986 Ga0207658_10418344 Ga0207658_104183441 295
423 3300026023 Ga0207677_10072693 Ga0207677_100726932 295
424 3300026035 Ga0207703_10041853 Ga0207703_100418533 295
425 3300026035 Ga0207703_10069667 Ga0207703_100696673 295
426 3300026035 Ga0207703_10371529 Ga0207703_103715291 295
427 3300026041 Ga0207639_10109132 Ga0207639_101091322 295
428 3300026067 Ga0207678_10001818 Ga0207678_100018182 295
429 3300026067 Ga0207678_10214587 Ga0207678_102145872 295
430 3300026075 Ga0207708_10034973 Ga0207708_100349734 295
431 3300026075 Ga0207708_10053197 Ga0207708_100531973 295
432 3300026078 Ga0207702_10001992 Ga0207702_1000199213 295
433 3300026078 Ga0207702_10021932 Ga0207702_100219326 295
434 3300026088 Ga0207641_10031263 Ga0207641_100312632 295
435 3300026089 Ga0207648_10048341 Ga0207648_100483413 295
436 3300026089 Ga0207648_10111844 Ga0207648_101118443 295
437 3300026089 Ga0207648_10170115 Ga0207648_101701152 295
438 3300026095 Ga0207676_10000896 Ga0207676_100008965 295
439 3300026095 Ga0207676_10060724 Ga0207676_100607243 295
440 3300026118 Ga0207675_100015760 Ga0207675_1000157607 295
441 3300026118 Ga0207675_100039045 Ga0207675_1000390456 295
442 3300026118 Ga0207675_100450507 Ga0207675_1004505072 295
443 3300026118 Ga0207675_100594747 Ga0207675_1005947471 295
444 3300026121 Ga0207683_10001721 Ga0207683_100017215 295
445 3300026121 Ga0207683_10001789 Ga0207683_1000178913 295
446 3300026121 Ga0207683_10065769 Ga0207683_100657694 295
447 3300026121 Ga0207683_10180368 Ga0207683_101803682 295
448 3300026142 Ga0207698_10002118 Ga0207698_100021184 295
449 3300026142 Ga0207698_10026942 Ga0207698_100269423 295
450 3300027617 Ga0210002_1018120 Ga0210002_10181202 295
451 3300027682 Ga0209971_1003179 Ga0209971_10031792 295
452 3300027907 Ga0207428_10015402 Ga0207428_100154023 295
453 3300028379 Ga0268266_10028457 Ga0268266_100284572 295
454 3300028380 Ga0268265_10007031 Ga0268265_100070315 295
455 3300028381 Ga0268264_10008954 Ga0268264_100089547 295
456 3300028381 Ga0268264_10018610 Ga0268264_100186104 295
457 3300028381 Ga0268264_10086517 Ga0268264_100865172 295
458 3300028381 Ga0268264_10207103 Ga0268264_102071031 295
459 3300028573 Ga0265334_10016887 Ga0265334_100168872 295
460 3300028800 Ga0265338_10015955 Ga0265338_100159556 295
461 3300031548 Ga0307408_100438842 Ga0307408_1004388421 295
462 3300031691 Ga0316579_10005942 Ga0316579_100059424 295
463 3300031727 Ga0316576_10145717 Ga0316576_101457172 295
464 3300031728 Ga0316578_10017721 Ga0316578_100177211 295
465 3300031733 Ga0316577_10072127 Ga0316577_100721272 295
466 3300031733 Ga0316577_10122595 Ga0316577_101225952 295
467 3300031995 Ga0307409_100007763 Ga0307409_1000077637 295
468 3300032002 Ga0307416_100910466 Ga0307416_1009104661 295
469 3300032004 Ga0307414_10026665 Ga0307414_100266653 295
470 3300032004 Ga0307414_10052365 Ga0307414_100523652 295
471 3300032005 Ga0307411_10037604 Ga0307411_100376044 295
472 3300032126 Ga0307415_100057771 Ga0307415_1000577712 295
473 3300032133 Ga0316583_10030367 Ga0316583_100303672 295
474 3300032137 Ga0316585_10025747 Ga0316585_100257471 295
475 3300032139 Ga0316580_10002895 Ga0316580_100028954 295
476 3300035398 Ga0316574_0000018 Ga0316574_0000018_555_1448 295
477 3300035398 Ga0316574_0132803 Ga0316574_0132803_95_982 295
478 3300035398 Ga0316574_0241715 Ga0316574_0241715_149_1036 295
479 3300035691 Ga0373931_0039649 Ga0373931_0039649_789_1679 295
480 3300036712 Ga0316584_0034958 Ga0316584_0034958_2637_3524 295
481 3300036712 Ga0316584_0067765 Ga0316584_0067765_27_920 295
482 3300037068 Ga0373925_0019723 Ga0373925_0019723_1321_2217 295
483 3300037312 Ga0395899_0010439 Ga0395899_0010439_2563_3450 295
484 3300037312 Ga0395899_0014021 Ga0395899_0014021_4490_5377 295
485 3300037418 Ga0395900_0029177 Ga0395900_0029177_189_1076 295
486 3300037418 Ga0395900_0246709 Ga0395900_0246709_74_961 295
487 3300037466 Ga0395898_0009056 Ga0395898_0009056_8255_9142 295
488 3300037466 Ga0395898_0252324 Ga0395898_0252324_245_1132 295
489 3300037471 Ga0395905_0115294 Ga0395905_0115294_882_1769 295
490 3300037471 Ga0395905_0427804 Ga0395905_0427804_95_982 295
491 3300038443 Ga0395901_0022229 Ga0395901_0022229_2170_3057 295
492 3300038443 Ga0395901_0055805 Ga0395901_0055805_2912_3799 295
493 3300038443 Ga0395901_0083749 Ga0395901_0083749_1519_2406 295
494 3300038443 Ga0395901_0168108 Ga0395901_0168108_544_1431 295
495 3300038443 Ga0395901_0628756 Ga0395901_0628756_16_903 295
496 3300039062 Ga0400483_016889 Ga0400483_016889_6106_6999 295
497 3300039062 Ga0400483_147849 Ga0400483_147849_7076_7963 295
498 3300039062 Ga0400483_194805 Ga0400483_194805_3019_3912 295
499 3300039062 Ga0400483_203034 Ga0400483_203034_708_1595 295
500 3300039437 Ga0436365_0011767 Ga0436365_0011767_4734_5621 295
501 3300039450 Ga0436363_0917267 Ga0436363_0917267_568_1455 295
502 3300039450 Ga0436363_1703617 Ga0436363_1703617_610_1497 295
503 3300042008 Ga0439450_038040 Ga0439450_038040_168_1070 295
504 3300042010 Ga0439452_037084 Ga0439452_037084_66_953 295
505 3300042439 Ga0439464_0023228 Ga0439464_0023228_16_903 295
506 3300042439 Ga0439464_0040721 Ga0439464_0040721_168_1055 295
507 3300042461 Ga0439460_0041204 Ga0439460_0041204_194_1081 295
508 3300044673 Ga0453683_0119545 Ga0453683_0119545_721_1608 295
509 3300044684 Ga0466966_0043210 Ga0466966_0043210_282_1169 295
510 3300044712 Ga0453684_0161279 Ga0453684_0161279_1340_2227 295
511 3300045049 Ga0466959_0037588 Ga0466959_0037588_2666_3553 295
512 3300045051 Ga0451576_0000007 Ga0451576_0000007_204996_205889 295
513 3300046459 Ga0495629_0146620 Ga0495629_0146620_354_1241 295
514 3300046528 Ga0495642_0072212 Ga0495642_0072212_426_1313 295
515 3300046533 Ga0495640_0178135 Ga0495640_0178135_342_1229 295
516 3300046616 Ga0495668_0035028 Ga0495668_0035028_608_1498 295
517 3300046660 Ga0495625_0000362 Ga0495625_0000362_51225_52115 295
518 3300046663 Ga0495635_0170574 Ga0495635_0170574_541_1428 295
519 3300046683 Ga0495658_0160091 Ga0495658_0160091_32_919 295
520 3300047471 Ga0495684_0024548 Ga0495684_0024548_3020_3907 295
521 3300048903 Ga0496100_0234764 Ga0496100_0234764_415_1302 295
522 3300048905 Ga0496102_0161621 Ga0496102_0161621_217_1104 295
523 3300048907 Ga0496104_0014412 Ga0496104_0014412_1251_2147 295
524 3300048908 Ga0496105_0006061 Ga0496105_0006061_4550_5446 295
525 3300048909 Ga0496106_0009636 Ga0496106_0009636_3939_4835 295
526 3300048910 Ga0496107_0003209 Ga0496107_0003209_519_1415 295
527 3300048912 Ga0496109_0047196 Ga0496109_0047196_186_1082 295
528 3300048913 Ga0496110_0017616 Ga0496110_0017616_3892_4788 295
529 3300048913 Ga0496110_0270079 Ga0496110_0270079_553_1440 295
530 3300048914 Ga0496111_0001084 Ga0496111_0001084_4371_5267 295
531 3300048916 Ga0496113_0004957 Ga0496113_0004957_2834_3730 295
532 3300048917 Ga0496114_0021201 Ga0496114_0021201_2533_3420 295
533 3300048918 Ga0496115_0024228 Ga0496115_0024228_3350_4237 295
534 3300048918 Ga0496115_0177399 Ga0496115_0177399_675_1562 295
535 3300048918 Ga0496115_0391865 Ga0496115_0391865_45_941 295
536 3300048926 Ga0496123_0128533 Ga0496123_0128533_495_1382 295
537 3300049571 Ga0501034_0002561 Ga0501034_0002561_7853_8743 295
538 3300049571 Ga0501034_0318569 Ga0501034_0318569_410_1297 295
539 3300049572 Ga0501036_0395699 Ga0501036_0395699_73_984 295
540 3300049778 Ga0501282_006148 Ga0501282_006148_250_1140 295
541 3300050491 nmdc:mga00v17_48861_c1 nmdc:mga00v17_48861_c1_1425_2312 295
542 3300050494 nmdc:mga06z11_29810_c1 nmdc:mga06z11_29810_c1_946_1833 295
543 3300050508 nmdc:mga09592_223429_c1 nmdc:mga09592_223429_c1_77_964 295
544 3300050511 nmdc:mga08y16_528942_c1 nmdc:mga08y16_528942_c1_183_1073 295
545 3300050512 nmdc:mga0n895_19450_c1 nmdc:mga0n895_19450_c1_1178_2074 295
546 3300050513 nmdc:mga0rr50_6191_c1 nmdc:mga0rr50_6191_c1_2706_3602 295
547 3300050514 nmdc:mga08x19_76538_c1 nmdc:mga08x19_76538_c1_144_1040 295
548 3300050515 nmdc:mga0a205_601820_c1 nmdc:mga0a205_601820_c1_51_938 295
549 3300053085 Ga0495619_0126831 Ga0495619_0126831_825_1712 295
550 3300053139 Ga0500568_0000724 Ga0500568_0000724_15581_16471 295
551 3300054114 Ga0501084_0000216 Ga0501084_0000216_6162_7049 295
552 3300005293 Ga0065715_10113248 Ga0065715_101132483 296
553 3300005331 Ga0070670_100016454 Ga0070670_1000164546 296
554 3300005347 Ga0070668_100009156 Ga0070668_1000091567 296
555 3300005353 Ga0070669_100063261 Ga0070669_1000632613 296
556 3300005355 Ga0070671_100025962 Ga0070671_1000259624 296
557 3300005356 Ga0070674_100003696 Ga0070674_1000036967 296
558 3300005364 Ga0070673_100276634 Ga0070673_1002766343 296
559 3300005366 Ga0070659_100180024 Ga0070659_1001800242 296
560 3300005457 Ga0070662_100032993 Ga0070662_1000329933 296
561 3300005459 Ga0068867_100130818 Ga0068867_1001308181 296
562 3300005543 Ga0070672_100003611 Ga0070672_1000036114 296
563 3300005617 Ga0068859_100025822 Ga0068859_1000258226 296
564 3300005618 Ga0068864_100095074 Ga0068864_1000950743 296
565 3300005844 Ga0068862_100008255 Ga0068862_1000082554 296
566 3300006844 Ga0075428_100261056 Ga0075428_1002610562 296
567 3300006847 Ga0075431_100036988 Ga0075431_1000369883 296
568 3300006931 Ga0097620_100025822 Ga0097620_1000258226 296
569 3300009177 Ga0105248_10218452 Ga0105248_102184522 296
570 3300009553 Ga0105249_10259151 Ga0105249_102591512 296
571 3300013105 Ga0157369_10050251 Ga0157369_100502512 296
572 3300014326 Ga0157380_10002279 Ga0157380_1000227911 296
573 3300014326 Ga0157380_10008389 Ga0157380_100083894 296
574 3300014326 Ga0157380_10033683 Ga0157380_100336833 296
575 3300025315 Ga0207697_10004336 Ga0207697_100043367 296
576 3300025893 Ga0207682_10002137 Ga0207682_100021372 296
577 3300025923 Ga0207681_10012027 Ga0207681_100120274 296
578 3300025925 Ga0207650_10001564 Ga0207650_1000156417 296
579 3300025925 Ga0207650_10003470 Ga0207650_1000347012 296
580 3300025926 Ga0207659_10002573 Ga0207659_1000257311 296
581 3300025931 Ga0207644_10089931 Ga0207644_100899312 296
582 3300025933 Ga0207706_10006526 Ga0207706_1000652612 296
583 3300025937 Ga0207669_10007588 Ga0207669_100075885 296
584 3300025940 Ga0207691_10003262 Ga0207691_100032627 296
585 3300025945 Ga0207679_10043675 Ga0207679_100436753 296
586 3300025960 Ga0207651_10401937 Ga0207651_104019372 296
587 3300025972 Ga0207668_10050245 Ga0207668_100502453 296
588 3300025972 Ga0207668_10092305 Ga0207668_100923053 296
589 3300025986 Ga0207658_10041264 Ga0207658_100412643 296
590 3300026023 Ga0207677_10551133 Ga0207677_105511331 296
591 3300026075 Ga0207708_10127160 Ga0207708_101271602 296
592 3300026089 Ga0207648_10017845 Ga0207648_100178457 296
593 3300026095 Ga0207676_10112461 Ga0207676_101124611 296
594 3300028380 Ga0268265_10050752 Ga0268265_100507524 296
595 3300028381 Ga0268264_10095159 Ga0268264_100951592 296
596 3300031665 Ga0316575_10076015 Ga0316575_100760152 296
597 3300031727 Ga0316576_10087355 Ga0316576_100873552 296
598 3300031824 Ga0307413_10014744 Ga0307413_100147443 296
599 3300031852 Ga0307410_10009576 Ga0307410_100095762 296
600 3300031901 Ga0307406_10030734 Ga0307406_100307344 296
601 3300031995 Ga0307409_100078235 Ga0307409_1000782352 296
602 3300031995 Ga0307409_100089516 Ga0307409_1000895162 296
603 3300032126 Ga0307415_100150460 Ga0307415_1001504603 296
604 3300035398 Ga0316574_0006270 Ga0316574_0006270_3443_4333 296
605 3300035398 Ga0316574_0030139 Ga0316574_0030139_1604_2494 296
606 3300036712 Ga0316584_0095372 Ga0316584_0095372_179_1069 296
607 3300038742 Ga0400486_08083 Ga0400486_08083_4563_5453 296
608 3300042004 Ga0439445_0000682 Ga0439445_0000682_1192_2115 296
609 3300046539 Ga0495621_0005070 Ga0495621_0005070_620_1528 296
610 3300046558 Ga0495633_0079868 Ga0495633_0079868_367_1275 296
611 3300046691 Ga0495670_0090065 Ga0495670_0090065_348_1256 296
612 3300046691 Ga0495670_0190264 Ga0495670_0190264_33_941 296
613 3300046809 Ga0495600_0013633 Ga0495600_0013633_3807_4718 296
614 3300048924 Ga0496121_0035138 Ga0496121_0035138_1593_2483 296
615 3300049571 Ga0501034_0308997 Ga0501034_0308997_209_1099 296
616 3300050510 nmdc:mga06r32_6485_c1 nmdc:mga06r32_6485_c1_9064_9978 296
617 iso_pu_bacteria 2643221667 2644374455 296
618 iso_pu_bacteria 2738541279 2738735933 296
619 iso_pu_bacteria 2738541285 2738768510 296
620 iso_pu_bacteria 2738543007 2739217515 296
621 iso_pu_bacteria 2857613821 2857616246 296
622 2162886007 SwRhRL2b_contig_1200904 SwRhRL2b_0118.00002930 297
623 3300005290 Ga0065712_10034659 Ga0065712_100346591 297
624 3300005328 Ga0070676_10046627 Ga0070676_100466273 297
625 3300005330 Ga0070690_100072792 Ga0070690_1000727922 297
626 3300005330 Ga0070690_100290753 Ga0070690_1002907531 297
627 3300005331 Ga0070670_100002372 Ga0070670_10000237214 297
628 3300005331 Ga0070670_100404492 Ga0070670_1004044921 297
629 3300005335 Ga0070666_10038577 Ga0070666_100385772 297
630 3300005338 Ga0068868_100010385 Ga0068868_1000103852 297
631 3300005338 Ga0068868_100053432 Ga0068868_1000534322 297
632 3300005340 Ga0070689_100224106 Ga0070689_1002241062 297
633 3300005343 Ga0070687_100155325 Ga0070687_1001553252 297
634 3300005347 Ga0070668_100185480 Ga0070668_1001854802 297
635 3300005354 Ga0070675_100018757 Ga0070675_1000187571 297
636 3300005355 Ga0070671_100023116 Ga0070671_1000231163 297
637 3300005364 Ga0070673_100051077 Ga0070673_1000510771 297
638 3300005364 Ga0070673_100282809 Ga0070673_1002828092 297
639 3300005444 Ga0070694_100023303 Ga0070694_1000233032 297
640 3300005456 Ga0070678_100099566 Ga0070678_1000995662 297
641 3300005456 Ga0070678_100188719 Ga0070678_1001887192 297
642 3300005466 Ga0070685_10059630 Ga0070685_100596302 297
643 3300005530 Ga0070679_100240896 Ga0070679_1002408962 297
644 3300005535 Ga0070684_100059898 Ga0070684_1000598983 297
645 3300005544 Ga0070686_100189910 Ga0070686_1001899102 297
646 3300005548 Ga0070665_100233743 Ga0070665_1002337432 297
647 3300005549 Ga0070704_100010008 Ga0070704_1000100083 297
648 3300005563 Ga0068855_100104113 Ga0068855_1001041132 297
649 3300005564 Ga0070664_100004030 Ga0070664_1000040304 297
650 3300005615 Ga0070702_100031295 Ga0070702_1000312952 297
651 3300005617 Ga0068859_100042445 Ga0068859_1000424452 297
652 3300005618 Ga0068864_100122909 Ga0068864_1001229093 297
653 3300005719 Ga0068861_100127650 Ga0068861_1001276502 297
654 3300005719 Ga0068861_100220865 Ga0068861_1002208652 297
655 3300005834 Ga0068851_10081757 Ga0068851_100817572 297
656 3300005840 Ga0068870_10051449 Ga0068870_100514492 297
657 3300005840 Ga0068870_10192874 Ga0068870_101928741 297
658 3300005841 Ga0068863_100003730 Ga0068863_1000037306 297
659 3300005841 Ga0068863_100087307 Ga0068863_1000873072 297
660 3300005842 Ga0068858_100010789 Ga0068858_1000107893 297
661 3300005842 Ga0068858_100211914 Ga0068858_1002119142 297
662 3300005844 Ga0068862_100030190 Ga0068862_1000301901 297
663 3300005844 Ga0068862_100174977 Ga0068862_1001749772 297
664 3300006237 Ga0097621_100349621 Ga0097621_1003496211 297
665 3300006358 Ga0068871_100031530 Ga0068871_1000315303 297
666 3300006358 Ga0068871_100075727 Ga0068871_1000757272 297
667 3300006358 Ga0068871_100275157 Ga0068871_1002751572 297
668 3300006844 Ga0075428_100190255 Ga0075428_1001902551 297
669 3300006846 Ga0075430_100075967 Ga0075430_1000759672 297
670 3300006846 Ga0075430_100131372 Ga0075430_1001313722 297
671 3300006847 Ga0075431_100072856 Ga0075431_1000728564 297
672 3300006847 Ga0075431_100154691 Ga0075431_1001546912 297
673 3300006880 Ga0075429_100185014 Ga0075429_1001850142 297
674 3300006931 Ga0097620_100042445 Ga0097620_1000424452 297
675 3300006942 Ga0099824_1007872 Ga0099824_100787213 297
676 3300006948 Ga0099826_10005057 Ga0099826_100050572 297
677 3300009094 Ga0111539_10057862 Ga0111539_100578622 297
678 3300009094 Ga0111539_10071416 Ga0111539_100714165 297
679 3300009094 Ga0111539_10120566 Ga0111539_101205663 297
680 3300009094 Ga0111539_10336516 Ga0111539_103365162 297
681 3300009098 Ga0105245_10008219 Ga0105245_100082196 297
682 3300009098 Ga0105245_10327570 Ga0105245_103275702 297
683 3300009101 Ga0105247_10004007 Ga0105247_100040077 297
684 3300009101 Ga0105247_10148587 Ga0105247_101485871 297
685 3300009147 Ga0114129_10069834 Ga0114129_100698342 297
686 3300009174 Ga0105241_10104068 Ga0105241_101040682 297
687 3300009176 Ga0105242_10088775 Ga0105242_100887752 297
688 3300009177 Ga0105248_10016488 Ga0105248_100164885 297
689 3300009177 Ga0105248_10113758 Ga0105248_101137583 297
690 3300009551 Ga0105238_10067892 Ga0105238_100678922 297
691 3300010375 Ga0105239_10056407 Ga0105239_100564073 297
692 3300013100 Ga0157373_10000023 Ga0157373_1000002325 297
693 3300013296 Ga0157374_10002677 Ga0157374_1000267713 297
694 3300013296 Ga0157374_10054267 Ga0157374_100542674 297
695 3300013296 Ga0157374_10375497 Ga0157374_103754972 297
696 3300013297 Ga0157378_10074921 Ga0157378_100749213 297
697 3300013308 Ga0157375_10019639 Ga0157375_100196392 297
698 3300014325 Ga0163163_10007534 Ga0163163_100075347 297
699 3300014326 Ga0157380_10002142 Ga0157380_1000214212 297
700 3300014326 Ga0157380_10116787 Ga0157380_101167872 297
701 3300014745 Ga0157377_10097218 Ga0157377_100972182 297
702 3300014968 Ga0157379_10181531 Ga0157379_101815312 297
703 3300014969 Ga0157376_10320753 Ga0157376_103207532 297
704 3300015261 Ga0182006_1002701 Ga0182006_10027014 297
705 3300025229 Ga0209147_103612 Ga0209147_1036122 297
706 3300025728 Ga0207655_1000003 Ga0207655_1000003141 297
707 3300025893 Ga0207682_10015311 Ga0207682_100153113 297
708 3300025899 Ga0207642_10031370 Ga0207642_100313702 297
709 3300025901 Ga0207688_10032338 Ga0207688_100323384 297
710 3300025903 Ga0207680_10030105 Ga0207680_100301052 297
711 3300025907 Ga0207645_10119781 Ga0207645_101197812 297
712 3300025908 Ga0207643_10046706 Ga0207643_100467063 297
713 3300025911 Ga0207654_10134043 Ga0207654_101340432 297
714 3300025913 Ga0207695_10109233 Ga0207695_101092333 297
715 3300025917 Ga0207660_10028542 Ga0207660_100285422 297
716 3300025923 Ga0207681_10045203 Ga0207681_100452032 297
717 3300025925 Ga0207650_10040514 Ga0207650_100405142 297
718 3300025931 Ga0207644_10003507 Ga0207644_100035072 297
719 3300025933 Ga0207706_10261322 Ga0207706_102613222 297
720 3300025935 Ga0207709_10052850 Ga0207709_100528502 297
721 3300025935 Ga0207709_10149120 Ga0207709_101491202 297
722 3300025936 Ga0207670_10157127 Ga0207670_101571272 297
723 3300025937 Ga0207669_10517847 Ga0207669_105178471 297
724 3300025940 Ga0207691_10136420 Ga0207691_101364202 297
725 3300025941 Ga0207711_10005883 Ga0207711_100058833 297
726 3300025941 Ga0207711_10092518 Ga0207711_100925183 297
727 3300025944 Ga0207661_10080148 Ga0207661_100801482 297
728 3300025960 Ga0207651_10075588 Ga0207651_100755881 297
729 3300026023 Ga0207677_10094007 Ga0207677_100940072 297
730 3300026035 Ga0207703_10012833 Ga0207703_100128333 297
731 3300026075 Ga0207708_10006356 Ga0207708_100063562 297
732 3300026088 Ga0207641_10010191 Ga0207641_100101916 297
733 3300026088 Ga0207641_10041337 Ga0207641_100413374 297
734 3300026089 Ga0207648_10077587 Ga0207648_100775872 297
735 3300026089 Ga0207648_10118701 Ga0207648_101187012 297
736 3300026095 Ga0207676_10005522 Ga0207676_100055227 297
737 3300026095 Ga0207676_10104749 Ga0207676_101047492 297
738 3300026118 Ga0207675_100023333 Ga0207675_1000233337 297
739 3300026118 Ga0207675_100086921 Ga0207675_1000869212 297
740 3300026121 Ga0207683_10163499 Ga0207683_101634992 297
741 3300026142 Ga0207698_10062486 Ga0207698_100624862 297
742 3300027361 Ga0209489_108520 Ga0209489_10852012 297
743 3300027695 Ga0209966_1005269 Ga0209966_10052692 297
744 3300027876 Ga0209974_10056085 Ga0209974_100560851 297
745 3300027907 Ga0207428_10214012 Ga0207428_102140122 297
746 3300028379 Ga0268266_10208928 Ga0268266_102089282 297
747 3300028381 Ga0268264_10282555 Ga0268264_102825552 297
748 3300028577 Ga0265318_10011555 Ga0265318_100115552 297
749 3300031235 Ga0265330_10030331 Ga0265330_100303312 297
750 3300031238 Ga0265332_10014637 Ga0265332_100146373 297
751 3300031247 Ga0265340_10092203 Ga0265340_100922032 297
752 3300031250 Ga0265331_10008258 Ga0265331_100082583 297
753 3300031344 Ga0265316_10018778 Ga0265316_100187785 297
754 3300031548 Ga0307408_100000475 Ga0307408_1000004755 297
755 3300031548 Ga0307408_100163213 Ga0307408_1001632131 297
756 3300031548 Ga0307408_100404560 Ga0307408_1004045601 297
757 3300031711 Ga0265314_10000595 Ga0265314_1000059537 297
758 3300031712 Ga0265342_10051906 Ga0265342_100519062 297
759 3300031727 Ga0316576_10004148 Ga0316576_100041485 297
760 3300031824 Ga0307413_10201004 Ga0307413_102010042 297
761 3300031852 Ga0307410_10018238 Ga0307410_100182383 297
762 3300031852 Ga0307410_10020706 Ga0307410_100207063 297
763 3300031901 Ga0307406_10000062 Ga0307406_1000006241 297
764 3300031903 Ga0307407_10000440 Ga0307407_1000044012 297
765 3300031903 Ga0307407_10043850 Ga0307407_100438502 297
766 3300032002 Ga0307416_100000394 Ga0307416_1000003942 297
767 3300032002 Ga0307416_100008628 Ga0307416_1000086283 297
768 3300032004 Ga0307414_10000027 Ga0307414_10000027122 297
769 3300032005 Ga0307411_10217284 Ga0307411_102172842 297
770 3300033541 Ga0316596_1027287 Ga0316596_10272871 297
771 3300035172 Ga0373955_0107256 Ga0373955_0107256_182_1138 297
772 3300035398 Ga0316574_0031913 Ga0316574_0031913_1967_2860 297
773 3300035398 Ga0316574_0033376 Ga0316574_0033376_277_1170 297
774 3300035724 Ga0373933_0015401 Ga0373933_0015401_1039_1995 297
775 3300036401 Ga0373937_0067615 Ga0373937_0067615_548_1462 297
776 3300036647 Ga0316582_0043967 Ga0316582_0043967_287_1180 297
777 3300036712 Ga0316584_0320366 Ga0316584_0320366_125_1018 297
778 3300039437 Ga0436365_0608669 Ga0436365_0608669_30_980 297
779 3300042438 Ga0439459_0021161 Ga0439459_0021161_195_1088 297
780 3300044673 Ga0453683_0153970 Ga0453683_0153970_511_1431 297
781 3300045051 Ga0451576_0758093 Ga0451576_0758093_23_916 297
782 3300046455 Ga0495603_0059340 Ga0495603_0059340_605_1498 297
783 3300046459 Ga0495629_0345730 Ga0495629_0345730_87_980 297
784 3300046514 Ga0495618_0159939 Ga0495618_0159939_34_927 297
785 3300046517 Ga0495630_0373600 Ga0495630_0373600_157_1050 297
786 3300046535 Ga0495586_0251815 Ga0495586_0251815_41_934 297
787 3300046683 Ga0495658_0056293 Ga0495658_0056293_216_1109 297
788 3300048907 Ga0496104_0046317 Ga0496104_0046317_2093_2986 297
789 3300048911 Ga0496108_0037240 Ga0496108_0037240_1655_2548 297
790 3300048913 Ga0496110_0199281 Ga0496110_0199281_121_1089 297
791 3300048915 Ga0496112_0009721 Ga0496112_0009721_1224_2117 297
792 3300048916 Ga0496113_0056701 Ga0496113_0056701_948_1841 297
793 3300048917 Ga0496114_0003135 Ga0496114_0003135_2098_2991 297
794 3300048929 Ga0496126_0000123 Ga0496126_0000123_157120_158016 297
795 3300048929 Ga0496126_0055530 Ga0496126_0055530_2624_3526 297
796 3300049576 Ga0501040_0048797 Ga0501040_0048797_1253_2146 297
797 3300049586 Ga0501070_0111884 Ga0501070_0111884_964_1920 297
798 3300049588 Ga0501072_0306719 Ga0501072_0306719_319_1212 297
799 3300049588 Ga0501072_0414436 Ga0501072_0414436_144_1037 297
800 3300049671 Ga0501238_000149 Ga0501238_000149_8654_9556 297
801 3300049758 Ga0501241_016649 Ga0501241_016649_362_1264 297
802 3300049766 Ga0501269_001740 Ga0501269_001740_591_1493 297
803 3300049776 Ga0501280_000708 Ga0501280_000708_3865_4767 297
804 3300050508 nmdc:mga09592_36737_c1 nmdc:mga09592_36737_c1_1700_2593 297
805 3300050509 nmdc:mga0qj67_63704_c1 nmdc:mga0qj67_63704_c1_1117_2064 297
806 3300050510 nmdc:mga06r32_71459_c1 nmdc:mga06r32_71459_c1_2396_3298 297
807 3300050511 nmdc:mga08y16_158678_c1 nmdc:mga08y16_158678_c1_728_1642 297
808 3300050511 nmdc:mga08y16_80191_c1 nmdc:mga08y16_80191_c1_1221_2114 297
809 3300050515 nmdc:mga0a205_361699_c1 nmdc:mga0a205_361699_c1_404_1297 297
810 3300053077 Ga0495601_0019377 Ga0495601_0019377_953_1846 297
811 3300053096 Ga0500641_0017281 Ga0500641_0017281_1679_2572 297
812 3300053726 Ga0500584_009662 Ga0500584_009662_2703_3605 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00274

Glycolytic

Fructose-bisphosphate aldolase class-I

45

265

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.988 4 297
2iqt-assembly1.cif.gz_A-2 crystal structure of fructose-bisphosphate aldolase, class i from porphyromonas gingivalis 0.9747 4 297
7efs-assembly1.cif.gz_B fructose-bisphosphate aldolase in artemisia sieversiana pollen 0.8177 1 294
7b2n-assembly1.cif.gz_B crystal structure of chlamydomonas reinhardtii chloroplastic fructose bisphosphate aldolase 0.817 4 294
6xmh-assembly1.cif.gz_B-2 human aldolase a wild type 0.8165 1 294
ID Description Score Start End Superfamily
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.998 5 297 3.20.20.70
af_Q2FV17_1_294_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9879 5 297 3.20.20.70
af_A0A1D6JVQ3_1_141_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8591 11 142 3.20.20.70
af_A0A1D6FD79_26_183_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8297 4 140 3.20.20.70
3mbdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.817 4 294 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A432GXV0-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 1.005 236 297 GO:0004332
AF-A0A7X8K759-F1-model_v4 Class I fructose-bisphosphate aldolase (EC 4.1.2.13) 1.003 239 295 GO:0004332
AF-A0A645JEX5-F1-model_v4 Fructose-bisphosphate aldolase class 1 (EC 4.1.2.13) 1.002 215 297 GO:0004332
AF-A0A2V9RUV5-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) 1 5 197 GO:0004332
GO:0006096
AF-A0A509Y451-F1-model_v4 deleted 0.9998 213 297

Feature Viewer

pLDDT pTM Quality
96.43 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map