F481897

General Info

Members Datasets Scaffolds Average Seq Length
812 620 1624 296

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0210545|Ga0436364_0210545_377_1315
Length 312
Sequence MIDAIARTDQEISEVAAELEAAGPRLIDRPERLSWDSRLRTTITVYIPLAIFVIVLLFPFYWMAITAIKPDYEMYDYKTYNPFWVHSPTLHNIEVLLLQTNYPRWLMITMGIAVAATFLSVGSSVLAAYAIERLRFRGAEHAGLLIYLAYLVPPSILFIPLATLIYQFGLFDNPVALILTYPTFLVPFCTWLLIGYFKSIPYELEECALIDGASRLQILRRITLPLAVPGLISAGIFAFTLSWNEFIYALAFIQSTDRKTVPVAILTELVTGDVYQWGALMAGSLLGSIPVALIYSFFVEYYVSSMTGAVKE

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
76 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
77 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
163 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
164 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
165 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
268 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
269 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
272 2508501050 Microvirga lupini Lut6 Isolate Nodule
273 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
274 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
275 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
276 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
277 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
278 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
279 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
280 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
281 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
282 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
283 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
284 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
285 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
286 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
287 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
288 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
289 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
290 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
291 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
292 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
293 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
294 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
295 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
296 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
297 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
298 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
299 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
300 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
301 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
302 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
303 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
304 2643221558 Rhizobium sp. Root149 Isolate Unclassified
305 2643221733 Bosea sp. Root381 Isolate Unclassified
306 2643221736 Bosea sp. Root483D1 Isolate Unclassified
307 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
308 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
309 2718217882 Rhizobium sp. N741 Isolate Nodule
310 2718217927 Rhizobium sp. N324 Isolate Nodule
311 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
312 2718218009 Rhizobium sp. N561 Isolate Nodule
313 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
314 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
315 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
316 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
317 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
318 2718218363 Rhizobium sp. N113 Isolate Nodule
319 2718218365 Rhizobium sp. N731 Isolate Nodule
320 2718218366 Rhizobium sp. N621 Isolate Nodule
321 2718218423 Rhizobium sp. N941 Isolate Nodule
322 2721755514 Rhizobium sp. N6212 Isolate Nodule
323 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
324 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
325 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
326 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
327 2721755809 Rhizobium sp. N541 Isolate Nodule
328 2721755810 Rhizobium sp. N871 Isolate Nodule
329 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
330 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
331 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
332 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
333 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
334 2728369365 Rhizobium sp. N1341 Isolate Nodule
335 2728369397 Rhizobium sp. N1314 Isolate Nodule
336 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
337 2751185800 Brucella pituitosa AA2 Isolate Unclassified
338 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
339 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
340 2791355256 Rhizobium sp. M10 Isolate Nodule
341 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
342 2791355260 Rhizobium sp. L9 Isolate Nodule
343 2791355261 Rhizobium sp. J15 Isolate Nodule
344 2791355262 Rhizobium sp. M1 Isolate Nodule
345 2791355263 Rhizobium chutanense C5 Isolate Nodule
346 2791355264 Rhizobium sp. S9 Isolate Nodule
347 2791355265 Rhizobium sp. H4 Isolate Nodule
348 2791355266 Rhizobium sp. L43 Isolate Nodule
349 2791355267 Rhizobium sp. L18 Isolate Nodule
350 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
351 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
352 2802429633 Rhizobium anhuiense J3 Isolate Nodule
353 2802429634 Rhizobium anhuiense S10 Isolate Nodule
354 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
355 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
356 2802429637 Rhizobium anhuiense C15 Isolate Nodule
357 2818991467 Bosea vestrisii 3192 Isolate Unclassified
358 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
359 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
360 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
361 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
362 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
363 2838048938 Rhizobium pisi 27/80 Isolate Nodule
364 2838061910 Rhizobium phaseoli L15 Isolate Nodule
365 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
366 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
367 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
368 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
369 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
370 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
371 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
372 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
373 2841760612 Bosea sp. Tri-49 Isolate Nodule
374 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
375 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
376 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
377 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
378 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
379 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
380 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
381 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
382 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
383 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
384 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
385 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
386 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
387 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
388 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
389 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
390 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
391 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
392 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
393 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
394 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
395 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
396 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
397 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
398 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
399 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
400 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
401 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
402 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
403 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
404 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
405 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
406 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
407 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
408 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
409 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
410 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
411 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
412 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
413 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
414 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
415 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
416 2842694124 Methylopila sp. R-72369 Isolate Unclassified
417 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
418 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
419 2844104063 Bosea sp. Tri-39 Isolate Nodule
420 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
421 2851182111 Bosea sp. Tri-44 Isolate Nodule
422 2851246043 Bosea sp. Tri-54 Isolate Nodule
423 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
424 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
425 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
426 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
427 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
428 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
429 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
430 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
431 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
432 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
433 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
434 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
435 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
436 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
437 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
438 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
439 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
440 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
441 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
442 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
443 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
444 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
445 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
446 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
447 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
448 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
449 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
450 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
451 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
452 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
453 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
454 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
455 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
456 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
457 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
458 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
459 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
460 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
461 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
462 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
463 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
464 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
465 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
466 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
467 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
468 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
469 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
470 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
471 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
472 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
473 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
474 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
475 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
476 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
477 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
478 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
479 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
480 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
481 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
482 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
483 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
484 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
485 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
486 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
487 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
488 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
489 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
490 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
491 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
492 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
493 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
494 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
495 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
496 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
497 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
498 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
499 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
500 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
501 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
502 2933599457 Rhizobium phaseoli M3 Isolate Nodule
503 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
504 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
505 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
506 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
507 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
508 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
509 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
510 2936381700 Rhizobium chutanense C16 Isolate Unclassified
511 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
512 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
513 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
514 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
515 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
516 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
517 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
518 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
519 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
520 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
521 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
522 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
523 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
524 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
525 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
526 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
527 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
528 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
529 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
530 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
531 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
532 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
533 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
534 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
535 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
536 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
537 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
538 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
539 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
540 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
541 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
542 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
543 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
544 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
545 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
546 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
547 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
548 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
549 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
550 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
551 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
552 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
553 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
554 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
555 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
556 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
557 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
558 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
559 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
560 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
561 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
562 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
563 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
564 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
565 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
566 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
567 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
568 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
569 2996893221 Rhizobium sp. R635 Isolate Nodule
570 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
571 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
572 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
573 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
574 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
575 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
576 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
577 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
578 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
579 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
580 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
581 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
582 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
583 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
584 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
585 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
586 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
587 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
588 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
589 8005275841 Rhizobium sp. N4311 Isolate Nodule
590 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
591 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
592 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
593 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
594 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
595 8005382845 Rhizobium sp. R634 Isolate Nodule
596 8005395548 Rhizobium sp. R339 Isolate Nodule
597 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
598 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
599 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
600 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
601 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
602 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
603 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
604 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
605 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
606 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
607 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
608 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
609 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
610 8018176218 Rhizobium sp. N122 Isolate Nodule
611 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
612 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
613 8024501048 Rhizobium sp. H4 Isolate Nodule
614 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
615 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
616 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
617 8056382006 Rhizobium croatiense 13T Isolate Nodule
618 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
619 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
620 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.16
Metatranscriptomes 0.25
Isolates 43.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 38.3
Rhizoplane 1.6
Rhizosphere 33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0210545 3300037853 Bacteria 2008
2 JGI25158J39367_1000448 3300002739 Bacteria 8533
3 JGI25152J39213_1005931 3300002773 Bacteria 3437
4 JGI25159J45721_1004075 3300002987 Bacteria 4958
5 JGI25159J45721_1008482 3300002987 Bacteria 2818
6 JGI25151J46595_10000458 3300003187 Bacteria 39262
7 JGI25151J46595_10000508 3300003187 Bacteria 36520
8 JGI25406J46586_10000433 3300003203 Bacteria 19355
9 JGI25153J46596_10002535 3300003215 Bacteria 10466
10 JGI25153J46596_10010647 3300003215 Bacteria 4140
11 JGI25153J46596_10014909 3300003215 Bacteria 3199
12 JGI25160J50197_1003716 3300003354 Bacteria 6735
13 JGI25160J50197_1040511 3300003354 Bacteria 1079
14 JGI25161J50226_1000075 3300003374 Bacteria 84775
15 JGI25161J50226_1006294 3300003374 Bacteria 2167
16 JGI25404J52841_10000339 3300003659 Bacteria 6235
17 JGI25404J52841_10016648 3300003659 Bacteria 1595
18 Ga0055542_1003894 3300003762 Bacteria 3838
19 Ga0055526_1000017 3300003771 Bacteria 210613
20 Ga0055526_1005597 3300003771 Bacteria 7157
21 Ga0055526_1024737 3300003771 Bacteria 1951
22 Ga0055524_1000014 3300003775 Bacteria 259417
23 Ga0055524_1010792 3300003775 Bacteria 3614
24 Ga0055528_1000054 3300003790 Bacteria 90334
25 Ga0055528_1002349 3300003790 Bacteria 10235
26 Ga0055540_1000255 3300003792 Bacteria 48177
27 Ga0055540_1025147 3300003792 Bacteria 1464
28 Ga0055531_10016286 3300003794 Bacteria 3216
29 Ga0055531_10046365 3300003794 Bacteria 1195
30 Ga0055543_1000096 3300004625 Bacteria 75972
31 Ga0055543_1000578 3300004625 Bacteria 20193
32 Ga0055543_1008108 3300004625 Bacteria 2356
33 Ga0058862_12352147 3300004803 Bacteria 1728
34 Ga0065165_1000231 3300005262 Bacteria 97237
35 Ga0065165_1007353 3300005262 Bacteria 5443
36 Ga0065165_1011236 3300005262 Bacteria 3763
37 Ga0065715_10161723 3300005293 Bacteria 1620
38 Ga0065707_10039833 3300005295 Bacteria 1392
39 Ga0065707_10117356 3300005295 Bacteria 2213
40 Ga0070683_100440100 3300005329 Bacteria 1244
41 Ga0070683_100473626 3300005329 Bacteria 1196
42 Ga0070683_100492237 3300005329 Bacteria 1171
43 Ga0070680_100034094 3300005336 Bacteria 4105
44 Ga0070680_100064135 3300005336 Bacteria 3011
45 Ga0070680_100098095 3300005336 Bacteria 2430
46 Ga0068868_100011310 3300005338 Bacteria 6497
47 Ga0070691_10003977 3300005341 Bacteria 6687
48 Ga0070669_100400495 3300005353 Bacteria 1123
49 Ga0070669_100666918 3300005353 Bacteria 876
50 Ga0070674_100246652 3300005356 Bacteria 1401
51 Ga0070659_100259525 3300005366 Bacteria 1441
52 Ga0070667_100291403 3300005367 Bacteria 1468
53 Ga0070713_100160398 3300005436 Bacteria 2007
54 Ga0070713_100186107 3300005436 Bacteria 1869
55 Ga0070700_100040608 3300005441 Bacteria 2849
56 Ga0070694_100003712 3300005444 Bacteria 9106
57 Ga0070694_100112115 3300005444 Bacteria 1945
58 Ga0070663_100007767 3300005455 Bacteria 6551
59 Ga0070678_100070667 3300005456 Bacteria 2611
60 Ga0070681_10000393 3300005458 Bacteria 35383
61 Ga0070681_10014505 3300005458 Bacteria 7842
62 Ga0070681_10116057 3300005458 Bacteria 2614
63 Ga0070707_100093884 3300005468 Bacteria 2905
64 Ga0070698_100446600 3300005471 Bacteria 1229
65 Ga0070679_100019403 3300005530 Bacteria 6610
66 Ga0070679_100172761 3300005530 Bacteria 2134
67 Ga0068853_100060577 3300005539 Bacteria 3271
68 Ga0068853_100112670 3300005539 Bacteria 2418
69 Ga0070686_100512241 3300005544 Bacteria 933
70 Ga0070695_100100156 3300005545 Bacteria 1950
71 Ga0070665_100175214 3300005548 Bacteria 2146
72 Ga0070665_100277455 3300005548 Bacteria 1678
73 Ga0070704_100003315 3300005549 Bacteria 9212
74 Ga0068855_100513777 3300005563 Bacteria 1300
75 Ga0070664_100061891 3300005564 Bacteria 3190
76 Ga0070664_100169755 3300005564 Bacteria 1935
77 Ga0068857_100013484 3300005577 Bacteria 7120
78 Ga0068856_100002849 3300005614 Bacteria 17692
79 Ga0068856_100072955 3300005614 Bacteria 3398
80 Ga0068852_100002288 3300005616 Bacteria 13173
81 Ga0068852_100071600 3300005616 Bacteria 3045
82 Ga0068861_100075148 3300005719 Bacteria 2630
83 Ga0068851_10131991 3300005834 Bacteria 1351
84 Ga0068858_100132512 3300005842 Bacteria 2338
85 Ga0081540_1000338 3300005983 Bacteria 48150
86 Ga0081540_1003442 3300005983 Bacteria 12498
87 Ga0081540_1005876 3300005983 Bacteria 9072
88 Ga0081540_1006001 3300005983 Bacteria 8945
89 Ga0081540_1014249 3300005983 Bacteria 5106
90 Ga0081539_10000549 3300005985 Bacteria 77428
91 Ga0070717_10082654 3300006028 Bacteria 2700
92 Ga0075365_10005493 3300006038 Bacteria 6843
93 Ga0075365_10016988 3300006038 Bacteria 4443
94 Ga0075365_10116315 3300006038 Bacteria 1841
95 Ga0075368_10062883 3300006042 Bacteria 1488
96 Ga0075368_10092149 3300006042 Bacteria 1240
97 Ga0075363_100002563 3300006048 Bacteria 7472
98 Ga0075364_10000285 3300006051 Bacteria 24819
99 Ga0075364_10317613 3300006051 Bacteria 1061
100 Ga0075432_10016468 3300006058 Bacteria 2523
101 Ga0075362_10006876 3300006177 Bacteria 4262
102 Ga0075362_10061163 3300006177 Bacteria 1704
103 Ga0075367_10002436 3300006178 Bacteria 8500
104 Ga0075367_10008149 3300006178 Bacteria 5412
105 Ga0075369_10083286 3300006186 Bacteria 1420
106 Ga0075366_10096705 3300006195 Bacteria 1770
107 Ga0075370_10139245 3300006353 Bacteria 1418
108 Ga0075428_100092179 3300006844 Bacteria 3303
109 Ga0075428_100097827 3300006844 Bacteria 3200
110 Ga0075428_100250183 3300006844 Bacteria 1910
111 Ga0075428_100358949 3300006844 Bacteria 1563
112 Ga0075428_100427878 3300006844 Bacteria 1418
113 Ga0075430_100109636 3300006846 Bacteria 2302
114 Ga0075430_100119818 3300006846 Bacteria 2194
115 Ga0075430_100248046 3300006846 Bacteria 1475
116 Ga0075430_100275755 3300006846 Bacteria 1391
117 Ga0075431_100004249 3300006847 Bacteria 14032
118 Ga0075431_100015726 3300006847 Bacteria 7672
119 Ga0075431_100247157 3300006847 Bacteria 1813
120 Ga0075431_100342482 3300006847 Bacteria 1504
121 Ga0075434_100116694 3300006871 Bacteria 2682
122 Ga0075429_100073335 3300006880 Bacteria 2982
123 Ga0105240_10011032 3300009093 Bacteria 12637
124 Ga0105240_10097351 3300009093 Bacteria 3585
125 Ga0105240_10119069 3300009093 Bacteria 3181
126 Ga0105245_10214159 3300009098 Bacteria 1855
127 Ga0114129_10042219 3300009147 Bacteria 6420
128 Ga0114129_10228326 3300009147 Bacteria 2508
129 Ga0105243_10108107 3300009148 Bacteria 2321
130 Ga0105243_10342701 3300009148 Bacteria 1369
131 Ga0105241_10297806 3300009174 Bacteria 1383
132 Ga0123341_1000012 3300009765 Bacteria 105056
133 Ga0123342_1012643 3300009766 Bacteria 8727
134 Ga0105028_108689 3300009993 Bacteria 1063
135 Ga0105239_10089511 3300010375 Bacteria 3394
136 Ga0105239_10523033 3300010375 Bacteria 1350
137 Ga0105246_10032074 3300011119 Bacteria 3481
138 Ga0105246_10188245 3300011119 Bacteria 1595
139 Ga0157370_10023801 3300013104 Bacteria 6076
140 Ga0157370_10211933 3300013104 Bacteria 1795
141 Ga0157370_10314929 3300013104 Bacteria 1444
142 Ga0163162_10222678 3300013306 Bacteria 2016
143 Ga0163162_10423863 3300013306 Bacteria 1463
144 Ga0157372_10517315 3300013307 Bacteria 1391
145 Ga0157375_10073454 3300013308 Bacteria 3439
146 Ga0163163_10321085 3300014325 Bacteria 1602
147 Ga0157380_10007607 3300014326 Bacteria 7700
148 Ga0157380_10590924 3300014326 Bacteria 1097
149 Ga0182008_10039986 3300014497 Bacteria 2342
150 Ga0157376_10215584 3300014969 Bacteria 1775
151 Ga0206350_11027389 3300020080 Bacteria 1104
152 Ga0213873_10032919 3300021358 Bacteria 1298
153 Ga0213874_10003165 3300021377 Bacteria 3626
154 Ga0213876_10006880 3300021384 Bacteria 6200
155 Ga0213876_10009074 3300021384 Bacteria 5355
156 Ga0213876_10058498 3300021384 Bacteria 2035
157 Ga0213875_10001033 3300021388 Bacteria 19652
158 Ga0213875_10004683 3300021388 Bacteria 7452
159 Ga0213875_10059905 3300021388 Bacteria 1781
160 Ga0209436_100035 3300025208 Bacteria 79010
161 Ga0209563_104900 3300025230 Bacteria 2497
162 Ga0207425_1002132 3300025245 Bacteria 7266
163 Ga0207425_1012579 3300025245 Bacteria 1981
164 Ga0209677_101018 3300025253 Bacteria 13392
165 Ga0209148_1000475 3300025254 Bacteria 42476
166 Ga0209129_1003154 3300025258 Bacteria 7387
167 Ga0209129_1005382 3300025258 Bacteria 4560
168 Ga0209455_1001935 3300025272 Bacteria 8555
169 Ga0209673_1000067 3300025273 Bacteria 249077
170 Ga0209673_1000750 3300025273 Bacteria 44330
171 Ga0209673_1001376 3300025273 Bacteria 23910
172 Ga0209130_1000031 3300025284 Bacteria 322932
173 Ga0209130_1000467 3300025284 Bacteria 41801
174 Ga0209675_1002662 3300025291 Bacteria 9016
175 Ga0209025_1000017 3300025294 Bacteria 768983
176 Ga0209025_1000099 3300025294 Bacteria 231353
177 Ga0209025_1000397 3300025294 Bacteria 89703
178 Ga0209564_1000031 3300025295 Bacteria 494703
179 Ga0209564_1000082 3300025295 Bacteria 261494
180 Ga0209564_1000092 3300025295 Bacteria 249018
181 Ga0209564_1000511 3300025295 Bacteria 63773
182 Ga0209564_1000925 3300025295 Bacteria 38190
183 Ga0209564_1022634 3300025295 Bacteria 2212
184 Ga0209758_1000504 3300025297 Bacteria 63308
185 Ga0209758_1000585 3300025297 Bacteria 56861
186 Ga0209758_1001602 3300025297 Bacteria 25857
187 Ga0209758_1005532 3300025297 Bacteria 9647
188 Ga0209758_1007908 3300025297 Bacteria 7058
189 Ga0209758_1019714 3300025297 Bacteria 3235
190 Ga0209050_1004942 3300025298 Bacteria 8693
191 Ga0209256_1000033 3300025299 Bacteria 393924
192 Ga0209256_1000170 3300025299 Bacteria 130504
193 Ga0209256_1000181 3300025299 Bacteria 123624
194 Ga0209256_1004342 3300025299 Bacteria 8997
195 Ga0209256_1015056 3300025299 Bacteria 2732
196 Ga0209256_1022722 3300025299 Bacteria 1891
197 Ga0207426_1000042 3300025302 Bacteria 433289
198 Ga0207426_1000065 3300025302 Bacteria 353625
199 Ga0207426_1000355 3300025302 Bacteria 83450
200 Ga0207426_1012996 3300025302 Bacteria 3104
201 Ga0209051_1000062 3300025303 Bacteria 251081
202 Ga0209051_1009790 3300025303 Bacteria 4909
203 Ga0209257_1000376 3300025304 Bacteria 89065
204 Ga0209257_1000970 3300025304 Bacteria 39244
205 Ga0209257_1037430 3300025304 Bacteria 1479
206 Ga0207705_10225043 3300025909 Bacteria 1426
207 Ga0207707_10100127 3300025912 Bacteria 2533
208 Ga0207707_10425776 3300025912 Bacteria 1137
209 Ga0207695_10000008 3300025913 Bacteria 1058268
210 Ga0207695_10087976 3300025913 Bacteria 3128
211 Ga0207671_10010828 3300025914 Bacteria 7480
212 Ga0207662_10197196 3300025918 Bacteria 1302
213 Ga0207657_10060743 3300025919 Bacteria 3243
214 Ga0207652_10075415 3300025921 Bacteria 2939
215 Ga0207652_10119480 3300025921 Bacteria 2344
216 Ga0207652_10326275 3300025921 Bacteria 1386
217 Ga0207652_10469754 3300025921 Bacteria 1133
218 Ga0207646_10053281 3300025922 Bacteria 3619
219 Ga0207646_10078849 3300025922 Bacteria 2944
220 Ga0207659_10142049 3300025926 Bacteria 1865
221 Ga0207687_10071054 3300025927 Bacteria 2486
222 Ga0207700_10010378 3300025928 Bacteria 5873
223 Ga0207700_10276604 3300025928 Bacteria 1443
224 Ga0207664_10343807 3300025929 Bacteria 1319
225 Ga0207690_10222726 3300025932 Bacteria 1444
226 Ga0207661_10281098 3300025944 Bacteria 1487
227 Ga0207679_10018807 3300025945 Bacteria 4635
228 Ga0207679_10299600 3300025945 Bacteria 1385
229 Ga0207667_10049571 3300025949 Bacteria 4434
230 Ga0207712_10190524 3300025961 Bacteria 1618
231 Ga0207640_10144624 3300025981 Bacteria 1738
232 Ga0207658_10028464 3300025986 Bacteria 3935
233 Ga0207677_10012388 3300026023 Bacteria 4900
234 Ga0207677_10414397 3300026023 Bacteria 1146
235 Ga0207639_10105232 3300026041 Bacteria 2289
236 Ga0207639_10124095 3300026041 Bacteria 2127
237 Ga0207639_10290016 3300026041 Bacteria 1442
238 Ga0207678_10020039 3300026067 Bacteria 5876
239 Ga0207708_10058747 3300026075 Bacteria 2934
240 Ga0207702_10000325 3300026078 Bacteria 54690
241 Ga0207702_10053185 3300026078 Bacteria 3427
242 Ga0207676_10145019 3300026095 Bacteria 2038
243 Ga0207674_10149448 3300026116 Bacteria 2293
244 Ga0207675_100177673 3300026118 Bacteria 2037
245 Ga0207683_10099071 3300026121 Bacteria 2601
246 Ga0207698_10033601 3300026142 Bacteria 3729
247 Ga0209813_10073571 3300027866 Bacteria 1116
248 Ga0207428_10059159 3300027907 Bacteria 3039
249 Ga0207428_10074571 3300027907 Bacteria 2661
250 Ga0268266_10003379 3300028379 Bacteria 15975
251 Ga0268266_10087468 3300028379 Bacteria 2726
252 Ga0268265_10178697 3300028380 Bacteria 1822
253 Ga0307513_10213258 3300031456 Bacteria 1760
254 Ga0307513_10269250 3300031456 Bacteria 1488
255 Ga0265314_10010424 3300031711 Bacteria 7753
256 Ga0307516_10023182 3300031730 Bacteria 6367
257 Ga0307516_10196893 3300031730 Bacteria 1737
258 Ga0307516_10393820 3300031730 Bacteria 1045
259 Ga0307510_10008141 3300033180 Bacteria 12485
260 Ga0373955_0043094 3300035172 Bacteria 2426
261 Ga0373937_0191104 3300036401 Bacteria 1924
262 Ga0373937_0274478 3300036401 Bacteria 1591
263 Ga0395899_0005619 3300037312 Bacteria 9731
264 Ga0395899_0013520 3300037312 Bacteria 6240
265 Ga0395900_0003232 3300037418 Bacteria 17642
266 Ga0395900_0008561 3300037418 Bacteria 10519
267 Ga0395900_0018325 3300037418 Bacteria 7142
268 Ga0395900_0529655 3300037418 Bacteria 1125
269 Ga0395898_0007511 3300037466 Bacteria 11584
270 Ga0395898_0009099 3300037466 Bacteria 10459
271 Ga0395905_0014555 3300037471 Bacteria 7504
272 Ga0436364_0063930 3300037853 Bacteria 4672
273 Ga0436364_0103156 3300037853 Bacteria 17490
274 Ga0436364_0533917 3300037853 Bacteria 9986
275 Ga0436364_0642169 3300037853 Bacteria 25731
276 Ga0436364_0659865 3300037853 Bacteria 47070
277 Ga0436364_0674187 3300037853 Bacteria 9456
278 Ga0436364_1379234 3300037853 Bacteria 5061
279 Ga0395901_0011181 3300038443 Bacteria 9096
280 Ga0395901_0012192 3300038443 Bacteria 8723
281 Ga0395901_0159895 3300038443 Bacteria 2366
282 Ga0395901_0456464 3300038443 Bacteria 1306
283 Ga0436365_0138565 3300039437 Bacteria 8501
284 Ga0436365_0481731 3300039437 Bacteria 2890
285 Ga0436365_0712519 3300039437 Bacteria 10286
286 Ga0436365_0879300 3300039437 Bacteria 3197
287 Ga0436365_1535876 3300039437 Bacteria 20439
288 Ga0436365_1736919 3300039437 Bacteria 6655
289 Ga0436360_0178193 3300039438 Bacteria 6576
290 Ga0436360_1090709 3300039438 Bacteria 1837
291 Ga0436361_0606306 3300039447 Bacteria 2508
292 Ga0436363_0282535 3300039450 Bacteria 16541
293 Ga0436363_0472610 3300039450 Bacteria 6308
294 Ga0436363_1477180 3300039450 Bacteria 2712
295 Ga0436362_0822437 3300039453 Bacteria 5872
296 Ga0439453_0001749 3300041408 Bacteria 2864
297 Ga0451802_0956542 3300041460 Bacteria 1297
298 Ga0451837_1690335 3300041494 Bacteria 1347
299 Ga0451839_0668746 3300041496 Bacteria 1848
300 Ga0451841_0665146 3300041498 Bacteria 1343
301 Ga0451841_0873827 3300041498 Bacteria 1077
302 Ga0451847_0365642 3300041503 Bacteria 1261
303 Ga0451847_0833553 3300041503 Bacteria 3861
304 Ga0451849_0492377 3300041505 Bacteria 3337
305 Ga0451843_0493458 3300041509 Bacteria 1825
306 Ga0451843_1370099 3300041509 Bacteria 1299
307 Ga0451853_2198736 3300041512 Bacteria 5299
308 Ga0439458_0027395 3300042157 Bacteria 1344
309 Ga0439464_0028317 3300042439 Bacteria 1561
310 Ga0451577_0013112 3300042876 Bacteria 7769
311 Ga0466961_0000154 3300044693 Bacteria 46518
312 Ga0466963_0044844 3300044694 Bacteria 2911
313 Ga0466963_0145165 3300044694 Bacteria 1646
314 Ga0466970_0024331 3300044765 Bacteria 3165
315 Ga0451576_0000231 3300045051 Bacteria 136040
316 Ga0466967_0008224 3300045976 Bacteria 7620
317 Ga0495638_0000475 3300046460 Bacteria 48300
318 Ga0495638_0017603 3300046460 Bacteria 4760
319 Ga0495651_0017859 3300046462 Bacteria 5492
320 Ga0495664_0077379 3300046477 Bacteria 1992
321 Ga0495585_0058598 3300046492 Bacteria 2124
322 Ga0495607_0021279 3300046501 Bacteria 4083
323 Ga0495583_0117562 3300046506 Bacteria 1122
324 Ga0495610_0068843 3300046512 Bacteria 1657
325 Ga0495632_0054675 3300046519 Bacteria 1956
326 Ga0495644_0047074 3300046523 Bacteria 1621
327 Ga0495640_0145381 3300046533 Bacteria 1526
328 Ga0495597_0018419 3300046542 Bacteria 3277
329 Ga0495645_0029087 3300046543 Bacteria 4016
330 Ga0495668_0091160 3300046616 Bacteria 1670
331 Ga0495625_0065986 3300046660 Bacteria 2550
332 Ga0495625_0149096 3300046660 Bacteria 1573
333 Ga0495670_0079396 3300046691 Bacteria 1670
334 Ga0495589_0196969 3300046794 Bacteria 952
335 Ga0495660_0133140 3300046810 Bacteria 1245
336 Ga0495604_0157604 3300047317 Bacteria 1607
337 Ga0495680_0209890 3300047322 Bacteria 1394
338 Ga0495683_0074182 3300047323 Bacteria 1668
339 Ga0495687_097650 3300047443 Bacteria 1110
340 Ga0495685_063961 3300047447 Bacteria 1238
341 Ga0495681_0119790 3300047470 Bacteria 1131
342 Ga0495686_0038269 3300047472 Bacteria 3068
343 Ga0496100_0020009 3300048903 Bacteria 4006
344 Ga0496102_0202039 3300048905 Bacteria 1873
345 Ga0496103_0073279 3300048906 Bacteria 2145
346 Ga0496104_0082985 3300048907 Bacteria 3056
347 Ga0496105_0021632 3300048908 Bacteria 5205
348 Ga0496107_0015042 3300048910 Bacteria 5421
349 Ga0496108_0075698 3300048911 Bacteria 2844
350 Ga0496110_0043688 3300048913 Bacteria 3913
351 Ga0496111_0032362 3300048914 Bacteria 3728
352 Ga0496112_0088237 3300048915 Bacteria 3069
353 Ga0496114_0019685 3300048917 Bacteria 5470
354 Ga0496115_0002706 3300048918 Bacteria 12727
355 Ga0496116_0009436 3300048919 Bacteria 8312
356 Ga0496117_0017924 3300048920 Bacteria 5895
357 Ga0496117_0071594 3300048920 Bacteria 2322
358 Ga0496117_0087353 3300048920 Bacteria 2022
359 Ga0496118_0002068 3300048921 Bacteria 28261
360 Ga0496118_0028344 3300048921 Bacteria 4718
361 Ga0496119_0008868 3300048922 Bacteria 8749
362 Ga0496120_0276800 3300048923 Bacteria 777
363 Ga0496121_0000406 3300048924 Bacteria 85761
364 Ga0496122_0023409 3300048925 Bacteria 5447
365 Ga0496122_0026726 3300048925 Bacteria 4964
366 Ga0496125_0000145 3300048928 Bacteria 156267
367 Ga0496125_0000471 3300048928 Bacteria 71765
368 Ga0496125_0010847 3300048928 Bacteria 9172
369 Ga0501031_0013786 3300049568 Bacteria 5269
370 Ga0501033_0010498 3300049570 Bacteria 7103
371 Ga0501034_0022087 3300049571 Bacteria 6482
372 Ga0501034_0036019 3300049571 Bacteria 5016
373 Ga0501034_0096432 3300049571 Bacteria 2953
374 Ga0501034_0145736 3300049571 Bacteria 2345
375 Ga0501036_0666533 3300049572 Bacteria 861
376 Ga0501037_0000107 3300049573 Bacteria 78666
377 Ga0501037_0093876 3300049573 Bacteria 2169
378 Ga0501037_0186493 3300049573 Bacteria 1470
379 Ga0501038_0027545 3300049574 Bacteria 5056
380 Ga0501038_0028509 3300049574 Bacteria 4961
381 Ga0501038_0098912 3300049574 Bacteria 2432
382 Ga0501043_0000005 3300049579 Bacteria 254466
383 Ga0501043_0067753 3300049579 Bacteria 2803
384 Ga0501046_0191968 3300049580 Bacteria 1523
385 Ga0501047_0061392 3300049581 Bacteria 3627
386 Ga0501069_0000033 3300049585 Bacteria 92477
387 Ga0501070_0000913 3300049586 Bacteria 26864
388 Ga0501073_0060391 3300049589 Bacteria 2646
389 Ga0501074_0000571 3300049590 Bacteria 22782
390 Ga0501076_0176737 3300049592 Bacteria 1740
391 Ga0501083_0000355 3300049744 Bacteria 29001
392 Ga0501083_0028777 3300049744 Bacteria 3827
393 Ga0501035_0000086 3300049822 Bacteria 115822
394 Ga0501035_0228322 3300049822 Bacteria 1587
395 Ga0501044_0000223 3300049823 Bacteria 71752
396 Ga0501044_0018528 3300049823 Bacteria 7459
397 Ga0501044_0072326 3300049823 Bacteria 3506
398 Ga0501044_0107423 3300049823 Bacteria 2802
399 Ga0501044_0114589 3300049823 Bacteria 2701
400 Ga0501045_0099903 3300049824 Bacteria 2148
401 nmdc:mga03683_70184_c1 3300050489 Bacteria 1496
402 nmdc:mga03683_70474_c1 3300050489 Bacteria 1494
403 nmdc:mga03n38_10745_c1 3300050490 Bacteria 3383
404 nmdc:mga03n38_157664_c1 3300050490 Bacteria 1147
405 nmdc:mga00v17_104960_c1 3300050491 Bacteria 1787
406 nmdc:mga00v17_14_c1 3300050491 Bacteria 126589
407 nmdc:mga0yw44_112489_c1 3300050492 Bacteria 1746
408 nmdc:mga0yw44_250837_c1 3300050492 Bacteria 1178
409 nmdc:mga0yw44_3294_c1 3300050492 Bacteria 7137
410 nmdc:mga0yw44_7443_c1 3300050492 Bacteria 5387
411 nmdc:mga0k408_45159_c1 3300050493 Bacteria 1269
412 nmdc:mga06z11_11047_c1 3300050494 Bacteria 3876
413 nmdc:mga06z11_160131_c1 3300050494 Bacteria 1286
414 nmdc:mga05p37_106889_c1 3300050507 Bacteria 3443
415 nmdc:mga09592_188763_c1 3300050508 Bacteria 1784
416 nmdc:mga09592_45885_c1 3300050508 Bacteria 3680
417 nmdc:mga09592_53176_c1 3300050508 Bacteria 2063
418 nmdc:mga0qj67_132735_c1 3300050509 Bacteria 2017
419 nmdc:mga0qj67_238091_c1 3300050509 Bacteria 1477
420 nmdc:mga0qj67_27792_c1 3300050509 Bacteria 4386
421 nmdc:mga0qj67_51412_c1 3300050509 Bacteria 1770
422 nmdc:mga06r32_12511_c1 3300050510 Bacteria 7658
423 nmdc:mga06r32_235229_c1 3300050510 Bacteria 1820
424 nmdc:mga06r32_245293_c1 3300050510 Bacteria 1779
425 nmdc:mga06r32_4390_c1 3300050510 Bacteria 12611
426 nmdc:mga06r32_941408_c1 3300050510 Bacteria 819
427 nmdc:mga08y16_230140_c1 3300050511 Bacteria 1917
428 nmdc:mga08y16_438965_c1 3300050511 Bacteria 1333
429 nmdc:mga08y16_545866_c1 3300050511 Bacteria 1173
430 nmdc:mga08y16_76334_c1 3300050511 Bacteria 3493
431 nmdc:mga0sz30_74628_c1 3300050516 Bacteria 1463
432 Ga0500578_0249768 3300053086 Bacteria 1069
433 Ga0500643_000035 3300053087 Bacteria 184794
434 Ga0500644_0060791 3300053088 Bacteria 1330
435 Ga0500641_0066828 3300053096 Bacteria 1506
436 Ga0500555_006777 3300053103 Bacteria 3256
437 Ga0500562_022839 3300053108 Bacteria 1631
438 Ga0500569_002841 3300053109 Bacteria 3462
439 Ga0500569_046106 3300053109 Bacteria 1297
440 Ga0500595_001183 3300053119 Bacteria 14392
441 Ga0500595_002181 3300053119 Bacteria 9945
442 Ga0500658_0002498 3300053134 Bacteria 7116
443 Ga0500658_0044689 3300053134 Bacteria 1788
444 Ga0500568_0001438 3300053139 Bacteria 15421
445 Ga0500568_0016475 3300053139 Bacteria 3285
446 Ga0500568_0143808 3300053139 Bacteria 883
447 Ga0500577_0033238 3300053142 Bacteria 1821
448 Ga0500616_0000472 3300053153 Bacteria 52191
449 Ga0500616_0026922 3300053153 Bacteria 3178
450 Ga0500634_0000507 3300053161 Bacteria 12661
451 Ga0500634_0073408 3300053161 Bacteria 1784
452 Ga0500638_009653 3300053162 Bacteria 4187
453 Ga0500636_0001753 3300053177 Bacteria 11889
454 Ga0500637_0000138 3300053178 Bacteria 26740
455 Ga0500609_000759 3300053731 Bacteria 4841
456 Ga0500601_000712 3300053737 Bacteria 4407
457 Ga0500661_000130 3300055283 Bacteria 12645
458 Ga0466962_0101240 3300061719 Bacteria 1383
459 2503200951 2503198000 Bacteria 6884444
460 2508728166 2508501050 Bacteria 9633614
461 2509144701 2508501127 Bacteria 7037543
462 2509369537 2509276018 Bacteria 6910194
463 2509385617 2509276021 Bacteria 7634384
464 2509448335 2509276033 Bacteria 7180565
465 2510136429 2510065019 Bacteria 6903379
466 2510319291 2510065059 Bacteria 6847884
467 2510892308 2510461076 Bacteria 8618824
468 2511198102 2510917030 Bacteria 7460662
469 2511394989 2511231028 Bacteria 8046582
470 2513568058 2513237084 Bacteria 7231967
471 2513578388 2513237085 Bacteria 7695351
472 2513591257 2513237087 Bacteria 5817514
473 2513630999 2513237093 Bacteria 7545552
474 2513711081 2513237103 Bacteria 7647401
475 2513999351 2513237159 Bacteria 6810126
476 2514021105 2513237162 Bacteria 7468464
477 2514423072 2513237305 Bacteria 7293571
478 2515632215 2515154113 Bacteria 7807172
479 2515643533 2515154114 Bacteria 7848616
480 2515658332 2515154116 Bacteria 7552979
481 2515738118 2515154134 Bacteria 7220242
482 2517041200 2516653077 Bacteria 7555578
483 2517080174 2516653085 Bacteria 7346596
484 2517098175 2517093000 Bacteria 7412387
485 2517410062 2517287029 Bacteria 6905599
486 2530644670 2529292951 Bacteria 6916614
487 2585525578 2585427526 Bacteria 7258840
488 2585538689 2585427528 Bacteria 6842387
489 2585836642 2585427593 Bacteria 7141551
490 2597814606 2597489875 Bacteria 7010078
491 2616294743 2615840624 Bacteria 6557588
492 2643814631 2643221558 Bacteria 5460675
493 2644730069 2643221733 Bacteria 5690728
494 2644746170 2643221736 Bacteria 6608466
495 2688597244 2687453392 Bacteria 6880454
496 2715501879 2713897090 Bacteria 3353799
497 2719184499 2718217882 Bacteria 6556348
498 2719388562 2718217927 Bacteria 6972593
499 2719388581 2718217927 Bacteria 6972593
500 2719668392 2718217997 Bacteria 6740740
501 2719728519 2718218009 Bacteria 6478651
502 2720489085 2718218199 Bacteria 6740745
503 2720609777 2718218232 Bacteria 6720332
504 2720617209 2718218233 Bacteria 6662049
505 2720628350 2718218235 Bacteria 6630699
506 2720772304 2718218269 Bacteria 6906114
507 2721144207 2718218363 Bacteria 6524337
508 2721156305 2718218365 Bacteria 6274507
509 2721161582 2718218366 Bacteria 6425255
510 2721403187 2718218423 Bacteria 6438183
511 2721403206 2718218423 Bacteria 6438183
512 2722842727 2721755514 Bacteria 6424414
513 2723029725 2721755556 Bacteria 6745503
514 2723564094 2721755684 Bacteria 6859907
515 2723570212 2721755685 Bacteria 6704835
516 2723577073 2721755686 Bacteria 7343952
517 2724035544 2721755809 Bacteria 6438790
518 2724035563 2721755809 Bacteria 6438790
519 2724041544 2721755810 Bacteria 6479005
520 2724092333 2721755819 Bacteria 6906405
521 2724101759 2721755822 Bacteria 6726041
522 2724112709 2721755823 Bacteria 6752556
523 2725947834 2724679232 Bacteria 7646494
524 2730110258 2728369352 Bacteria 6745171
525 2730160615 2728369365 Bacteria 6555560
526 2730295838 2728369397 Bacteria 6274511
527 2739034112 2738541333 Bacteria 7106503
528 2753361093 2751185800 Bacteria 5467370
529 2758637829 2758568016 Bacteria 5645291
530 2766065111 2765235942 Bacteria 7445910
531 2793297445 2791355256 Bacteria 6798008
532 2793317318 2791355259 Bacteria 7254731
533 2793323110 2791355260 Bacteria 6598818
534 2793329872 2791355261 Bacteria 6661293
535 2793336602 2791355262 Bacteria 6774204
536 2793344511 2791355263 Bacteria 6872478
537 2793345379 2791355264 Bacteria 6429314
538 2793354924 2791355265 Bacteria 6539969
539 2793358163 2791355266 Bacteria 7116587
540 2793369827 2791355267 Bacteria 7222458
541 2805927144 2802429605 Bacteria 6875453
542 2805934430 2802429606 Bacteria 6346811
543 2806042909 2802429633 Bacteria 7341974
544 2806050862 2802429634 Bacteria 7083200
545 2806057970 2802429635 Bacteria 7650140
546 2806065317 2802429636 Bacteria 7597525
547 2806076800 2802429637 Bacteria 7067217
548 2819720105 2818991467 Bacteria 5893227
549 2828310327 2828305725 Bacteria 4916900
550 2835316039 2835312727 Bacteria 7413381
551 2838016391 2838016132 Bacteria 6577831
552 2838028328 2838022645 Bacteria 6494267
553 2838045839 2838042994 Bacteria 6046894
554 2838049498 2838048938 Bacteria 6044578
555 2838065227 2838061910 Bacteria 6794874
556 2838068927 2838068647 Bacteria 6208656
557 2838669552 2838668709 Bacteria 6671819
558 2838686244 2838680041 Bacteria 6545511
559 2838687469 2838686498 Bacteria 7807632
560 2838701924 2838701080 Bacteria 6669771
561 2838713951 2838707686 Bacteria 6619912
562 2838734119 2838729681 Bacteria 7400765
563 2838746571 2838742623 Bacteria 7396178
564 2841766118 2841760612 Bacteria 6454112
565 2841854019 2841851746 Bacteria 7532261
566 2841869339 2841864319 Bacteria 6742987
567 2842083349 2842077413 Bacteria 6508645
568 2842116732 2842110456 Bacteria 7656360
569 2842124296 2842118031 Bacteria 7033875
570 2842159614 2842156927 Bacteria 6894975
571 2842164063 2842163707 Bacteria 6916235
572 2842182816 2842180545 Bacteria 6888678
573 2842198539 2842192696 Bacteria 6147454
574 2842204304 2842198810 Bacteria 6608673
575 2842209371 2842205361 Bacteria 6340321
576 2842221591 2842217011 Bacteria 7497767
577 2842232527 2842229732 Bacteria 7475766
578 2842243368 2842237096 Bacteria 6620661
579 2842247230 2842243621 Bacteria 7421798
580 2842251653 2842250916 Bacteria 6579627
581 2842259083 2842257432 Bacteria 7401195
582 2842265263 2842264693 Bacteria 6472963
583 2842272497 2842271015 Bacteria 7807131
584 2842282585 2842278818 Bacteria 6340002
585 2842297550 2842291075 Bacteria 7076806
586 2842309831 2842304105 Bacteria 7023636
587 2842313404 2842311132 Bacteria 6616990
588 2842323361 2842317721 Bacteria 6793725
589 2842344113 2842341865 Bacteria 7003929
590 2842376579 2842370503 Bacteria 7038661
591 2842383832 2842377471 Bacteria 7140707
592 2842390975 2842384541 Bacteria 7057858
593 2842396473 2842395702 Bacteria 6780583
594 2842405726 2842402390 Bacteria 6681310
595 2842412310 2842409023 Bacteria 6687331
596 2842418956 2842415677 Bacteria 6596907
597 2842423073 2842422224 Bacteria 6239196
598 2842428684 2842428310 Bacteria 6767288
599 2842435297 2842434925 Bacteria 6502746
600 2842441840 2842441272 Bacteria 6769273
601 2842448114 2842447887 Bacteria 6754142
602 2842463108 2842462802 Bacteria 6588055
603 2842469628 2842469257 Bacteria 6752936
604 2842489630 2842489311 Bacteria 6620893
605 2842500462 2842495871 Bacteria 6820686
606 2842525143 2842521101 Bacteria 6569494
607 2842695716 2842694124 Bacteria 4063419
608 2842777250 2842775625 Bacteria 5587290
609 2844012627 2844009547 Bacteria 6728125
610 2844105884 2844104063 Bacteria 6440972
611 2844460465 2844454524 Bacteria 7952546
612 2851186382 2851182111 Bacteria 6047226
613 2851246240 2851246043 Bacteria 6439203
614 2854899956 2854896431 Bacteria 5869725
615 2856334866 2856328259 Bacteria 6528202
616 2856341583 2856334872 Bacteria 7037011
617 2856347706 2856342000 Bacteria 7176905
618 2856352999 2856349417 Bacteria 6230045
619 2856362010 2856356410 Bacteria 6297484
620 2857373248 2857367948 Bacteria 6965560
621 2857518030 2857516855 Bacteria 7787325
622 2869171175 2869169390 Bacteria 6659796
623 2869238807 2869234852 Bacteria 6654993
624 2869248133 2869242130 Bacteria 6609239
625 2869251560 2869249662 Bacteria 6868783
626 2869260095 2869256925 Bacteria 6981691
627 2869271068 2869264136 Bacteria 6880765
628 2869277774 2869271264 Bacteria 6908218
629 2871436915 2871435913 Bacteria 6880295
630 2871454630 2871451962 Bacteria 7336357
631 2871465715 2871459585 Bacteria 6866887
632 2871487692 2871481445 Bacteria 6700002
633 2871493618 2871488783 Bacteria 6929816
634 2871497151 2871495908 Bacteria 6935695
635 2874110346 2874109183 Bacteria 6517025
636 2874122791 2874116593 Bacteria 6674494
637 2874137122 2874131515 Bacteria 6820270
638 2874167956 2874162495 Bacteria 6174670
639 2874632158 2874628541 Bacteria 8630250
640 2876389737 2876386047 Bacteria 6698674
641 2876402861 2876399893 Bacteria 6927900
642 2876410527 2876406927 Bacteria 6191900
643 2876427447 2876420981 Bacteria 6687741
644 2878737482 2878730984 Bacteria 6380721
645 2878756191 2878753008 Bacteria 6922523
646 2878761372 2878760144 Bacteria 6823465
647 2878768339 2878767105 Bacteria 6898628
648 2878775068 2878774303 Bacteria 6108671
649 2878783594 2878781027 Bacteria 6834456
650 2881156999 2881155292 Bacteria 6461656
651 2881851600 2881845957 Bacteria 6611900
652 2881860304 2881853255 Bacteria 6698367
653 2881864925 2881861095 Bacteria 7128710
654 2882633809 2882632389 Bacteria 8154593
655 2882918125 2882912400 Bacteria 6801539
656 2883577390 2883577096 Bacteria 4709178
657 2885321319 2885318864 Bacteria 6729568
658 2885343950 2885342637 Bacteria 7011821
659 2885352797 2885350715 Bacteria 6787678
660 2888348047 2888343758 Bacteria 6611049
661 2888356719 2888350351 Bacteria 7372807
662 2888393539 2888388044 Bacteria 7304136
663 2889023299 2889016732 Bacteria 6700763
664 2894237774 2894232714 Bacteria 8834183
665 2894776640 2894772417 Bacteria 5305674
666 2894822088 2894817345 Bacteria 4892941
667 2903502878 2903492973 Bacteria 13473544
668 2903541946 2903540706 Bacteria 7062119
669 2906363078 2906354277 Bacteria 6991324
670 2906364668 2906363423 Bacteria 6856682
671 2906376936 2906370794 Bacteria 6881062
672 2906389595 2906386501 Bacteria 5977019
673 2906401129 2906393657 Bacteria 6790866
674 2906401782 2906401398 Bacteria 6693206
675 2906411357 2906408224 Bacteria 6162342
676 2917703899 2917699015 Bacteria 7043791
677 2919102789 2919100787 Bacteria 7710546
678 2922135486 2922130491 Bacteria 7173936
679 2922155928 2922151315 Bacteria 6902399
680 2922177625 2922172374 Bacteria 6167644
681 2922179333 2922178524 Bacteria 6025201
682 2922192520 2922185730 Bacteria 7113964
683 2924716945 2924710171 Bacteria 6752351
684 2924737865 2924733363 Bacteria 7574837
685 2924742681 2924741084 Bacteria 6661321
686 2924749427 2924748358 Bacteria 6154725
687 2924757664 2924754689 Bacteria 6774424
688 2924765984 2924762789 Bacteria 6561353
689 2924787761 2924784321 Bacteria 7416538
690 2929202996 2929199973 Bacteria 7260745
691 2933576273 2933570622 Bacteria 7023390
692 2933592948 2933586486 Bacteria 7667493
693 2933599595 2933599457 Bacteria 5858799
694 2935773905 2935769743 Bacteria 7878163
695 2935788659 2935785616 Bacteria 7962367
696 2935795715 2935793552 Bacteria 8012592
697 2935900993 2935894831 Bacteria 6620579
698 2935903164 2935901341 Bacteria 7341747
699 2936374399 2936367885 Bacteria 7324495
700 2936378759 2936375103 Bacteria 6652732
701 2936386549 2936381700 Bacteria 7006523
702 2937862656 2937861824 Bacteria 6660327
703 2937870048 2937868953 Bacteria 6639878
704 2937981210 2937980651 Bacteria 6517427
705 2937995802 2937994558 Bacteria 7036190
706 2958105499 2958100919 Bacteria 6800575
707 2958115082 2958108152 Bacteria 6681128
708 2958129824 2958122699 Bacteria 7280457
709 2958158293 2958158011 Bacteria 6058449
710 2958166274 2958165035 Bacteria 6906348
711 2958178763 2958172287 Bacteria 6716688
712 2961129930 2961127735 Bacteria 7196641
713 2961164736 2961163497 Bacteria 6901077
714 2961172479 2961170736 Bacteria 7072258
715 2961184365 2961183825 Bacteria 6688536
716 2965019562 2965018300 Bacteria 6883036
717 2965027621 2965025482 Bacteria 6532201
718 2965036221 2965032056 Bacteria 6887443
719 2965043330 2965040258 Bacteria 6855979
720 2965049654 2965047637 Bacteria 6623551
721 2965090548 2965089291 Bacteria 6866420
722 2965107374 2965102966 Bacteria 6800987
723 2965111228 2965110997 Bacteria 6693150
724 2965119757 2965119406 Bacteria 6956431
725 2967997695 2967996073 Bacteria 6787468
726 2968008346 2968003550 Bacteria 6929263
727 2968141126 2968138860 Bacteria 6605449
728 2968173138 2968171901 Bacteria 6894245
729 2970495187 2970489779 Bacteria 6517260
730 2970505073 2970503327 Bacteria 7099517
731 2970531949 2970524798 Bacteria 6840927
732 2970547656 2970540015 Bacteria 6977556
733 2970552322 2970547951 Bacteria 6931819
734 2970556228 2970554993 Bacteria 6814252
735 2970626597 2970619444 Bacteria 6986144
736 2970627861 2970627176 Bacteria 6680862
737 2977825372 2977821940 Bacteria 6906439
738 2977832682 2977828996 Bacteria 7007971
739 2977852029 2977851361 Bacteria 6694324
740 2977873863 2977872689 Bacteria 7270173
741 2977905078 2977898635 Bacteria 6675551
742 2977914961 2977907340 Bacteria 6577984
743 2977916508 2977915119 Bacteria 6829656
744 2977941666 2977935797 Bacteria 6252826
745 2977951032 2977950692 Bacteria 6893264
746 2977960464 2977957713 Bacteria 6877875
747 2977974932 2977971508 Bacteria 7472917
748 2979716026 2979710463 Bacteria 6785254
749 2979750769 2979742915 Bacteria 7301278
750 2979769648 2979764755 Bacteria 6610066
751 2979779733 2979772303 Bacteria 6618277
752 2979797187 2979793036 Bacteria 6808957
753 2979809794 2979808191 Bacteria 7179355
754 2987648178 2987645492 Bacteria 6117018
755 2987660745 2987659509 Bacteria 6966464
756 2987668500 2987666974 Bacteria 6509233
757 2987680946 2987673487 Bacteria 6884027
758 2996316207 2996310559 Bacteria 6357320
759 2996390031 2996386984 Bacteria 6978667
760 2996894491 2996893221 Bacteria 5823108
761 3004189793 3004188549 Bacteria 6952365
762 3004203512 3004195979 Bacteria 6776956
763 3004235875 3004232784 Bacteria 6662140
764 3004243286 3004239961 Bacteria 6892290
765 3004253659 3004248173 Bacteria 6563236
766 3004273896 3004268573 Bacteria 7043476
767 3005413507 3005409236 Bacteria 7188837
768 3005452049 3005445848 Bacteria 6906074
769 3005599513 3005594810 Bacteria 8716512
770 3005715184 3005710791 Bacteria 7622528
771 639644988 639633055 Bacteria 7751309
772 649871797 649633066 Bacteria 6690028
773 8004302835 8004300914 Bacteria 6132239
774 8004312760 8004312739 Bacteria 7444653
775 8004365152 8004361976 Bacteria 6858373
776 8004377780 8004374579 Bacteria 6898112
777 8004397839 8004395343 Bacteria 6620908
778 8004702367 8004695233 Bacteria 6731676
779 8004731568 8004727605 Bacteria 6643904
780 8005277278 8005275841 Bacteria 6929066
781 8005277297 8005275841 Bacteria 6929066
782 8005287613 8005282627 Bacteria 6675747
783 8005295520 8005289223 Bacteria 6634003
784 8005306310 8005301065 Bacteria 6614431
785 8005307933 8005307578 Bacteria 7395396
786 8005379798 8005376324 Bacteria 6590079
787 8005383403 8005382845 Bacteria 6732062
788 8005398997 8005395548 Bacteria 6806915
789 8005431769 8005430974 Bacteria 6689030
790 8005502600 8005497431 Bacteria 6477605
791 8005562360 8005556819 Bacteria 6908598
792 8005565522 8005563573 Bacteria 7153261
793 8005575762 8005570704 Bacteria 6957481
794 8005623807 8005619151 Bacteria 7030230
795 8005626366 8005626139 Bacteria 6534237
796 8005674029 8005668836 Bacteria 6953162
797 8005693994 8005688590 Bacteria 6610080
798 8005701816 8005695170 Bacteria 6912330
799 8018131905 8018127388 Bacteria 7351159
800 8018150446 8018150411 Bacteria 5549903
801 8018165502 8018163183 Bacteria 7277977
802 8018182373 8018176218 Bacteria 6896178
803 8023688085 8023680758 Bacteria 7729763
804 8024485040 8024479707 Bacteria 6954785
805 8024507170 8024501048 Bacteria 6427847
806 8055622158 8055617313 Bacteria 7548464
807 8055916096 8055909800 Bacteria 7278581
808 8056375043 8056375014 Bacteria 7006639
809 8056382491 8056382006 Bacteria 6408074
810 8056968301 8056967851 Bacteria 9038162
811 8057531534 8057529695 Bacteria 6306553
812 8057878015 8057874678 Bacteria 7494653
813 Ga0436364_0210545
814 JGI25158J39367_1000448
815 JGI25152J39213_1005931
816 JGI25159J45721_1004075
817 JGI25159J45721_1008482
818 JGI25151J46595_10000458
819 JGI25151J46595_10000508
820 JGI25406J46586_10000433
821 JGI25153J46596_10002535
822 JGI25153J46596_10010647
823 JGI25153J46596_10014909
824 JGI25160J50197_1003716
825 JGI25160J50197_1040511
826 JGI25161J50226_1000075
827 JGI25161J50226_1006294
828 JGI25404J52841_10000339
829 JGI25404J52841_10016648
830 Ga0055542_1003894
831 Ga0055526_1000017
832 Ga0055526_1005597
833 Ga0055526_1024737
834 Ga0055524_1000014
835 Ga0055524_1010792
836 Ga0055528_1000054
837 Ga0055528_1002349
838 Ga0055540_1000255
839 Ga0055540_1025147
840 Ga0055531_10016286
841 Ga0055531_10046365
842 Ga0055543_1000096
843 Ga0055543_1000578
844 Ga0055543_1008108
845 Ga0058862_12352147
846 Ga0065165_1000231
847 Ga0065165_1007353
848 Ga0065165_1011236
849 Ga0065715_10161723
850 Ga0065707_10039833
851 Ga0065707_10117356
852 Ga0070683_100440100
853 Ga0070683_100473626
854 Ga0070683_100492237
855 Ga0070680_100034094
856 Ga0070680_100064135
857 Ga0070680_100098095
858 Ga0068868_100011310
859 Ga0070691_10003977
860 Ga0070669_100400495
861 Ga0070669_100666918
862 Ga0070674_100246652
863 Ga0070659_100259525
864 Ga0070667_100291403
865 Ga0070713_100160398
866 Ga0070713_100186107
867 Ga0070700_100040608
868 Ga0070694_100003712
869 Ga0070694_100112115
870 Ga0070663_100007767
871 Ga0070678_100070667
872 Ga0070681_10000393
873 Ga0070681_10014505
874 Ga0070681_10116057
875 Ga0070707_100093884
876 Ga0070698_100446600
877 Ga0070679_100019403
878 Ga0070679_100172761
879 Ga0068853_100060577
880 Ga0068853_100112670
881 Ga0070686_100512241
882 Ga0070695_100100156
883 Ga0070665_100175214
884 Ga0070665_100277455
885 Ga0070704_100003315
886 Ga0068855_100513777
887 Ga0070664_100061891
888 Ga0070664_100169755
889 Ga0068857_100013484
890 Ga0068856_100002849
891 Ga0068856_100072955
892 Ga0068852_100002288
893 Ga0068852_100071600
894 Ga0068861_100075148
895 Ga0068851_10131991
896 Ga0068858_100132512
897 Ga0081540_1000338
898 Ga0081540_1003442
899 Ga0081540_1005876
900 Ga0081540_1006001
901 Ga0081540_1014249
902 Ga0081539_10000549
903 Ga0070717_10082654
904 Ga0075365_10005493
905 Ga0075365_10016988
906 Ga0075365_10116315
907 Ga0075368_10062883
908 Ga0075368_10092149
909 Ga0075363_100002563
910 Ga0075364_10000285
911 Ga0075364_10317613
912 Ga0075432_10016468
913 Ga0075362_10006876
914 Ga0075362_10061163
915 Ga0075367_10002436
916 Ga0075367_10008149
917 Ga0075369_10083286
918 Ga0075366_10096705
919 Ga0075370_10139245
920 Ga0075428_100092179
921 Ga0075428_100097827
922 Ga0075428_100250183
923 Ga0075428_100358949
924 Ga0075428_100427878
925 Ga0075430_100109636
926 Ga0075430_100119818
927 Ga0075430_100248046
928 Ga0075430_100275755
929 Ga0075431_100004249
930 Ga0075431_100015726
931 Ga0075431_100247157
932 Ga0075431_100342482
933 Ga0075434_100116694
934 Ga0075429_100073335
935 Ga0105240_10011032
936 Ga0105240_10097351
937 Ga0105240_10119069
938 Ga0105245_10214159
939 Ga0114129_10042219
940 Ga0114129_10228326
941 Ga0105243_10108107
942 Ga0105243_10342701
943 Ga0105241_10297806
944 Ga0123341_1000012
945 Ga0123342_1012643
946 Ga0105028_108689
947 Ga0105239_10089511
948 Ga0105239_10523033
949 Ga0105246_10032074
950 Ga0105246_10188245
951 Ga0157370_10023801
952 Ga0157370_10211933
953 Ga0157370_10314929
954 Ga0163162_10222678
955 Ga0163162_10423863
956 Ga0157372_10517315
957 Ga0157375_10073454
958 Ga0163163_10321085
959 Ga0157380_10007607
960 Ga0157380_10590924
961 Ga0182008_10039986
962 Ga0157376_10215584
963 Ga0206350_11027389
964 Ga0213873_10032919
965 Ga0213874_10003165
966 Ga0213876_10006880
967 Ga0213876_10009074
968 Ga0213876_10058498
969 Ga0213875_10001033
970 Ga0213875_10004683
971 Ga0213875_10059905
972 Ga0209436_100035
973 Ga0209563_104900
974 Ga0207425_1002132
975 Ga0207425_1012579
976 Ga0209677_101018
977 Ga0209148_1000475
978 Ga0209129_1003154
979 Ga0209129_1005382
980 Ga0209455_1001935
981 Ga0209673_1000067
982 Ga0209673_1000750
983 Ga0209673_1001376
984 Ga0209130_1000031
985 Ga0209130_1000467
986 Ga0209675_1002662
987 Ga0209025_1000017
988 Ga0209025_1000099
989 Ga0209025_1000397
990 Ga0209564_1000031
991 Ga0209564_1000082
992 Ga0209564_1000092
993 Ga0209564_1000511
994 Ga0209564_1000925
995 Ga0209564_1022634
996 Ga0209758_1000504
997 Ga0209758_1000585
998 Ga0209758_1001602
999 Ga0209758_1005532
1000 Ga0209758_1007908
1001 Ga0209758_1019714
1002 Ga0209050_1004942
1003 Ga0209256_1000033
1004 Ga0209256_1000170
1005 Ga0209256_1000181
1006 Ga0209256_1004342
1007 Ga0209256_1015056
1008 Ga0209256_1022722
1009 Ga0207426_1000042
1010 Ga0207426_1000065
1011 Ga0207426_1000355
1012 Ga0207426_1012996
1013 Ga0209051_1000062
1014 Ga0209051_1009790
1015 Ga0209257_1000376
1016 Ga0209257_1000970
1017 Ga0209257_1037430
1018 Ga0207705_10225043
1019 Ga0207707_10100127
1020 Ga0207707_10425776
1021 Ga0207695_10000008
1022 Ga0207695_10087976
1023 Ga0207671_10010828
1024 Ga0207662_10197196
1025 Ga0207657_10060743
1026 Ga0207652_10075415
1027 Ga0207652_10119480
1028 Ga0207652_10326275
1029 Ga0207652_10469754
1030 Ga0207646_10053281
1031 Ga0207646_10078849
1032 Ga0207659_10142049
1033 Ga0207687_10071054
1034 Ga0207700_10010378
1035 Ga0207700_10276604
1036 Ga0207664_10343807
1037 Ga0207690_10222726
1038 Ga0207661_10281098
1039 Ga0207679_10018807
1040 Ga0207679_10299600
1041 Ga0207667_10049571
1042 Ga0207712_10190524
1043 Ga0207640_10144624
1044 Ga0207658_10028464
1045 Ga0207677_10012388
1046 Ga0207677_10414397
1047 Ga0207639_10105232
1048 Ga0207639_10124095
1049 Ga0207639_10290016
1050 Ga0207678_10020039
1051 Ga0207708_10058747
1052 Ga0207702_10000325
1053 Ga0207702_10053185
1054 Ga0207676_10145019
1055 Ga0207674_10149448
1056 Ga0207675_100177673
1057 Ga0207683_10099071
1058 Ga0207698_10033601
1059 Ga0209813_10073571
1060 Ga0207428_10059159
1061 Ga0207428_10074571
1062 Ga0268266_10003379
1063 Ga0268266_10087468
1064 Ga0268265_10178697
1065 Ga0307513_10213258
1066 Ga0307513_10269250
1067 Ga0265314_10010424
1068 Ga0307516_10023182
1069 Ga0307516_10196893
1070 Ga0307516_10393820
1071 Ga0307510_10008141
1072 Ga0373955_0043094
1073 Ga0373937_0191104
1074 Ga0373937_0274478
1075 Ga0395899_0005619
1076 Ga0395899_0013520
1077 Ga0395900_0003232
1078 Ga0395900_0008561
1079 Ga0395900_0018325
1080 Ga0395900_0529655
1081 Ga0395898_0007511
1082 Ga0395898_0009099
1083 Ga0395905_0014555
1084 Ga0436364_0063930
1085 Ga0436364_0103156
1086 Ga0436364_0533917
1087 Ga0436364_0642169
1088 Ga0436364_0659865
1089 Ga0436364_0674187
1090 Ga0436364_1379234
1091 Ga0395901_0011181
1092 Ga0395901_0012192
1093 Ga0395901_0159895
1094 Ga0395901_0456464
1095 Ga0436365_0138565
1096 Ga0436365_0481731
1097 Ga0436365_0712519
1098 Ga0436365_0879300
1099 Ga0436365_1535876
1100 Ga0436365_1736919
1101 Ga0436360_0178193
1102 Ga0436360_1090709
1103 Ga0436361_0606306
1104 Ga0436363_0282535
1105 Ga0436363_0472610
1106 Ga0436363_1477180
1107 Ga0436362_0822437
1108 Ga0439453_0001749
1109 Ga0451802_0956542
1110 Ga0451837_1690335
1111 Ga0451839_0668746
1112 Ga0451841_0665146
1113 Ga0451841_0873827
1114 Ga0451847_0365642
1115 Ga0451847_0833553
1116 Ga0451849_0492377
1117 Ga0451843_0493458
1118 Ga0451843_1370099
1119 Ga0451853_2198736
1120 Ga0439458_0027395
1121 Ga0439464_0028317
1122 Ga0451577_0013112
1123 Ga0466961_0000154
1124 Ga0466963_0044844
1125 Ga0466963_0145165
1126 Ga0466970_0024331
1127 Ga0451576_0000231
1128 Ga0466967_0008224
1129 Ga0495638_0000475
1130 Ga0495638_0017603
1131 Ga0495651_0017859
1132 Ga0495664_0077379
1133 Ga0495585_0058598
1134 Ga0495607_0021279
1135 Ga0495583_0117562
1136 Ga0495610_0068843
1137 Ga0495632_0054675
1138 Ga0495644_0047074
1139 Ga0495640_0145381
1140 Ga0495597_0018419
1141 Ga0495645_0029087
1142 Ga0495668_0091160
1143 Ga0495625_0065986
1144 Ga0495625_0149096
1145 Ga0495670_0079396
1146 Ga0495589_0196969
1147 Ga0495660_0133140
1148 Ga0495604_0157604
1149 Ga0495680_0209890
1150 Ga0495683_0074182
1151 Ga0495687_097650
1152 Ga0495685_063961
1153 Ga0495681_0119790
1154 Ga0495686_0038269
1155 Ga0496100_0020009
1156 Ga0496102_0202039
1157 Ga0496103_0073279
1158 Ga0496104_0082985
1159 Ga0496105_0021632
1160 Ga0496107_0015042
1161 Ga0496108_0075698
1162 Ga0496110_0043688
1163 Ga0496111_0032362
1164 Ga0496112_0088237
1165 Ga0496114_0019685
1166 Ga0496115_0002706
1167 Ga0496116_0009436
1168 Ga0496117_0017924
1169 Ga0496117_0071594
1170 Ga0496117_0087353
1171 Ga0496118_0002068
1172 Ga0496118_0028344
1173 Ga0496119_0008868
1174 Ga0496120_0276800
1175 Ga0496121_0000406
1176 Ga0496122_0023409
1177 Ga0496122_0026726
1178 Ga0496125_0000145
1179 Ga0496125_0000471
1180 Ga0496125_0010847
1181 Ga0501031_0013786
1182 Ga0501033_0010498
1183 Ga0501034_0022087
1184 Ga0501034_0036019
1185 Ga0501034_0096432
1186 Ga0501034_0145736
1187 Ga0501036_0666533
1188 Ga0501037_0000107
1189 Ga0501037_0093876
1190 Ga0501037_0186493
1191 Ga0501038_0027545
1192 Ga0501038_0028509
1193 Ga0501038_0098912
1194 Ga0501043_0000005
1195 Ga0501043_0067753
1196 Ga0501046_0191968
1197 Ga0501047_0061392
1198 Ga0501069_0000033
1199 Ga0501070_0000913
1200 Ga0501073_0060391
1201 Ga0501074_0000571
1202 Ga0501076_0176737
1203 Ga0501083_0000355
1204 Ga0501083_0028777
1205 Ga0501035_0000086
1206 Ga0501035_0228322
1207 Ga0501044_0000223
1208 Ga0501044_0018528
1209 Ga0501044_0072326
1210 Ga0501044_0107423
1211 Ga0501044_0114589
1212 Ga0501045_0099903
1213 nmdc:mga03683_70184_c1
1214 nmdc:mga03683_70474_c1
1215 nmdc:mga03n38_10745_c1
1216 nmdc:mga03n38_157664_c1
1217 nmdc:mga00v17_104960_c1
1218 nmdc:mga00v17_14_c1
1219 nmdc:mga0yw44_112489_c1
1220 nmdc:mga0yw44_250837_c1
1221 nmdc:mga0yw44_3294_c1
1222 nmdc:mga0yw44_7443_c1
1223 nmdc:mga0k408_45159_c1
1224 nmdc:mga06z11_11047_c1
1225 nmdc:mga06z11_160131_c1
1226 nmdc:mga05p37_106889_c1
1227 nmdc:mga09592_188763_c1
1228 nmdc:mga09592_45885_c1
1229 nmdc:mga09592_53176_c1
1230 nmdc:mga0qj67_132735_c1
1231 nmdc:mga0qj67_238091_c1
1232 nmdc:mga0qj67_27792_c1
1233 nmdc:mga0qj67_51412_c1
1234 nmdc:mga06r32_12511_c1
1235 nmdc:mga06r32_235229_c1
1236 nmdc:mga06r32_245293_c1
1237 nmdc:mga06r32_4390_c1
1238 nmdc:mga06r32_941408_c1
1239 nmdc:mga08y16_230140_c1
1240 nmdc:mga08y16_438965_c1
1241 nmdc:mga08y16_545866_c1
1242 nmdc:mga08y16_76334_c1
1243 nmdc:mga0sz30_74628_c1
1244 Ga0500578_0249768
1245 Ga0500643_000035
1246 Ga0500644_0060791
1247 Ga0500641_0066828
1248 Ga0500555_006777
1249 Ga0500562_022839
1250 Ga0500569_002841
1251 Ga0500569_046106
1252 Ga0500595_001183
1253 Ga0500595_002181
1254 Ga0500658_0002498
1255 Ga0500658_0044689
1256 Ga0500568_0001438
1257 Ga0500568_0016475
1258 Ga0500568_0143808
1259 Ga0500577_0033238
1260 Ga0500616_0000472
1261 Ga0500616_0026922
1262 Ga0500634_0000507
1263 Ga0500634_0073408
1264 Ga0500638_009653
1265 Ga0500636_0001753
1266 Ga0500637_0000138
1267 Ga0500609_000759
1268 Ga0500601_000712
1269 Ga0500661_000130
1270 Ga0466962_0101240
1271 2503200951
1272 2508728166
1273 2509144701
1274 2509369537
1275 2509385617
1276 2509448335
1277 2510136429
1278 2510319291
1279 2510892308
1280 2511198102
1281 2511394989
1282 2513568058
1283 2513578388
1284 2513591257
1285 2513630999
1286 2513711081
1287 2513999351
1288 2514021105
1289 2514423072
1290 2515632215
1291 2515643533
1292 2515658332
1293 2515738118
1294 2517041200
1295 2517080174
1296 2517098175
1297 2517410062
1298 2530644670
1299 2585525578
1300 2585538689
1301 2585836642
1302 2597814606
1303 2616294743
1304 2643814631
1305 2644730069
1306 2644746170
1307 2688597244
1308 2715501879
1309 2719184499
1310 2719388562
1311 2719388581
1312 2719668392
1313 2719728519
1314 2720489085
1315 2720609777
1316 2720617209
1317 2720628350
1318 2720772304
1319 2721144207
1320 2721156305
1321 2721161582
1322 2721403187
1323 2721403206
1324 2722842727
1325 2723029725
1326 2723564094
1327 2723570212
1328 2723577073
1329 2724035544
1330 2724035563
1331 2724041544
1332 2724092333
1333 2724101759
1334 2724112709
1335 2725947834
1336 2730110258
1337 2730160615
1338 2730295838
1339 2739034112
1340 2753361093
1341 2758637829
1342 2766065111
1343 2793297445
1344 2793317318
1345 2793323110
1346 2793329872
1347 2793336602
1348 2793344511
1349 2793345379
1350 2793354924
1351 2793358163
1352 2793369827
1353 2805927144
1354 2805934430
1355 2806042909
1356 2806050862
1357 2806057970
1358 2806065317
1359 2806076800
1360 2819720105
1361 2828310327
1362 2835316039
1363 2838016391
1364 2838028328
1365 2838045839
1366 2838049498
1367 2838065227
1368 2838068927
1369 2838669552
1370 2838686244
1371 2838687469
1372 2838701924
1373 2838713951
1374 2838734119
1375 2838746571
1376 2841766118
1377 2841854019
1378 2841869339
1379 2842083349
1380 2842116732
1381 2842124296
1382 2842159614
1383 2842164063
1384 2842182816
1385 2842198539
1386 2842204304
1387 2842209371
1388 2842221591
1389 2842232527
1390 2842243368
1391 2842247230
1392 2842251653
1393 2842259083
1394 2842265263
1395 2842272497
1396 2842282585
1397 2842297550
1398 2842309831
1399 2842313404
1400 2842323361
1401 2842344113
1402 2842376579
1403 2842383832
1404 2842390975
1405 2842396473
1406 2842405726
1407 2842412310
1408 2842418956
1409 2842423073
1410 2842428684
1411 2842435297
1412 2842441840
1413 2842448114
1414 2842463108
1415 2842469628
1416 2842489630
1417 2842500462
1418 2842525143
1419 2842695716
1420 2842777250
1421 2844012627
1422 2844105884
1423 2844460465
1424 2851186382
1425 2851246240
1426 2854899956
1427 2856334866
1428 2856341583
1429 2856347706
1430 2856352999
1431 2856362010
1432 2857373248
1433 2857518030
1434 2869171175
1435 2869238807
1436 2869248133
1437 2869251560
1438 2869260095
1439 2869271068
1440 2869277774
1441 2871436915
1442 2871454630
1443 2871465715
1444 2871487692
1445 2871493618
1446 2871497151
1447 2874110346
1448 2874122791
1449 2874137122
1450 2874167956
1451 2874632158
1452 2876389737
1453 2876402861
1454 2876410527
1455 2876427447
1456 2878737482
1457 2878756191
1458 2878761372
1459 2878768339
1460 2878775068
1461 2878783594
1462 2881156999
1463 2881851600
1464 2881860304
1465 2881864925
1466 2882633809
1467 2882918125
1468 2883577390
1469 2885321319
1470 2885343950
1471 2885352797
1472 2888348047
1473 2888356719
1474 2888393539
1475 2889023299
1476 2894237774
1477 2894776640
1478 2894822088
1479 2903502878
1480 2903541946
1481 2906363078
1482 2906364668
1483 2906376936
1484 2906389595
1485 2906401129
1486 2906401782
1487 2906411357
1488 2917703899
1489 2919102789
1490 2922135486
1491 2922155928
1492 2922177625
1493 2922179333
1494 2922192520
1495 2924716945
1496 2924737865
1497 2924742681
1498 2924749427
1499 2924757664
1500 2924765984
1501 2924787761
1502 2929202996
1503 2933576273
1504 2933592948
1505 2933599595
1506 2935773905
1507 2935788659
1508 2935795715
1509 2935900993
1510 2935903164
1511 2936374399
1512 2936378759
1513 2936386549
1514 2937862656
1515 2937870048
1516 2937981210
1517 2937995802
1518 2958105499
1519 2958115082
1520 2958129824
1521 2958158293
1522 2958166274
1523 2958178763
1524 2961129930
1525 2961164736
1526 2961172479
1527 2961184365
1528 2965019562
1529 2965027621
1530 2965036221
1531 2965043330
1532 2965049654
1533 2965090548
1534 2965107374
1535 2965111228
1536 2965119757
1537 2967997695
1538 2968008346
1539 2968141126
1540 2968173138
1541 2970495187
1542 2970505073
1543 2970531949
1544 2970547656
1545 2970552322
1546 2970556228
1547 2970626597
1548 2970627861
1549 2977825372
1550 2977832682
1551 2977852029
1552 2977873863
1553 2977905078
1554 2977914961
1555 2977916508
1556 2977941666
1557 2977951032
1558 2977960464
1559 2977974932
1560 2979716026
1561 2979750769
1562 2979769648
1563 2979779733
1564 2979797187
1565 2979809794
1566 2987648178
1567 2987660745
1568 2987668500
1569 2987680946
1570 2996316207
1571 2996390031
1572 2996894491
1573 3004189793
1574 3004203512
1575 3004235875
1576 3004243286
1577 3004253659
1578 3004273896
1579 3005413507
1580 3005452049
1581 3005599513
1582 3005715184
1583 639644988
1584 649871797
1585 8004302835
1586 8004312760
1587 8004365152
1588 8004377780
1589 8004397839
1590 8004702367
1591 8004731568
1592 8005277278
1593 8005277297
1594 8005287613
1595 8005295520
1596 8005306310
1597 8005307933
1598 8005379798
1599 8005383403
1600 8005398997
1601 8005431769
1602 8005502600
1603 8005562360
1604 8005565522
1605 8005575762
1606 8005623807
1607 8005626366
1608 8005674029
1609 8005693994
1610 8005701816
1611 8018131905
1612 8018150446
1613 8018165502
1614 8018182373
1615 8023688085
1616 8024485040
1617 8024507170
1618 8055622158
1619 8055916096
1620 8056375043
1621 8056382491
1622 8056968301
1623 8057531534
1624 8057878015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

120

308

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8822 28 284
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8655 28 284
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8509 27 294
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8488 24 284
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.848 26 294
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9257 28 284 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9167 28 290 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9126 28 290 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9101 28 290 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9008 14 284 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A660RIG7-F1-model_v4 Carbohydrate ABC transporter permease 0.9644 36 284 GO:0005886
GO:0055085
AF-A0A1F7MT14-F1-model_v4 Sugar ABC transporter permease 0.9602 27 273 GO:0005886
GO:0055085
AF-A0A660RIG7-F1-model_v4 Carbohydrate ABC transporter permease 0.9494 36 284 GO:0005886
GO:0055085
AF-A0A2V6RI67-F1-model_v4 Sugar ABC transporter permease 0.9484 70 295 GO:0005886
GO:0055085
AF-A0A023XWK9-F1-model_v4 deleted 0.9449 37 299

Map