F481902
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 556 | 1624 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0060485|Ga0495585_0060485_683_1678 |
| Length | 331 |
| Sequence | MGNCVRSAKRYRLAGSGRIPNRPLPLTRIAPDDEIMSPAARPLAPADRRFLTGLIGAPIAHSASPAMHERAAEALGAHCHYQLIEVAGAGREELQLLLDGVRRLGFAGVNVTFPYKEAVVSLLDELSPGAQAIGAVNTVVVRDGRLIGYNTDTTGFARAITELVRDPAQSTVAVIGAGGVGKAITFALAGIGVAEIRIFDTDRAKATQLAGQIGKRGNTSVARSVEDAMRGATGVVNGSPVGMLPNRGTPVPDALLHKGVWVADAVYTPLWTPLLNAAKAKGAEVMTGRELAIYQAADAFELFTGLKPSAVEMGNAFDAVMAKRYAKVNAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 65 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 66 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 95 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 96 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 97 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 166 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 167 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 168 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 169 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 188 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 189 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 293 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 294 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 295 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 311 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 313 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 314 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 316 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 318 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 319 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 320 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 321 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 322 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 323 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 324 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 330 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 331 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 332 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 335 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 336 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 337 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 339 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 341 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 342 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 343 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 344 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 345 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 346 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 347 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 348 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 349 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 350 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 351 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 352 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 353 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 354 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 355 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 356 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 357 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 358 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 359 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 360 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 361 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 362 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 363 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 364 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 365 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 366 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 367 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 368 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 369 | 2791355199 | |||
| 370 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 371 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 372 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 373 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 374 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 375 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 376 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 377 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 378 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 379 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 380 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 381 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 382 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 383 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 384 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 385 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 386 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 387 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 388 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 389 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 390 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 391 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 392 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 393 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 394 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 395 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 396 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 397 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 398 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 399 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 400 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 401 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 402 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 403 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 404 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 405 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 406 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 407 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 408 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 409 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 410 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 411 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 412 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 413 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 414 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 415 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 416 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 417 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 418 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 419 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 420 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 421 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 422 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 423 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 424 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 425 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 426 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 427 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 428 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 429 | 2904699407 | |||
| 430 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 431 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 432 | 2906610324 | |||
| 433 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 434 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 435 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 436 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 437 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 438 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 439 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 440 | 2922368715 | |||
| 441 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 442 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 443 | 2922425934 | |||
| 444 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 445 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 446 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 447 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 448 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 449 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 450 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 451 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 452 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 453 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 454 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 455 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 456 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 457 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 458 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 459 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 460 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 461 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 462 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 463 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 464 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 465 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 466 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 467 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 468 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 469 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 470 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 471 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 472 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 473 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 474 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 475 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 476 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 477 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 478 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 479 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 480 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 481 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 482 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 483 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 484 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 485 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 486 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 487 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 488 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 489 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 490 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 491 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 492 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 493 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 494 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 495 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 496 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 497 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 498 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 499 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 500 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 501 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 502 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 503 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 504 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 505 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 506 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 507 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 508 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 509 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 510 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 511 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 512 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 513 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 514 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 515 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 516 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 517 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 518 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 519 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 520 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 521 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 522 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 523 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 524 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 525 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 526 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 527 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 528 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 529 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 530 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 531 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 532 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 533 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 534 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 535 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 536 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 537 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 538 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 539 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 540 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 541 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 542 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 543 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 544 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 545 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 546 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 547 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 548 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 549 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 550 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 551 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 552 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 553 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 554 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 555 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 556 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.1 |
| Metatranscriptomes | 0 |
| Isolates | 25.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.5 |
| Nodule | 21.92 |
| Rhizoplane | 4.43 |
| Rhizosphere | 44.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495585_0060485 | 3300046492 | Bacteria | 2084 |
| 2 | JGI25153J46596_10000546 | 3300003215 | Bacteria | 23492 |
| 3 | JGI25153J46596_10002402 | 3300003215 | Bacteria | 10814 |
| 4 | JGI25153J46596_10002991 | 3300003215 | Bacteria | 9566 |
| 5 | JGI25153J46596_10003079 | 3300003215 | Bacteria | 9412 |
| 6 | JGI25153J46596_10006476 | 3300003215 | Bacteria | 5908 |
| 7 | JGI25153J46596_10006750 | 3300003215 | Bacteria | 5756 |
| 8 | JGI25160J50197_1002937 | 3300003354 | Bacteria | 7791 |
| 9 | JGI25160J50197_1010766 | 3300003354 | Bacteria | 3287 |
| 10 | Ga0055531_10022050 | 3300003794 | Bacteria | 2444 |
| 11 | Ga0055543_1005955 | 3300004625 | Bacteria | 3029 |
| 12 | Ga0065165_1001155 | 3300005262 | Bacteria | 30824 |
| 13 | Ga0065165_1002140 | 3300005262 | Bacteria | 17914 |
| 14 | Ga0065165_1006888 | 3300005262 | Bacteria | 5774 |
| 15 | Ga0070658_10032489 | 3300005327 | Bacteria | 4195 |
| 16 | Ga0068869_100042236 | 3300005334 | Bacteria | 3268 |
| 17 | Ga0070666_10453064 | 3300005335 | Bacteria | 926 |
| 18 | Ga0068868_100059877 | 3300005338 | Bacteria | 3013 |
| 19 | Ga0070660_100001075 | 3300005339 | Bacteria | 18360 |
| 20 | Ga0070660_100064745 | 3300005339 | Bacteria | 2845 |
| 21 | Ga0070691_10024348 | 3300005341 | Bacteria | 2814 |
| 22 | Ga0070661_100058898 | 3300005344 | Bacteria | 2815 |
| 23 | Ga0070692_10262534 | 3300005345 | Bacteria | 1039 |
| 24 | Ga0070668_100059132 | 3300005347 | Bacteria | 2967 |
| 25 | Ga0070669_100195727 | 3300005353 | Bacteria | 1588 |
| 26 | Ga0070675_100279899 | 3300005354 | Bacteria | 1465 |
| 27 | Ga0070671_100160445 | 3300005355 | Bacteria | 1901 |
| 28 | Ga0070671_100179287 | 3300005355 | Bacteria | 1793 |
| 29 | Ga0070671_100305345 | 3300005355 | Bacteria | 1355 |
| 30 | Ga0070659_100065729 | 3300005366 | Bacteria | 2873 |
| 31 | Ga0070659_100076877 | 3300005366 | Bacteria | 2661 |
| 32 | Ga0070667_100041698 | 3300005367 | Bacteria | 3850 |
| 33 | Ga0070709_10000324 | 3300005434 | Bacteria | 30045 |
| 34 | Ga0070714_100029600 | 3300005435 | Bacteria | 4553 |
| 35 | Ga0070714_100053032 | 3300005435 | Bacteria | 3460 |
| 36 | Ga0070713_100402554 | 3300005436 | Bacteria | 1278 |
| 37 | Ga0070710_10002222 | 3300005437 | Bacteria | 9169 |
| 38 | Ga0070710_10112105 | 3300005437 | Bacteria | 1640 |
| 39 | Ga0070711_100000621 | 3300005439 | Bacteria | 18488 |
| 40 | Ga0070663_100086070 | 3300005455 | Bacteria | 2321 |
| 41 | Ga0070678_100015205 | 3300005456 | Bacteria | 4884 |
| 42 | Ga0070678_100191992 | 3300005456 | Bacteria | 1680 |
| 43 | Ga0070681_10327748 | 3300005458 | Bacteria | 1441 |
| 44 | Ga0070679_100074543 | 3300005530 | Bacteria | 3384 |
| 45 | Ga0070679_100079032 | 3300005530 | Bacteria | 3279 |
| 46 | Ga0070684_100053529 | 3300005535 | Bacteria | 3514 |
| 47 | Ga0068853_100030716 | 3300005539 | Bacteria | 4539 |
| 48 | Ga0068853_100056431 | 3300005539 | Bacteria | 3386 |
| 49 | Ga0070665_100044229 | 3300005548 | Bacteria | 4472 |
| 50 | Ga0070665_100164262 | 3300005548 | Bacteria | 2223 |
| 51 | Ga0068855_100040085 | 3300005563 | Bacteria | 5559 |
| 52 | Ga0068855_100057744 | 3300005563 | Bacteria | 4548 |
| 53 | Ga0070664_100130533 | 3300005564 | Bacteria | 2207 |
| 54 | Ga0070664_100334796 | 3300005564 | Bacteria | 1374 |
| 55 | Ga0068857_100025038 | 3300005577 | Bacteria | 5257 |
| 56 | Ga0068857_100074121 | 3300005577 | Bacteria | 3033 |
| 57 | Ga0068857_100195779 | 3300005577 | Bacteria | 1841 |
| 58 | Ga0068854_100090460 | 3300005578 | Bacteria | 2276 |
| 59 | Ga0068856_100016067 | 3300005614 | Bacteria | 7235 |
| 60 | Ga0070702_100351922 | 3300005615 | Bacteria | 1038 |
| 61 | Ga0068852_100112800 | 3300005616 | Bacteria | 2474 |
| 62 | Ga0068859_100247995 | 3300005617 | Bacteria | 1871 |
| 63 | Ga0068864_100195064 | 3300005618 | Bacteria | 1858 |
| 64 | Ga0068864_100230576 | 3300005618 | Bacteria | 1712 |
| 65 | Ga0068861_100082221 | 3300005719 | Bacteria | 2523 |
| 66 | Ga0068861_100110642 | 3300005719 | Bacteria | 2200 |
| 67 | Ga0068870_10115852 | 3300005840 | Bacteria | 1537 |
| 68 | Ga0068863_100111652 | 3300005841 | Bacteria | 2603 |
| 69 | Ga0068858_100016761 | 3300005842 | Bacteria | 6881 |
| 70 | Ga0068858_100273209 | 3300005842 | Bacteria | 1608 |
| 71 | Ga0068860_100080172 | 3300005843 | Bacteria | 3104 |
| 72 | Ga0068860_100229846 | 3300005843 | Bacteria | 1802 |
| 73 | Ga0068862_100035365 | 3300005844 | Bacteria | 4230 |
| 74 | Ga0068862_100168500 | 3300005844 | Bacteria | 1959 |
| 75 | Ga0068862_100261091 | 3300005844 | Bacteria | 1581 |
| 76 | Ga0081455_10014700 | 3300005937 | Bacteria | 7645 |
| 77 | Ga0081455_10061650 | 3300005937 | Bacteria | 3155 |
| 78 | Ga0081455_10161147 | 3300005937 | Bacteria | 1719 |
| 79 | Ga0081540_1006462 | 3300005983 | Bacteria | 8532 |
| 80 | Ga0081540_1010349 | 3300005983 | Bacteria | 6326 |
| 81 | Ga0081540_1012280 | 3300005983 | Bacteria | 5655 |
| 82 | Ga0081540_1036187 | 3300005983 | Bacteria | 2636 |
| 83 | Ga0081539_10039936 | 3300005985 | Bacteria | 2762 |
| 84 | Ga0075365_10001198 | 3300006038 | Bacteria | 11427 |
| 85 | Ga0075365_10006757 | 3300006038 | Bacteria | 6347 |
| 86 | Ga0075365_10009402 | 3300006038 | Bacteria | 5617 |
| 87 | Ga0075365_10011386 | 3300006038 | Bacteria | 5229 |
| 88 | Ga0075365_10113758 | 3300006038 | Bacteria | 1862 |
| 89 | Ga0075365_10183503 | 3300006038 | Bacteria | 1463 |
| 90 | Ga0075368_10005851 | 3300006042 | Bacteria | 4255 |
| 91 | Ga0075368_10049991 | 3300006042 | Bacteria | 1659 |
| 92 | Ga0075368_10063018 | 3300006042 | Bacteria | 1487 |
| 93 | Ga0075364_10009412 | 3300006051 | Bacteria | 5861 |
| 94 | Ga0075364_10058870 | 3300006051 | Bacteria | 2518 |
| 95 | Ga0070715_10001188 | 3300006163 | Bacteria | 7488 |
| 96 | Ga0070715_10196377 | 3300006163 | Bacteria | 1022 |
| 97 | Ga0070716_100001795 | 3300006173 | Bacteria | 9720 |
| 98 | Ga0070712_100031848 | 3300006175 | Bacteria | 3556 |
| 99 | Ga0075362_10009436 | 3300006177 | Bacteria | 3774 |
| 100 | Ga0075362_10056307 | 3300006177 | Bacteria | 1769 |
| 101 | Ga0075367_10005172 | 3300006178 | Bacteria | 6447 |
| 102 | Ga0075367_10042065 | 3300006178 | Bacteria | 2673 |
| 103 | Ga0075369_10021492 | 3300006186 | Bacteria | 2653 |
| 104 | Ga0075369_10073822 | 3300006186 | Bacteria | 1504 |
| 105 | Ga0075369_10093354 | 3300006186 | Bacteria | 1344 |
| 106 | Ga0075366_10066209 | 3300006195 | Bacteria | 2149 |
| 107 | Ga0075366_10089129 | 3300006195 | Bacteria | 1847 |
| 108 | Ga0075370_10029295 | 3300006353 | Bacteria | 3066 |
| 109 | Ga0075370_10148264 | 3300006353 | Bacteria | 1374 |
| 110 | Ga0075428_100107748 | 3300006844 | Bacteria | 3036 |
| 111 | Ga0097620_100248011 | 3300006931 | Bacteria | 1871 |
| 112 | Ga0099825_1039521 | 3300006941 | Bacteria | 1444 |
| 113 | Ga0099824_1009891 | 3300006942 | Bacteria | 11523 |
| 114 | Ga0099823_1048339 | 3300006944 | Bacteria | 2710 |
| 115 | Ga0075435_100088713 | 3300007076 | Bacteria | 2550 |
| 116 | Ga0099794_10012276 | 3300007265 | Bacteria | 3691 |
| 117 | Ga0105240_10003126 | 3300009093 | Bacteria | 26076 |
| 118 | Ga0105240_10020444 | 3300009093 | Bacteria | 8831 |
| 119 | Ga0105240_10339512 | 3300009093 | Bacteria | 1707 |
| 120 | Ga0111539_10680147 | 3300009094 | Bacteria | 1198 |
| 121 | Ga0105245_10143854 | 3300009098 | Bacteria | 2248 |
| 122 | Ga0105247_10022493 | 3300009101 | Bacteria | 3796 |
| 123 | Ga0114129_10037785 | 3300009147 | Bacteria | 6814 |
| 124 | Ga0105241_10015960 | 3300009174 | Bacteria | 5503 |
| 125 | Ga0105241_10215624 | 3300009174 | Bacteria | 1610 |
| 126 | Ga0105248_10021406 | 3300009177 | Bacteria | 7164 |
| 127 | Ga0105248_10038765 | 3300009177 | Bacteria | 5334 |
| 128 | Ga0105237_10000859 | 3300009545 | Bacteria | 41301 |
| 129 | Ga0105237_10034201 | 3300009545 | Bacteria | 5147 |
| 130 | Ga0105238_10000767 | 3300009551 | Bacteria | 33436 |
| 131 | Ga0105238_10149736 | 3300009551 | Bacteria | 2309 |
| 132 | Ga0105238_10203961 | 3300009551 | Bacteria | 1953 |
| 133 | Ga0105238_10463446 | 3300009551 | Bacteria | 1265 |
| 134 | Ga0105249_10145888 | 3300009553 | Bacteria | 2274 |
| 135 | Ga0105249_10150335 | 3300009553 | Bacteria | 2241 |
| 136 | Ga0105249_10208784 | 3300009553 | Bacteria | 1915 |
| 137 | Ga0099796_10000291 | 3300010159 | Bacteria | 7896 |
| 138 | Ga0105239_10021858 | 3300010375 | Bacteria | 7053 |
| 139 | Ga0105239_10032270 | 3300010375 | Bacteria | 5756 |
| 140 | Ga0105246_10034814 | 3300011119 | Bacteria | 3359 |
| 141 | Ga0105246_10050886 | 3300011119 | Bacteria | 2843 |
| 142 | Ga0157370_10014068 | 3300013104 | Bacteria | 8211 |
| 143 | Ga0157369_10043256 | 3300013105 | Bacteria | 4911 |
| 144 | Ga0157374_10040096 | 3300013296 | Bacteria | 4311 |
| 145 | Ga0157374_10326209 | 3300013296 | Bacteria | 1522 |
| 146 | Ga0157378_10032924 | 3300013297 | Bacteria | 4582 |
| 147 | Ga0163162_10108209 | 3300013306 | Bacteria | 2876 |
| 148 | Ga0163162_10153664 | 3300013306 | Bacteria | 2420 |
| 149 | Ga0163162_10200594 | 3300013306 | Bacteria | 2124 |
| 150 | Ga0157375_10120296 | 3300013308 | Bacteria | 2734 |
| 151 | Ga0163163_10053931 | 3300014325 | Bacteria | 3970 |
| 152 | Ga0157380_10288343 | 3300014326 | Bacteria | 1506 |
| 153 | Ga0157377_10112047 | 3300014745 | Bacteria | 1641 |
| 154 | Ga0157379_10152113 | 3300014968 | Bacteria | 2087 |
| 155 | Ga0157376_10127804 | 3300014969 | Bacteria | 2263 |
| 156 | Ga0163161_10151307 | 3300017792 | Bacteria | 1764 |
| 157 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 158 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 159 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 160 | Ga0214545_1016668 | 3300021324 | Bacteria | 7477 |
| 161 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 162 | Ga0213876_10016680 | 3300021384 | Bacteria | 3880 |
| 163 | Ga0209677_110514 | 3300025253 | Bacteria | 1530 |
| 164 | Ga0209148_1000351 | 3300025254 | Bacteria | 59739 |
| 165 | Ga0209233_1008082 | 3300025261 | Bacteria | 3284 |
| 166 | Ga0209233_1041648 | 3300025261 | Bacteria | 991 |
| 167 | Ga0209455_1002831 | 3300025272 | Bacteria | 6445 |
| 168 | Ga0209673_1036314 | 3300025273 | Bacteria | 1463 |
| 169 | Ga0209130_1027079 | 3300025284 | Bacteria | 1222 |
| 170 | Ga0209564_1000297 | 3300025295 | Bacteria | 100091 |
| 171 | Ga0209564_1006838 | 3300025295 | Bacteria | 6023 |
| 172 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 173 | Ga0209758_1000886 | 3300025297 | Bacteria | 41032 |
| 174 | Ga0209758_1001252 | 3300025297 | Bacteria | 31479 |
| 175 | Ga0209758_1001829 | 3300025297 | Bacteria | 23439 |
| 176 | Ga0209758_1002026 | 3300025297 | Bacteria | 21780 |
| 177 | Ga0209758_1009050 | 3300025297 | Bacteria | 6282 |
| 178 | Ga0209758_1009164 | 3300025297 | Bacteria | 6227 |
| 179 | Ga0209256_1005506 | 3300025299 | Bacteria | 7244 |
| 180 | Ga0207426_1000585 | 3300025302 | Bacteria | 48529 |
| 181 | Ga0207426_1000734 | 3300025302 | Bacteria | 37516 |
| 182 | Ga0207426_1004869 | 3300025302 | Bacteria | 6358 |
| 183 | Ga0207426_1023553 | 3300025302 | Bacteria | 2099 |
| 184 | Ga0207426_1039285 | 3300025302 | Bacteria | 1483 |
| 185 | Ga0209257_1001348 | 3300025304 | Bacteria | 29776 |
| 186 | Ga0209257_1016267 | 3300025304 | Bacteria | 3021 |
| 187 | Ga0209257_1025898 | 3300025304 | Bacteria | 1991 |
| 188 | Ga0207692_10000791 | 3300025898 | Bacteria | 11236 |
| 189 | Ga0207692_10044644 | 3300025898 | Bacteria | 2212 |
| 190 | Ga0207710_10119840 | 3300025900 | Bacteria | 1256 |
| 191 | Ga0207688_10040389 | 3300025901 | Bacteria | 2593 |
| 192 | Ga0207688_10041194 | 3300025901 | Bacteria | 2568 |
| 193 | Ga0207699_10006573 | 3300025906 | Bacteria | 5641 |
| 194 | Ga0207645_10018670 | 3300025907 | Bacteria | 4555 |
| 195 | Ga0207645_10033885 | 3300025907 | Bacteria | 3282 |
| 196 | Ga0207643_10033625 | 3300025908 | Bacteria | 2870 |
| 197 | Ga0207705_10102740 | 3300025909 | Bacteria | 2104 |
| 198 | Ga0207705_10478384 | 3300025909 | Bacteria | 967 |
| 199 | Ga0207654_10022669 | 3300025911 | Bacteria | 3353 |
| 200 | Ga0207707_10005939 | 3300025912 | Bacteria | 10685 |
| 201 | Ga0207707_10176300 | 3300025912 | Unclassified | 1867 |
| 202 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 203 | Ga0207671_10007730 | 3300025914 | Bacteria | 9263 |
| 204 | Ga0207671_10122656 | 3300025914 | Bacteria | 1987 |
| 205 | Ga0207671_10248994 | 3300025914 | Bacteria | 1397 |
| 206 | Ga0207693_10021506 | 3300025915 | Bacteria | 5125 |
| 207 | Ga0207660_10001773 | 3300025917 | Bacteria | 14441 |
| 208 | Ga0207657_10043219 | 3300025919 | Bacteria | 3971 |
| 209 | Ga0207652_10009669 | 3300025921 | Bacteria | 7756 |
| 210 | Ga0207652_10240859 | 3300025921 | Bacteria | 1631 |
| 211 | Ga0207694_10235277 | 3300025924 | Bacteria | 1496 |
| 212 | Ga0207700_10013498 | 3300025928 | Bacteria | 5318 |
| 213 | Ga0207664_10004165 | 3300025929 | Bacteria | 9765 |
| 214 | Ga0207664_10009713 | 3300025929 | Bacteria | 6764 |
| 215 | Ga0207664_10028124 | 3300025929 | Bacteria | 4270 |
| 216 | Ga0207644_10094115 | 3300025931 | Bacteria | 2238 |
| 217 | Ga0207690_10021506 | 3300025932 | Bacteria | 4002 |
| 218 | Ga0207706_10028409 | 3300025933 | Bacteria | 4996 |
| 219 | Ga0207706_10112362 | 3300025933 | Bacteria | 2397 |
| 220 | Ga0207709_10049743 | 3300025935 | Bacteria | 2560 |
| 221 | Ga0207665_10003002 | 3300025939 | Bacteria | 11325 |
| 222 | Ga0207691_10110438 | 3300025940 | Bacteria | 2446 |
| 223 | Ga0207711_10037439 | 3300025941 | Bacteria | 4120 |
| 224 | Ga0207689_10096737 | 3300025942 | Bacteria | 2425 |
| 225 | Ga0207689_10162267 | 3300025942 | Bacteria | 1841 |
| 226 | Ga0207689_10206302 | 3300025942 | Bacteria | 1623 |
| 227 | Ga0207661_10358101 | 3300025944 | Bacteria | 1318 |
| 228 | Ga0207667_10044922 | 3300025949 | Bacteria | 4680 |
| 229 | Ga0207651_10109268 | 3300025960 | Bacteria | 2072 |
| 230 | Ga0207668_10021221 | 3300025972 | Bacteria | 4140 |
| 231 | Ga0207668_10209291 | 3300025972 | Bacteria | 1559 |
| 232 | Ga0207640_10057950 | 3300025981 | Bacteria | 2550 |
| 233 | Ga0207677_10035608 | 3300026023 | Bacteria | 3235 |
| 234 | Ga0207703_10034619 | 3300026035 | Bacteria | 4008 |
| 235 | Ga0207703_10101106 | 3300026035 | Bacteria | 2444 |
| 236 | Ga0207639_10025841 | 3300026041 | Bacteria | 4261 |
| 237 | Ga0207678_10014301 | 3300026067 | Bacteria | 6977 |
| 238 | Ga0207678_10017811 | 3300026067 | Bacteria | 6237 |
| 239 | Ga0207678_10018068 | 3300026067 | Bacteria | 6194 |
| 240 | Ga0207678_10139876 | 3300026067 | Bacteria | 2066 |
| 241 | Ga0207708_10087412 | 3300026075 | Bacteria | 2400 |
| 242 | Ga0207648_10067620 | 3300026089 | Bacteria | 3114 |
| 243 | Ga0207676_10259124 | 3300026095 | Bacteria | 1569 |
| 244 | Ga0207674_10014693 | 3300026116 | Bacteria | 8634 |
| 245 | Ga0207674_10042218 | 3300026116 | Bacteria | 4712 |
| 246 | Ga0207675_100289962 | 3300026118 | Bacteria | 1592 |
| 247 | Ga0207683_10157971 | 3300026121 | Bacteria | 2048 |
| 248 | Ga0207683_10290724 | 3300026121 | Bacteria | 1494 |
| 249 | Ga0209389_1000015 | 3300027296 | Bacteria | 188311 |
| 250 | Ga0209389_1000029 | 3300027296 | Bacteria | 140337 |
| 251 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 252 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 253 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 254 | Ga0209489_100072 | 3300027361 | Bacteria | 138111 |
| 255 | Ga0209700_100034 | 3300027363 | Bacteria | 197276 |
| 256 | Ga0209179_1030212 | 3300027512 | Bacteria | 1107 |
| 257 | Ga0209588_1006189 | 3300027671 | Bacteria | 3465 |
| 258 | Ga0268266_10003057 | 3300028379 | Bacteria | 17106 |
| 259 | Ga0268266_10021201 | 3300028379 | Bacteria | 5535 |
| 260 | Ga0268266_10359461 | 3300028379 | Bacteria | 1370 |
| 261 | Ga0268265_10207514 | 3300028380 | Bacteria | 1704 |
| 262 | Ga0268265_10265389 | 3300028380 | Bacteria | 1529 |
| 263 | Ga0268264_10053346 | 3300028381 | Bacteria | 3372 |
| 264 | Ga0265336_10000668 | 3300028666 | Bacteria | 18619 |
| 265 | Ga0307517_10146593 | 3300028786 | Bacteria | 1636 |
| 266 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 267 | Ga0307508_10240232 | 3300031616 | Bacteria | 1409 |
| 268 | Ga0265314_10099150 | 3300031711 | Bacteria | 1877 |
| 269 | Ga0307507_10218251 | 3300033179 | Bacteria | 1287 |
| 270 | Ga0307510_10011942 | 3300033180 | Bacteria | 10295 |
| 271 | Ga0315911_1000019 | 3300033442 | Bacteria | 146597 |
| 272 | Ga0316215_1003491 | 3300033544 | Bacteria | 1498 |
| 273 | Ga0373956_0032446 | 3300035119 | Bacteria | 2291 |
| 274 | Ga0373943_0005135 | 3300035170 | Bacteria | 5892 |
| 275 | Ga0373946_0101210 | 3300035171 | Bacteria | 1292 |
| 276 | Ga0373955_0114567 | 3300035172 | Bacteria | 1561 |
| 277 | Ga0373955_0217559 | 3300035172 | Bacteria | 1140 |
| 278 | Ga0373924_0008201 | 3300035410 | Bacteria | 3789 |
| 279 | Ga0373935_0001046 | 3300035692 | Bacteria | 15076 |
| 280 | Ga0373927_0003698 | 3300035695 | Bacteria | 10879 |
| 281 | Ga0373927_0008512 | 3300035695 | Bacteria | 6901 |
| 282 | Ga0373933_0024598 | 3300035724 | Bacteria | 3447 |
| 283 | Ga0373947_0004655 | 3300035725 | Bacteria | 8046 |
| 284 | Ga0373947_0080060 | 3300035725 | Bacteria | 2020 |
| 285 | Ga0373937_0053168 | 3300036401 | Bacteria | 3715 |
| 286 | Ga0373937_0215582 | 3300036401 | Bacteria | 1806 |
| 287 | Ga0373925_0000882 | 3300037068 | Bacteria | 27403 |
| 288 | Ga0395899_0181750 | 3300037312 | Bacteria | 1476 |
| 289 | Ga0395900_0000833 | 3300037418 | Bacteria | 40657 |
| 290 | Ga0395900_0524697 | 3300037418 | Bacteria | 1132 |
| 291 | Ga0395898_0013271 | 3300037466 | Bacteria | 8486 |
| 292 | Ga0395898_0262525 | 3300037466 | Bacteria | 1647 |
| 293 | Ga0395905_0005852 | 3300037471 | Bacteria | 12494 |
| 294 | Ga0395905_0044831 | 3300037471 | Bacteria | 4149 |
| 295 | Ga0395905_0198963 | 3300037471 | Bacteria | 1879 |
| 296 | Ga0395901_0342661 | 3300038443 | Bacteria | 1544 |
| 297 | Ga0436365_1449098 | 3300039437 | Bacteria | 1645 |
| 298 | Ga0436363_0152674 | 3300039450 | Bacteria | 1464 |
| 299 | Ga0436363_1170546 | 3300039450 | Bacteria | 2475 |
| 300 | Ga0451802_1490081 | 3300041460 | Bacteria | 1050 |
| 301 | Ga0439444_0015312 | 3300042437 | Bacteria | 1294 |
| 302 | Ga0466969_0045038 | 3300044656 | Bacteria | 2191 |
| 303 | Ga0466972_0000258 | 3300044658 | Bacteria | 34985 |
| 304 | Ga0466966_0000238 | 3300044684 | Bacteria | 36401 |
| 305 | Ga0466961_0000044 | 3300044693 | Bacteria | 76071 |
| 306 | Ga0466963_0016295 | 3300044694 | Bacteria | 4620 |
| 307 | Ga0466968_0004945 | 3300044735 | Bacteria | 4992 |
| 308 | Ga0466957_0215670 | 3300044842 | Bacteria | 1265 |
| 309 | Ga0466960_0162101 | 3300044901 | Bacteria | 1201 |
| 310 | Ga0466959_0334523 | 3300045049 | Bacteria | 1034 |
| 311 | Ga0466967_0519702 | 3300045976 | Bacteria | 1170 |
| 312 | Ga0495592_0033641 | 3300046454 | Bacteria | 3866 |
| 313 | Ga0495603_0002460 | 3300046455 | Bacteria | 10893 |
| 314 | Ga0495603_0005987 | 3300046455 | Bacteria | 7272 |
| 315 | Ga0495629_0002171 | 3300046459 | Bacteria | 15153 |
| 316 | Ga0495629_0016658 | 3300046459 | Bacteria | 5275 |
| 317 | Ga0495629_0055779 | 3300046459 | Bacteria | 2763 |
| 318 | Ga0495638_0005818 | 3300046460 | Bacteria | 9070 |
| 319 | Ga0495638_0022787 | 3300046460 | Bacteria | 4107 |
| 320 | Ga0495638_0252165 | 3300046460 | Bacteria | 972 |
| 321 | Ga0495641_0012155 | 3300046461 | Bacteria | 4837 |
| 322 | Ga0495651_0047178 | 3300046462 | Bacteria | 3332 |
| 323 | Ga0495651_0052817 | 3300046462 | Bacteria | 3129 |
| 324 | Ga0495653_0031884 | 3300046463 | Bacteria | 4187 |
| 325 | Ga0495653_0136054 | 3300046463 | Bacteria | 1733 |
| 326 | Ga0495653_0296988 | 3300046463 | Bacteria | 1055 |
| 327 | Ga0495580_0005485 | 3300046472 | Bacteria | 10484 |
| 328 | Ga0495582_0000535 | 3300046473 | Bacteria | 20995 |
| 329 | Ga0495605_0164518 | 3300046474 | Bacteria | 983 |
| 330 | Ga0495639_0000244 | 3300046475 | Bacteria | 26932 |
| 331 | Ga0495662_0001710 | 3300046476 | Bacteria | 10965 |
| 332 | Ga0495664_0015373 | 3300046477 | Bacteria | 4350 |
| 333 | Ga0495584_0138228 | 3300046491 | Bacteria | 1237 |
| 334 | Ga0495585_0044202 | 3300046492 | Bacteria | 2489 |
| 335 | Ga0495594_0001209 | 3300046499 | Bacteria | 13496 |
| 336 | Ga0495594_0062339 | 3300046499 | Bacteria | 2065 |
| 337 | Ga0495607_0018452 | 3300046501 | Bacteria | 4449 |
| 338 | Ga0495606_0022953 | 3300046507 | Bacteria | 4533 |
| 339 | Ga0495606_0052046 | 3300046507 | Bacteria | 2665 |
| 340 | Ga0495608_0033003 | 3300046511 | Bacteria | 3501 |
| 341 | Ga0495608_0057267 | 3300046511 | Bacteria | 2572 |
| 342 | Ga0495608_0077929 | 3300046511 | Bacteria | 2157 |
| 343 | Ga0495616_0021483 | 3300046513 | Bacteria | 3496 |
| 344 | Ga0495616_0097955 | 3300046513 | Bacteria | 1379 |
| 345 | Ga0495616_0143346 | 3300046513 | Bacteria | 1086 |
| 346 | Ga0495618_0149979 | 3300046514 | Bacteria | 1489 |
| 347 | Ga0495620_0070271 | 3300046515 | Bacteria | 1434 |
| 348 | Ga0495628_0074059 | 3300046516 | Bacteria | 2653 |
| 349 | Ga0495628_0362317 | 3300046516 | Bacteria | 1064 |
| 350 | Ga0495630_0008971 | 3300046517 | Bacteria | 7181 |
| 351 | Ga0495631_0034805 | 3300046518 | Bacteria | 2256 |
| 352 | Ga0495631_0095131 | 3300046518 | Bacteria | 1282 |
| 353 | Ga0495637_0023152 | 3300046520 | Bacteria | 2827 |
| 354 | Ga0495643_0037331 | 3300046522 | Bacteria | 2666 |
| 355 | Ga0495644_0046228 | 3300046523 | Bacteria | 1636 |
| 356 | Ga0495648_0015033 | 3300046524 | Bacteria | 5636 |
| 357 | Ga0495648_0018081 | 3300046524 | Bacteria | 5011 |
| 358 | Ga0495648_0022334 | 3300046524 | Bacteria | 4360 |
| 359 | Ga0495648_0117542 | 3300046524 | Bacteria | 1435 |
| 360 | Ga0495652_0006687 | 3300046529 | Bacteria | 10704 |
| 361 | Ga0495652_0092769 | 3300046529 | Bacteria | 2466 |
| 362 | Ga0495652_0116127 | 3300046529 | Bacteria | 2143 |
| 363 | Ga0495665_0001927 | 3300046531 | Bacteria | 11189 |
| 364 | Ga0495640_0011531 | 3300046533 | Bacteria | 6798 |
| 365 | Ga0495640_0030678 | 3300046533 | Bacteria | 3846 |
| 366 | Ga0495640_0038204 | 3300046533 | Bacteria | 3378 |
| 367 | Ga0495640_0042066 | 3300046533 | Bacteria | 3190 |
| 368 | Ga0495587_0046902 | 3300046536 | Bacteria | 2563 |
| 369 | Ga0495609_0035942 | 3300046538 | Bacteria | 2240 |
| 370 | Ga0495597_0031143 | 3300046542 | Bacteria | 2429 |
| 371 | Ga0495597_0035593 | 3300046542 | Bacteria | 2245 |
| 372 | Ga0495645_0022180 | 3300046543 | Bacteria | 4592 |
| 373 | Ga0495622_0003099 | 3300046557 | Bacteria | 7882 |
| 374 | Ga0495622_0021149 | 3300046557 | Bacteria | 3031 |
| 375 | Ga0495622_0047249 | 3300046557 | Bacteria | 2000 |
| 376 | Ga0495667_0036546 | 3300046559 | Bacteria | 3278 |
| 377 | Ga0495667_0188679 | 3300046559 | Bacteria | 1321 |
| 378 | Ga0495656_0016437 | 3300046615 | Bacteria | 2807 |
| 379 | Ga0495668_0073887 | 3300046616 | Bacteria | 1872 |
| 380 | Ga0495668_0131715 | 3300046616 | Bacteria | 1368 |
| 381 | Ga0495668_0163237 | 3300046616 | Bacteria | 1220 |
| 382 | Ga0495634_0009148 | 3300046642 | Bacteria | 7315 |
| 383 | Ga0495634_0120745 | 3300046642 | Bacteria | 1678 |
| 384 | Ga0495634_0172734 | 3300046642 | Bacteria | 1357 |
| 385 | Ga0495635_0010698 | 3300046663 | Bacteria | 6424 |
| 386 | Ga0495635_0014509 | 3300046663 | Bacteria | 5513 |
| 387 | Ga0495635_0149767 | 3300046663 | Bacteria | 1588 |
| 388 | Ga0495588_0001193 | 3300046674 | Bacteria | 11212 |
| 389 | Ga0495588_0058679 | 3300046674 | Bacteria | 1989 |
| 390 | Ga0495588_0083342 | 3300046674 | Bacteria | 1670 |
| 391 | Ga0495657_0012827 | 3300046675 | Bacteria | 6211 |
| 392 | Ga0495657_0014120 | 3300046675 | Bacteria | 5869 |
| 393 | Ga0495657_0044727 | 3300046675 | Bacteria | 3010 |
| 394 | Ga0495599_0015254 | 3300046678 | Bacteria | 4766 |
| 395 | Ga0495599_0030631 | 3300046678 | Bacteria | 3377 |
| 396 | Ga0495623_0012533 | 3300046679 | Bacteria | 5485 |
| 397 | Ga0495646_0014943 | 3300046680 | Bacteria | 4932 |
| 398 | Ga0495646_0087275 | 3300046680 | Bacteria | 1808 |
| 399 | Ga0495647_0001826 | 3300046681 | Bacteria | 6587 |
| 400 | Ga0495658_0139698 | 3300046683 | Bacteria | 1481 |
| 401 | Ga0495613_0033811 | 3300046689 | Bacteria | 3797 |
| 402 | Ga0495624_0003980 | 3300046690 | Bacteria | 10875 |
| 403 | Ga0495624_0053135 | 3300046690 | Bacteria | 2558 |
| 404 | Ga0495670_0018866 | 3300046691 | Bacteria | 3398 |
| 405 | Ga0495670_0030396 | 3300046691 | Bacteria | 2683 |
| 406 | Ga0495671_0079710 | 3300046692 | Bacteria | 1605 |
| 407 | Ga0495649_0021090 | 3300046694 | Bacteria | 3652 |
| 408 | Ga0495589_0095991 | 3300046794 | Bacteria | 1438 |
| 409 | Ga0495600_0004461 | 3300046809 | Bacteria | 8381 |
| 410 | Ga0495581_0000264 | 3300047315 | Bacteria | 25244 |
| 411 | Ga0495581_0042277 | 3300047315 | Bacteria | 2638 |
| 412 | Ga0495581_0073663 | 3300047315 | Bacteria | 1976 |
| 413 | Ga0495604_0013466 | 3300047317 | Bacteria | 6516 |
| 414 | Ga0495604_0018489 | 3300047317 | Bacteria | 5581 |
| 415 | Ga0495604_0024608 | 3300047317 | Bacteria | 4803 |
| 416 | Ga0495674_0019160 | 3300047319 | Bacteria | 6356 |
| 417 | Ga0495674_0039658 | 3300047319 | Bacteria | 4219 |
| 418 | Ga0495674_0396562 | 3300047319 | Bacteria | 1114 |
| 419 | Ga0495672_0015945 | 3300047320 | Bacteria | 5086 |
| 420 | Ga0495672_0204690 | 3300047320 | Bacteria | 985 |
| 421 | Ga0495676_0035575 | 3300047321 | Bacteria | 4164 |
| 422 | Ga0495676_0081735 | 3300047321 | Bacteria | 2448 |
| 423 | Ga0495676_0086954 | 3300047321 | Bacteria | 2350 |
| 424 | Ga0495676_0143954 | 3300047321 | Bacteria | 1705 |
| 425 | Ga0495680_0027951 | 3300047322 | Bacteria | 4628 |
| 426 | Ga0495680_0051282 | 3300047322 | Bacteria | 3222 |
| 427 | Ga0495687_016529 | 3300047443 | Bacteria | 3709 |
| 428 | Ga0495675_0010276 | 3300047444 | Bacteria | 5846 |
| 429 | Ga0495677_0109223 | 3300047445 | Bacteria | 1051 |
| 430 | Ga0495677_0148432 | 3300047445 | Bacteria | 902 |
| 431 | Ga0495673_0035289 | 3300047469 | Bacteria | 2306 |
| 432 | Ga0495673_0072381 | 3300047469 | Bacteria | 1447 |
| 433 | Ga0495681_0178914 | 3300047470 | Bacteria | 873 |
| 434 | Ga0495684_0098047 | 3300047471 | Bacteria | 2216 |
| 435 | Ga0495686_0085563 | 3300047472 | Bacteria | 1919 |
| 436 | Ga0495686_0128524 | 3300047472 | Bacteria | 1504 |
| 437 | Ga0495593_0009834 | 3300047673 | Bacteria | 5550 |
| 438 | Ga0495602_0035417 | 3300048088 | Bacteria | 4654 |
| 439 | Ga0495602_0115265 | 3300048088 | Bacteria | 2174 |
| 440 | Ga0495614_0010397 | 3300048089 | Bacteria | 4105 |
| 441 | Ga0495615_0006910 | 3300048090 | Bacteria | 2129 |
| 442 | Ga0496101_0182190 | 3300048904 | Bacteria | 1618 |
| 443 | Ga0496102_0042791 | 3300048905 | Bacteria | 4105 |
| 444 | Ga0496102_0047156 | 3300048905 | Bacteria | 3914 |
| 445 | Ga0496102_0087218 | 3300048905 | Bacteria | 2883 |
| 446 | Ga0496102_0868426 | 3300048905 | Bacteria | 824 |
| 447 | Ga0496103_0014246 | 3300048906 | Bacteria | 4721 |
| 448 | Ga0496103_0205421 | 3300048906 | Bacteria | 1267 |
| 449 | Ga0496104_0001527 | 3300048907 | Bacteria | 19963 |
| 450 | Ga0496104_0165226 | 3300048907 | Bacteria | 2122 |
| 451 | Ga0496104_0217273 | 3300048907 | Bacteria | 1824 |
| 452 | Ga0496104_0245271 | 3300048907 | Bacteria | 1704 |
| 453 | Ga0496105_0022915 | 3300048908 | Bacteria | 5063 |
| 454 | Ga0496105_0034191 | 3300048908 | Bacteria | 4179 |
| 455 | Ga0496105_0117212 | 3300048908 | Bacteria | 2196 |
| 456 | Ga0496106_0207173 | 3300048909 | Bacteria | 1561 |
| 457 | Ga0496106_0291084 | 3300048909 | Bacteria | 1309 |
| 458 | Ga0496107_0084351 | 3300048910 | Bacteria | 2318 |
| 459 | Ga0496107_0177432 | 3300048910 | Bacteria | 1582 |
| 460 | Ga0496107_0207282 | 3300048910 | Bacteria | 1457 |
| 461 | Ga0496108_0344508 | 3300048911 | Bacteria | 1300 |
| 462 | Ga0496109_0375385 | 3300048912 | Bacteria | 1343 |
| 463 | Ga0496110_0101641 | 3300048913 | Bacteria | 2578 |
| 464 | Ga0496110_0243276 | 3300048913 | Bacteria | 1637 |
| 465 | Ga0496111_0104195 | 3300048914 | Bacteria | 2087 |
| 466 | Ga0496111_0391621 | 3300048914 | Bacteria | 1027 |
| 467 | Ga0496112_0067048 | 3300048915 | Bacteria | 3542 |
| 468 | Ga0496112_0137037 | 3300048915 | Bacteria | 2417 |
| 469 | Ga0496112_0211128 | 3300048915 | Bacteria | 1898 |
| 470 | Ga0496112_0242836 | 3300048915 | Bacteria | 1753 |
| 471 | Ga0496113_0105718 | 3300048916 | Bacteria | 2186 |
| 472 | Ga0496113_0392417 | 3300048916 | Bacteria | 1114 |
| 473 | Ga0496114_0147645 | 3300048917 | Bacteria | 2039 |
| 474 | Ga0496115_0027627 | 3300048918 | Bacteria | 4441 |
| 475 | Ga0496115_0246876 | 3300048918 | Bacteria | 1470 |
| 476 | Ga0496116_0004921 | 3300048919 | Bacteria | 12589 |
| 477 | Ga0496116_0024999 | 3300048919 | Bacteria | 4401 |
| 478 | Ga0496116_0120391 | 3300048919 | Bacteria | 1521 |
| 479 | Ga0496117_0063202 | 3300048920 | Bacteria | 2532 |
| 480 | Ga0496117_0077757 | 3300048920 | Bacteria | 2194 |
| 481 | Ga0496117_0093791 | 3300048920 | Bacteria | 1924 |
| 482 | Ga0496117_0149679 | 3300048920 | Bacteria | 1383 |
| 483 | Ga0496118_0022470 | 3300048921 | Bacteria | 5512 |
| 484 | Ga0496118_0044354 | 3300048921 | Bacteria | 3483 |
| 485 | Ga0496118_0062035 | 3300048921 | Bacteria | 2763 |
| 486 | Ga0496119_0040487 | 3300048922 | Bacteria | 2979 |
| 487 | Ga0496119_0076492 | 3300048922 | Bacteria | 1942 |
| 488 | Ga0496119_0151590 | 3300048922 | Bacteria | 1242 |
| 489 | Ga0496119_0169471 | 3300048922 | Bacteria | 1154 |
| 490 | Ga0496120_0005676 | 3300048923 | Bacteria | 9858 |
| 491 | Ga0496120_0026012 | 3300048923 | Bacteria | 3622 |
| 492 | Ga0496121_0006604 | 3300048924 | Bacteria | 14311 |
| 493 | Ga0496121_0006859 | 3300048924 | Bacteria | 13921 |
| 494 | Ga0496121_0036077 | 3300048924 | Bacteria | 4413 |
| 495 | Ga0496121_0046487 | 3300048924 | Bacteria | 3714 |
| 496 | Ga0496121_0082638 | 3300048924 | Bacteria | 2538 |
| 497 | Ga0496121_0087594 | 3300048924 | Bacteria | 2444 |
| 498 | Ga0496121_0137321 | 3300048924 | Bacteria | 1819 |
| 499 | Ga0496121_0141556 | 3300048924 | Bacteria | 1783 |
| 500 | Ga0496121_0189086 | 3300048924 | Bacteria | 1478 |
| 501 | Ga0496121_0193092 | 3300048924 | Bacteria | 1458 |
| 502 | Ga0496122_0045609 | 3300048925 | Bacteria | 3405 |
| 503 | Ga0496122_0226682 | 3300048925 | Bacteria | 1067 |
| 504 | Ga0496123_0101067 | 3300048926 | Bacteria | 1677 |
| 505 | Ga0496124_0023449 | 3300048927 | Bacteria | 5633 |
| 506 | Ga0496124_0043186 | 3300048927 | Bacteria | 3876 |
| 507 | Ga0496124_0089346 | 3300048927 | Bacteria | 2516 |
| 508 | Ga0496124_0170038 | 3300048927 | Bacteria | 1689 |
| 509 | Ga0496125_0007927 | 3300048928 | Bacteria | 11213 |
| 510 | Ga0496125_0016974 | 3300048928 | Bacteria | 6961 |
| 511 | Ga0496125_0061209 | 3300048928 | Bacteria | 3020 |
| 512 | Ga0496125_0094053 | 3300048928 | Bacteria | 2235 |
| 513 | Ga0496125_0125224 | 3300048928 | Bacteria | 1823 |
| 514 | Ga0496125_0220286 | 3300048928 | Bacteria | 1223 |
| 515 | Ga0496126_0017021 | 3300048929 | Bacteria | 7253 |
| 516 | Ga0496126_0052786 | 3300048929 | Bacteria | 3692 |
| 517 | Ga0496126_0059832 | 3300048929 | Bacteria | 3429 |
| 518 | Ga0496126_0247609 | 3300048929 | Bacteria | 1486 |
| 519 | Ga0496126_0270259 | 3300048929 | Bacteria | 1411 |
| 520 | Ga0501079_0328435 | 3300049741 | Bacteria | 1198 |
| 521 | nmdc:mga03683_86224_c1 | 3300050489 | Bacteria | 1363 |
| 522 | nmdc:mga03n38_139933_c1 | 3300050490 | Bacteria | 1208 |
| 523 | nmdc:mga00v17_26969_c1 | 3300050491 | Bacteria | 3351 |
| 524 | nmdc:mga00v17_286890_c1 | 3300050491 | Bacteria | 1069 |
| 525 | nmdc:mga00v17_62020_c1 | 3300050491 | Bacteria | 2299 |
| 526 | nmdc:mga0yw44_129872_c1 | 3300050492 | Bacteria | 1630 |
| 527 | nmdc:mga0yw44_14033_c1 | 3300050492 | Bacteria | 4240 |
| 528 | nmdc:mga0yw44_21950_c1 | 3300050492 | Bacteria | 3571 |
| 529 | nmdc:mga0yw44_3590_c1 | 3300050492 | Bacteria | 6918 |
| 530 | nmdc:mga0yw44_76043_c1 | 3300050492 | Bacteria | 2095 |
| 531 | nmdc:mga0yw44_89462_c1 | 3300050492 | Bacteria | 1943 |
| 532 | nmdc:mga0yw44_95057_c1 | 3300050492 | Bacteria | 1890 |
| 533 | nmdc:mga0yw44_96208_c1 | 3300050492 | Bacteria | 1879 |
| 534 | nmdc:mga0k408_55414_c1 | 3300050493 | Bacteria | 2299 |
| 535 | nmdc:mga06z11_122121_c1 | 3300050494 | Bacteria | 1454 |
| 536 | nmdc:mga06z11_29098_c1 | 3300050494 | Bacteria | 2657 |
| 537 | nmdc:mga07m45_13136_c1 | 3300050496 | Bacteria | 4386 |
| 538 | nmdc:mga07m45_78151_c1 | 3300050496 | Bacteria | 1888 |
| 539 | nmdc:mga05p37_341124_c1 | 3300050507 | Bacteria | 1767 |
| 540 | nmdc:mga08y16_342172_c1 | 3300050511 | Bacteria | 1537 |
| 541 | nmdc:mga0sz30_207623_c1 | 3300050516 | Bacteria | 870 |
| 542 | nmdc:mga0sz30_95436_c1 | 3300050516 | Bacteria | 1297 |
| 543 | Ga0495612_0006842 | 3300053078 | Bacteria | 4669 |
| 544 | Ga0495595_0028782 | 3300053084 | Bacteria | 2483 |
| 545 | Ga0500578_0120652 | 3300053086 | Bacteria | 1648 |
| 546 | Ga0500578_0142288 | 3300053086 | Bacteria | 1499 |
| 547 | Ga0500643_000091 | 3300053087 | Bacteria | 93825 |
| 548 | Ga0500646_0022320 | 3300053090 | Bacteria | 1693 |
| 549 | Ga0500651_0001429 | 3300053093 | Bacteria | 11996 |
| 550 | Ga0500651_0021819 | 3300053093 | Bacteria | 3996 |
| 551 | Ga0500566_0000199 | 3300053094 | Bacteria | 31473 |
| 552 | Ga0500566_0001852 | 3300053094 | Bacteria | 12442 |
| 553 | Ga0500650_0098265 | 3300053098 | Bacteria | 1371 |
| 554 | Ga0500650_0170985 | 3300053098 | Bacteria | 999 |
| 555 | Ga0500555_009112 | 3300053103 | Bacteria | 2836 |
| 556 | Ga0500555_030650 | 3300053103 | Bacteria | 1526 |
| 557 | Ga0500556_0000267 | 3300053104 | Bacteria | 41211 |
| 558 | Ga0500557_000043 | 3300053105 | Bacteria | 63389 |
| 559 | Ga0500562_006383 | 3300053108 | Bacteria | 2973 |
| 560 | Ga0500562_006987 | 3300053108 | Bacteria | 2846 |
| 561 | Ga0500569_001915 | 3300053109 | Bacteria | 4022 |
| 562 | Ga0500595_022371 | 3300053119 | Bacteria | 2240 |
| 563 | Ga0500595_036005 | 3300053119 | Bacteria | 1625 |
| 564 | Ga0500595_065251 | 3300053119 | Bacteria | 1090 |
| 565 | Ga0500607_087066 | 3300053121 | Bacteria | 1580 |
| 566 | Ga0500642_0000582 | 3300053130 | Bacteria | 10974 |
| 567 | Ga0500642_0056276 | 3300053130 | Bacteria | 1752 |
| 568 | Ga0500642_0094796 | 3300053130 | Bacteria | 1383 |
| 569 | Ga0500655_013151 | 3300053133 | Bacteria | 1508 |
| 570 | Ga0500658_0026391 | 3300053134 | Bacteria | 2237 |
| 571 | Ga0500559_0054545 | 3300053136 | Bacteria | 1771 |
| 572 | Ga0500559_0092826 | 3300053136 | Bacteria | 1383 |
| 573 | Ga0500564_094409 | 3300053138 | Bacteria | 1328 |
| 574 | Ga0500568_0001711 | 3300053139 | Bacteria | 13683 |
| 575 | Ga0500568_0014409 | 3300053139 | Bacteria | 3571 |
| 576 | Ga0500568_0034178 | 3300053139 | Bacteria | 2081 |
| 577 | Ga0500568_0045480 | 3300053139 | Bacteria | 1747 |
| 578 | Ga0500586_008951 | 3300053145 | Bacteria | 2753 |
| 579 | Ga0500588_0115984 | 3300053146 | Bacteria | 940 |
| 580 | Ga0500604_0105976 | 3300053151 | Bacteria | 930 |
| 581 | Ga0500616_0000197 | 3300053153 | Bacteria | 98372 |
| 582 | Ga0500616_0045474 | 3300053153 | Bacteria | 2339 |
| 583 | Ga0500616_0083129 | 3300053153 | Bacteria | 1605 |
| 584 | Ga0500620_002074 | 3300053155 | Bacteria | 3921 |
| 585 | Ga0500622_0003992 | 3300053156 | Bacteria | 9510 |
| 586 | Ga0500622_0007515 | 3300053156 | Bacteria | 6185 |
| 587 | Ga0500622_0021604 | 3300053156 | Bacteria | 3415 |
| 588 | Ga0500622_0176558 | 3300053156 | Bacteria | 990 |
| 589 | Ga0500633_0013684 | 3300053160 | Bacteria | 2281 |
| 590 | Ga0500634_0015616 | 3300053161 | Bacteria | 4037 |
| 591 | Ga0500634_0039728 | 3300053161 | Bacteria | 2558 |
| 592 | Ga0500638_028725 | 3300053162 | Bacteria | 2673 |
| 593 | Ga0500639_129349 | 3300053163 | Bacteria | 1199 |
| 594 | Ga0500636_0000958 | 3300053177 | Bacteria | 15526 |
| 595 | Ga0500636_0005903 | 3300053177 | Bacteria | 7020 |
| 596 | Ga0500637_0138137 | 3300053178 | Bacteria | 1411 |
| 597 | Ga0500625_000057 | 3300053729 | Bacteria | 21062 |
| 598 | Ga0500601_000162 | 3300053737 | Bacteria | 13961 |
| 599 | 2507504794 | 2507262055 | Bacteria | 8048963 |
| 600 | 2508546148 | 2508501009 | Bacteria | 7784016 |
| 601 | 2508695084 | 2508501042 | Bacteria | 8719808 |
| 602 | 2511400464 | 2511231028 | Bacteria | 8046582 |
| 603 | 2513626181 | 2513237092 | Bacteria | 8341956 |
| 604 | 2513641864 | 2513237094 | Bacteria | 8789602 |
| 605 | 2513694096 | 2513237101 | Bacteria | 7952346 |
| 606 | 2513702870 | 2513237102 | Bacteria | 7703324 |
| 607 | 2513715648 | 2513237104 | Bacteria | 10034502 |
| 608 | 2513855891 | 2513237137 | Bacteria | 9558895 |
| 609 | 2513873962 | 2513237139 | Bacteria | 8737671 |
| 610 | 2513894307 | 2513237141 | Bacteria | 8496279 |
| 611 | 2514012936 | 2513237161 | Bacteria | 8871253 |
| 612 | 2515625913 | 2515154112 | Bacteria | 8294334 |
| 613 | 2517102438 | 2517093001 | Bacteria | 9002274 |
| 614 | 2517888507 | 2517572143 | Bacteria | 9484767 |
| 615 | 2524435694 | 2524023205 | Bacteria | 8918781 |
| 616 | 2524535190 | 2524023228 | Bacteria | 10118060 |
| 617 | 2528850351 | 2528768022 | Bacteria | 10457665 |
| 618 | 2603857504 | 2602042107 | Bacteria | 6226103 |
| 619 | 2617353008 | 2617270735 | Bacteria | 9163226 |
| 620 | 2617374180 | 2617270741 | Bacteria | 8201522 |
| 621 | 2644741994 | 2643221736 | Bacteria | 6608466 |
| 622 | 2745078990 | 2744054633 | Bacteria | 8678936 |
| 623 | 2793063148 | 2791355196 | Bacteria | 7323613 |
| 624 | 2793067328 | 2791355197 | Bacteria | 8420563 |
| 625 | 2793077049 | |||
| 626 | 2805919451 | 2802429603 | Bacteria | 8777136 |
| 627 | 2818237230 | 2816332527 | Bacteria | 8933356 |
| 628 | 2824624802 | 2824617872 | Bacteria | 8814715 |
| 629 | 2824633674 | 2824626560 | Bacteria | 8813858 |
| 630 | 2824641544 | 2824635225 | Bacteria | 8785348 |
| 631 | 2824663615 | 2824661429 | Bacteria | 9877870 |
| 632 | 2824675408 | 2824671348 | Bacteria | 8369588 |
| 633 | 2824691626 | 2824687955 | Bacteria | 8360029 |
| 634 | 2824709452 | 2824704595 | Bacteria | 9667483 |
| 635 | 2824731199 | 2824723954 | Bacteria | 8758240 |
| 636 | 2824748176 | 2824746037 | Bacteria | 7911610 |
| 637 | 2824758443 | 2824753945 | Bacteria | 9787441 |
| 638 | 2824768855 | 2824763712 | Bacteria | 9792355 |
| 639 | 2824774991 | 2824773399 | Bacteria | 8360218 |
| 640 | 2838129508 | 2838122688 | Bacteria | 8803140 |
| 641 | 2841763401 | 2841760612 | Bacteria | 6454112 |
| 642 | 2841944409 | 2841941048 | Bacteria | 8688029 |
| 643 | 2841951550 | 2841949485 | Bacteria | 8680857 |
| 644 | 2841964662 | 2841957949 | Bacteria | 8652217 |
| 645 | 2841969186 | 2841966195 | Bacteria | 8673214 |
| 646 | 2841982987 | 2841974524 | Bacteria | 8931498 |
| 647 | 2841990859 | 2841983080 | Bacteria | 8395090 |
| 648 | 2842043932 | 2842038055 | Bacteria | 8002051 |
| 649 | 2842052078 | 2842045827 | Bacteria | 8006841 |
| 650 | 2844108728 | 2844104063 | Bacteria | 6440972 |
| 651 | 2844321778 | 2844315083 | Bacteria | 8138177 |
| 652 | 2847939744 | 2847930680 | Bacteria | 9342022 |
| 653 | 2849082630 | 2849076700 | Bacteria | 7039503 |
| 654 | 2851182641 | 2851182111 | Bacteria | 6047226 |
| 655 | 2851250835 | 2851246043 | Bacteria | 6439203 |
| 656 | 2857511519 | 2857509624 | Bacteria | 7472071 |
| 657 | 2857526891 | 2857524615 | Bacteria | 6615449 |
| 658 | 2874594243 | 2874590934 | Bacteria | 8299676 |
| 659 | 2874608373 | 2874604998 | Bacteria | 7834745 |
| 660 | 2874615504 | 2874612657 | Bacteria | 8252029 |
| 661 | 2874624372 | 2874620515 | Bacteria | 8290088 |
| 662 | 2874636659 | 2874628541 | Bacteria | 8630250 |
| 663 | 2874647669 | 2874645413 | Bacteria | 8214782 |
| 664 | 2876764992 | 2876761206 | Bacteria | 10111113 |
| 665 | 2876771891 | 2876771140 | Bacteria | 8287509 |
| 666 | 2876815893 | 2876808645 | Bacteria | 8824342 |
| 667 | 2876819197 | 2876818435 | Bacteria | 8274608 |
| 668 | 2879075742 | 2879074833 | Bacteria | 8279565 |
| 669 | 2879089996 | 2879083081 | Bacteria | 8587928 |
| 670 | 2879101296 | 2879099564 | Bacteria | 10442239 |
| 671 | 2879112860 | 2879110137 | Bacteria | 8907982 |
| 672 | 2879130727 | 2879127579 | Bacteria | 8294491 |
| 673 | 2879146113 | 2879142872 | Bacteria | 8267021 |
| 674 | 2881672896 | 2881665667 | Bacteria | 8175609 |
| 675 | 2885371445 | 2885366525 | Bacteria | 8326213 |
| 676 | 2885410841 | 2885409591 | Bacteria | 9235467 |
| 677 | 2888380017 | 2888378607 | Bacteria | 9652610 |
| 678 | 2888391085 | 2888388044 | Bacteria | 7304136 |
| 679 | 2888420822 | 2888419890 | Bacteria | 7857137 |
| 680 | 2889035815 | 2889033259 | Bacteria | 9099371 |
| 681 | 2903727672 | 2903727486 | Bacteria | 8281579 |
| 682 | 2903756755 | 2903748898 | Bacteria | 9972761 |
| 683 | 2904672289 | 2904666416 | Bacteria | 8226587 |
| 684 | 2904699339 | 2904690495 | Bacteria | 9412302 |
| 685 | 2904708030 | |||
| 686 | 2904716018 | 2904711408 | Bacteria | 9771557 |
| 687 | 2906602838 | 2906602504 | Bacteria | 8295279 |
| 688 | 2906614126 | |||
| 689 | 2906634433 | 2906626472 | Bacteria | 8826946 |
| 690 | 2906644992 | 2906643746 | Bacteria | 8722424 |
| 691 | 2908747047 | 2908739725 | Bacteria | 8628932 |
| 692 | 2908764749 | 2908756301 | Bacteria | 8864324 |
| 693 | 2908776655 | 2908775508 | Bacteria | 8092255 |
| 694 | 2919078008 | 2919073203 | Bacteria | 6531949 |
| 695 | 2922364298 | 2922361189 | Bacteria | 7436256 |
| 696 | 2922378399 | |||
| 697 | 2922388996 | 2922386360 | Bacteria | 7017218 |
| 698 | 2922400315 | 2922393267 | Bacteria | 8285685 |
| 699 | 2922425955 | |||
| 700 | 2929622501 | 2929615660 | Bacteria | 9193770 |
| 701 | 2929631281 | 2929624759 | Bacteria | 9339455 |
| 702 | 2932786298 | 2932784394 | Bacteria | 9704911 |
| 703 | 2932794733 | 2932794094 | Bacteria | 7915132 |
| 704 | 2932805457 | 2932801729 | Bacteria | 7987968 |
| 705 | 2932812628 | 2932809354 | Bacteria | 9135765 |
| 706 | 2932822990 | 2932818245 | Bacteria | 9955613 |
| 707 | 2932829536 | 2932828146 | Bacteria | 9745859 |
| 708 | 2933584420 | 2933577622 | Bacteria | 9116884 |
| 709 | 2935615005 | 2935608549 | Bacteria | 8203142 |
| 710 | 2935618054 | 2935616580 | Bacteria | 9032984 |
| 711 | 2935636685 | 2935630451 | Bacteria | 8169952 |
| 712 | 2935641548 | 2935638405 | Bacteria | 10015038 |
| 713 | 2935651647 | 2935648319 | Bacteria | 8801166 |
| 714 | 2935659585 | 2935656913 | Bacteria | 8965014 |
| 715 | 2935669394 | 2935665750 | Bacteria | 9571747 |
| 716 | 2935678008 | 2935675223 | Bacteria | 9928132 |
| 717 | 2935693671 | 2935684952 | Bacteria | 9590419 |
| 718 | 2935701753 | 2935694250 | Bacteria | 9291695 |
| 719 | 2935707218 | 2935703347 | Bacteria | 10242284 |
| 720 | 2935717060 | 2935713505 | Bacteria | 9608509 |
| 721 | 2935730106 | 2935722832 | Bacteria | 9608746 |
| 722 | 2935738474 | 2935732158 | Bacteria | 9706831 |
| 723 | 2935750262 | 2935741537 | Bacteria | 9707219 |
| 724 | 2935759856 | 2935750917 | Bacteria | 9590372 |
| 725 | 2935764493 | 2935760218 | Bacteria | 9817913 |
| 726 | 2935772822 | 2935769743 | Bacteria | 7878163 |
| 727 | 2935778042 | 2935777560 | Bacteria | 8077691 |
| 728 | 2935787269 | 2935785616 | Bacteria | 7962367 |
| 729 | 2935795943 | 2935793552 | Bacteria | 8012592 |
| 730 | 2935804402 | 2935801545 | Bacteria | 9301974 |
| 731 | 2935817263 | 2935810662 | Bacteria | 9401221 |
| 732 | 2935825957 | 2935819856 | Bacteria | 8261050 |
| 733 | 2935831279 | 2935827899 | Bacteria | 10038562 |
| 734 | 2935841888 | 2935837841 | Bacteria | 9454360 |
| 735 | 2935851576 | 2935847175 | Bacteria | 8228321 |
| 736 | 2935856447 | 2935855204 | Bacteria | 9035059 |
| 737 | 2935871011 | 2935864058 | Bacteria | 9784707 |
| 738 | 2935874527 | 2935873716 | Bacteria | 9632195 |
| 739 | 2935888946 | 2935883170 | Bacteria | 7964738 |
| 740 | 2935910401 | 2935908558 | Bacteria | 8568796 |
| 741 | 2935918313 | 2935916978 | Bacteria | 9113783 |
| 742 | 2935927688 | 2935926038 | Bacteria | 8601059 |
| 743 | 2935936440 | 2935934488 | Bacteria | 8602579 |
| 744 | 2935944007 | 2935942939 | Bacteria | 8599779 |
| 745 | 2935952444 | 2935951376 | Bacteria | 8602333 |
| 746 | 2935964192 | 2935959822 | Bacteria | 7869783 |
| 747 | 2935969284 | 2935967501 | Bacteria | 8603075 |
| 748 | 2935977955 | 2935975950 | Bacteria | 8347125 |
| 749 | 2935984745 | 2935984226 | Bacteria | 8302647 |
| 750 | 2935993988 | 2935992306 | Bacteria | 9802711 |
| 751 | 2936005001 | 2936002035 | Bacteria | 9362176 |
| 752 | 2936014001 | 2936011229 | Bacteria | 8801034 |
| 753 | 2936023090 | 2936019824 | Bacteria | 8804134 |
| 754 | 2936031226 | 2936028420 | Bacteria | 8965941 |
| 755 | 2936044059 | 2936037263 | Bacteria | 9446081 |
| 756 | 2936049348 | 2936046547 | Bacteria | 8903709 |
| 757 | 2936055915 | 2936055302 | Bacteria | 8785755 |
| 758 | 2940565690 | 2940556831 | Bacteria | 9590747 |
| 759 | 2941513321 | 2941507105 | Bacteria | 8166816 |
| 760 | 2941521284 | 2941515067 | Bacteria | 8166720 |
| 761 | 2941529004 | 2941523033 | Bacteria | 8169134 |
| 762 | 2941532306 | 2941531003 | Bacteria | 7653939 |
| 763 | 2941543961 | 2941538514 | Bacteria | 9402094 |
| 764 | 3003670037 | 3003665799 | Bacteria | 7279786 |
| 765 | 3005483598 | 3005474847 | Bacteria | 9259049 |
| 766 | 3005491047 | 3005483717 | Bacteria | 7877331 |
| 767 | 3005509592 | 3005506211 | Bacteria | 6943378 |
| 768 | 3005594190 | 3005587118 | Bacteria | 7794411 |
| 769 | 3005602124 | 3005594810 | Bacteria | 8716512 |
| 770 | 3005717880 | 3005710791 | Bacteria | 7622528 |
| 771 | 3005724912 | 3005718088 | Bacteria | 8283608 |
| 772 | 643597897 | 643348564 | Bacteria | 8839022 |
| 773 | 8006930535 | 8006926726 | Bacteria | 6749210 |
| 774 | 8006936654 | 8006933436 | Bacteria | 10410654 |
| 775 | 8006976624 | 8006973647 | Bacteria | 10679141 |
| 776 | 8006992395 | 8006984368 | Bacteria | 9651211 |
| 777 | 8007000016 | 8006994254 | Bacteria | 8309700 |
| 778 | 8016518692 | 8016511872 | Bacteria | 9921665 |
| 779 | 8016526653 | 8016522445 | Bacteria | 8156687 |
| 780 | 8016531739 | 8016530956 | Bacteria | 8155261 |
| 781 | 8016544938 | 8016539877 | Bacteria | 8155419 |
| 782 | 8016557132 | 8016548790 | Bacteria | 8155074 |
| 783 | 8016565483 | 8016557553 | Bacteria | 8154380 |
| 784 | 8016570015 | 8016566248 | Bacteria | 8158151 |
| 785 | 8016582585 | 8016575299 | Bacteria | 8154085 |
| 786 | 8016586896 | 8016583857 | Bacteria | 10421953 |
| 787 | 8016603114 | 8016595262 | Bacteria | 8149947 |
| 788 | 8016606023 | 8016603502 | Bacteria | 8731218 |
| 789 | 8016617912 | 8016613128 | Bacteria | 8794220 |
| 790 | 8016623663 | 8016622563 | Bacteria | 7999408 |
| 791 | 8016636135 | 8016630954 | Bacteria | 9217207 |
| 792 | 8017057981 | 8017057580 | Bacteria | 10023680 |
| 793 | 8019531563 | 8019530166 | Bacteria | 8155624 |
| 794 | 8019539971 | 8019538911 | Bacteria | 7872763 |
| 795 | 8019550684 | 8019547302 | Bacteria | 7996444 |
| 796 | 8019562061 | 8019555841 | Bacteria | 9642137 |
| 797 | 8019572127 | 8019565922 | Bacteria | 9639779 |
| 798 | 8019577739 | 8019576017 | Bacteria | 10049540 |
| 799 | 8019595840 | 8019586578 | Bacteria | 10212056 |
| 800 | 8019605920 | 8019597564 | Bacteria | 10041141 |
| 801 | 8019612615 | 8019608314 | Bacteria | 10042931 |
| 802 | 8019622502 | 8019619141 | Bacteria | 9218857 |
| 803 | 8019630615 | 8019629233 | Bacteria | 8687553 |
| 804 | 8019640001 | 8019638758 | Bacteria | 9062356 |
| 805 | 8019652031 | 8019648815 | Bacteria | 10014479 |
| 806 | 8019677209 | 8019668869 | Bacteria | 8791617 |
| 807 | 8019678775 | 8019678201 | Bacteria | 8863603 |
| 808 | 8019696750 | 8019687851 | Bacteria | 8712826 |
| 809 | 8055750952 | 8055742211 | Bacteria | 9226248 |
| 810 | 8056693922 | 8056689827 | Bacteria | 6712655 |
| 811 | 8056970866 | 8056967851 | Bacteria | 9038162 |
| 812 | 8057534670 | 8057529695 | Bacteria | 6306553 |
| 813 | Ga0495585_0060485 | |||
| 814 | JGI25153J46596_10000546 | |||
| 815 | JGI25153J46596_10002402 | |||
| 816 | JGI25153J46596_10002991 | |||
| 817 | JGI25153J46596_10003079 | |||
| 818 | JGI25153J46596_10006476 | |||
| 819 | JGI25153J46596_10006750 | |||
| 820 | JGI25160J50197_1002937 | |||
| 821 | JGI25160J50197_1010766 | |||
| 822 | Ga0055531_10022050 | |||
| 823 | Ga0055543_1005955 | |||
| 824 | Ga0065165_1001155 | |||
| 825 | Ga0065165_1002140 | |||
| 826 | Ga0065165_1006888 | |||
| 827 | Ga0070658_10032489 | |||
| 828 | Ga0068869_100042236 | |||
| 829 | Ga0070666_10453064 | |||
| 830 | Ga0068868_100059877 | |||
| 831 | Ga0070660_100001075 | |||
| 832 | Ga0070660_100064745 | |||
| 833 | Ga0070691_10024348 | |||
| 834 | Ga0070661_100058898 | |||
| 835 | Ga0070692_10262534 | |||
| 836 | Ga0070668_100059132 | |||
| 837 | Ga0070669_100195727 | |||
| 838 | Ga0070675_100279899 | |||
| 839 | Ga0070671_100160445 | |||
| 840 | Ga0070671_100179287 | |||
| 841 | Ga0070671_100305345 | |||
| 842 | Ga0070659_100065729 | |||
| 843 | Ga0070659_100076877 | |||
| 844 | Ga0070667_100041698 | |||
| 845 | Ga0070709_10000324 | |||
| 846 | Ga0070714_100029600 | |||
| 847 | Ga0070714_100053032 | |||
| 848 | Ga0070713_100402554 | |||
| 849 | Ga0070710_10002222 | |||
| 850 | Ga0070710_10112105 | |||
| 851 | Ga0070711_100000621 | |||
| 852 | Ga0070663_100086070 | |||
| 853 | Ga0070678_100015205 | |||
| 854 | Ga0070678_100191992 | |||
| 855 | Ga0070681_10327748 | |||
| 856 | Ga0070679_100074543 | |||
| 857 | Ga0070679_100079032 | |||
| 858 | Ga0070684_100053529 | |||
| 859 | Ga0068853_100030716 | |||
| 860 | Ga0068853_100056431 | |||
| 861 | Ga0070665_100044229 | |||
| 862 | Ga0070665_100164262 | |||
| 863 | Ga0068855_100040085 | |||
| 864 | Ga0068855_100057744 | |||
| 865 | Ga0070664_100130533 | |||
| 866 | Ga0070664_100334796 | |||
| 867 | Ga0068857_100025038 | |||
| 868 | Ga0068857_100074121 | |||
| 869 | Ga0068857_100195779 | |||
| 870 | Ga0068854_100090460 | |||
| 871 | Ga0068856_100016067 | |||
| 872 | Ga0070702_100351922 | |||
| 873 | Ga0068852_100112800 | |||
| 874 | Ga0068859_100247995 | |||
| 875 | Ga0068864_100195064 | |||
| 876 | Ga0068864_100230576 | |||
| 877 | Ga0068861_100082221 | |||
| 878 | Ga0068861_100110642 | |||
| 879 | Ga0068870_10115852 | |||
| 880 | Ga0068863_100111652 | |||
| 881 | Ga0068858_100016761 | |||
| 882 | Ga0068858_100273209 | |||
| 883 | Ga0068860_100080172 | |||
| 884 | Ga0068860_100229846 | |||
| 885 | Ga0068862_100035365 | |||
| 886 | Ga0068862_100168500 | |||
| 887 | Ga0068862_100261091 | |||
| 888 | Ga0081455_10014700 | |||
| 889 | Ga0081455_10061650 | |||
| 890 | Ga0081455_10161147 | |||
| 891 | Ga0081540_1006462 | |||
| 892 | Ga0081540_1010349 | |||
| 893 | Ga0081540_1012280 | |||
| 894 | Ga0081540_1036187 | |||
| 895 | Ga0081539_10039936 | |||
| 896 | Ga0075365_10001198 | |||
| 897 | Ga0075365_10006757 | |||
| 898 | Ga0075365_10009402 | |||
| 899 | Ga0075365_10011386 | |||
| 900 | Ga0075365_10113758 | |||
| 901 | Ga0075365_10183503 | |||
| 902 | Ga0075368_10005851 | |||
| 903 | Ga0075368_10049991 | |||
| 904 | Ga0075368_10063018 | |||
| 905 | Ga0075364_10009412 | |||
| 906 | Ga0075364_10058870 | |||
| 907 | Ga0070715_10001188 | |||
| 908 | Ga0070715_10196377 | |||
| 909 | Ga0070716_100001795 | |||
| 910 | Ga0070712_100031848 | |||
| 911 | Ga0075362_10009436 | |||
| 912 | Ga0075362_10056307 | |||
| 913 | Ga0075367_10005172 | |||
| 914 | Ga0075367_10042065 | |||
| 915 | Ga0075369_10021492 | |||
| 916 | Ga0075369_10073822 | |||
| 917 | Ga0075369_10093354 | |||
| 918 | Ga0075366_10066209 | |||
| 919 | Ga0075366_10089129 | |||
| 920 | Ga0075370_10029295 | |||
| 921 | Ga0075370_10148264 | |||
| 922 | Ga0075428_100107748 | |||
| 923 | Ga0097620_100248011 | |||
| 924 | Ga0099825_1039521 | |||
| 925 | Ga0099824_1009891 | |||
| 926 | Ga0099823_1048339 | |||
| 927 | Ga0075435_100088713 | |||
| 928 | Ga0099794_10012276 | |||
| 929 | Ga0105240_10003126 | |||
| 930 | Ga0105240_10020444 | |||
| 931 | Ga0105240_10339512 | |||
| 932 | Ga0111539_10680147 | |||
| 933 | Ga0105245_10143854 | |||
| 934 | Ga0105247_10022493 | |||
| 935 | Ga0114129_10037785 | |||
| 936 | Ga0105241_10015960 | |||
| 937 | Ga0105241_10215624 | |||
| 938 | Ga0105248_10021406 | |||
| 939 | Ga0105248_10038765 | |||
| 940 | Ga0105237_10000859 | |||
| 941 | Ga0105237_10034201 | |||
| 942 | Ga0105238_10000767 | |||
| 943 | Ga0105238_10149736 | |||
| 944 | Ga0105238_10203961 | |||
| 945 | Ga0105238_10463446 | |||
| 946 | Ga0105249_10145888 | |||
| 947 | Ga0105249_10150335 | |||
| 948 | Ga0105249_10208784 | |||
| 949 | Ga0099796_10000291 | |||
| 950 | Ga0105239_10021858 | |||
| 951 | Ga0105239_10032270 | |||
| 952 | Ga0105246_10034814 | |||
| 953 | Ga0105246_10050886 | |||
| 954 | Ga0157370_10014068 | |||
| 955 | Ga0157369_10043256 | |||
| 956 | Ga0157374_10040096 | |||
| 957 | Ga0157374_10326209 | |||
| 958 | Ga0157378_10032924 | |||
| 959 | Ga0163162_10108209 | |||
| 960 | Ga0163162_10153664 | |||
| 961 | Ga0163162_10200594 | |||
| 962 | Ga0157375_10120296 | |||
| 963 | Ga0163163_10053931 | |||
| 964 | Ga0157380_10288343 | |||
| 965 | Ga0157377_10112047 | |||
| 966 | Ga0157379_10152113 | |||
| 967 | Ga0157376_10127804 | |||
| 968 | Ga0163161_10151307 | |||
| 969 | Ga0214544_1000003 | |||
| 970 | Ga0214542_1000003 | |||
| 971 | Ga0214545_1000004 | |||
| 972 | Ga0214545_1016668 | |||
| 973 | Ga0214543_1000007 | |||
| 974 | Ga0213876_10016680 | |||
| 975 | Ga0209677_110514 | |||
| 976 | Ga0209148_1000351 | |||
| 977 | Ga0209233_1008082 | |||
| 978 | Ga0209233_1041648 | |||
| 979 | Ga0209455_1002831 | |||
| 980 | Ga0209673_1036314 | |||
| 981 | Ga0209130_1027079 | |||
| 982 | Ga0209564_1000297 | |||
| 983 | Ga0209564_1006838 | |||
| 984 | Ga0209758_1000015 | |||
| 985 | Ga0209758_1000886 | |||
| 986 | Ga0209758_1001252 | |||
| 987 | Ga0209758_1001829 | |||
| 988 | Ga0209758_1002026 | |||
| 989 | Ga0209758_1009050 | |||
| 990 | Ga0209758_1009164 | |||
| 991 | Ga0209256_1005506 | |||
| 992 | Ga0207426_1000585 | |||
| 993 | Ga0207426_1000734 | |||
| 994 | Ga0207426_1004869 | |||
| 995 | Ga0207426_1023553 | |||
| 996 | Ga0207426_1039285 | |||
| 997 | Ga0209257_1001348 | |||
| 998 | Ga0209257_1016267 | |||
| 999 | Ga0209257_1025898 | |||
| 1000 | Ga0207692_10000791 | |||
| 1001 | Ga0207692_10044644 | |||
| 1002 | Ga0207710_10119840 | |||
| 1003 | Ga0207688_10040389 | |||
| 1004 | Ga0207688_10041194 | |||
| 1005 | Ga0207699_10006573 | |||
| 1006 | Ga0207645_10018670 | |||
| 1007 | Ga0207645_10033885 | |||
| 1008 | Ga0207643_10033625 | |||
| 1009 | Ga0207705_10102740 | |||
| 1010 | Ga0207705_10478384 | |||
| 1011 | Ga0207654_10022669 | |||
| 1012 | Ga0207707_10005939 | |||
| 1013 | Ga0207707_10176300 | |||
| 1014 | Ga0207695_10000065 | |||
| 1015 | Ga0207671_10007730 | |||
| 1016 | Ga0207671_10122656 | |||
| 1017 | Ga0207671_10248994 | |||
| 1018 | Ga0207693_10021506 | |||
| 1019 | Ga0207660_10001773 | |||
| 1020 | Ga0207657_10043219 | |||
| 1021 | Ga0207652_10009669 | |||
| 1022 | Ga0207652_10240859 | |||
| 1023 | Ga0207694_10235277 | |||
| 1024 | Ga0207700_10013498 | |||
| 1025 | Ga0207664_10004165 | |||
| 1026 | Ga0207664_10009713 | |||
| 1027 | Ga0207664_10028124 | |||
| 1028 | Ga0207644_10094115 | |||
| 1029 | Ga0207690_10021506 | |||
| 1030 | Ga0207706_10028409 | |||
| 1031 | Ga0207706_10112362 | |||
| 1032 | Ga0207709_10049743 | |||
| 1033 | Ga0207665_10003002 | |||
| 1034 | Ga0207691_10110438 | |||
| 1035 | Ga0207711_10037439 | |||
| 1036 | Ga0207689_10096737 | |||
| 1037 | Ga0207689_10162267 | |||
| 1038 | Ga0207689_10206302 | |||
| 1039 | Ga0207661_10358101 | |||
| 1040 | Ga0207667_10044922 | |||
| 1041 | Ga0207651_10109268 | |||
| 1042 | Ga0207668_10021221 | |||
| 1043 | Ga0207668_10209291 | |||
| 1044 | Ga0207640_10057950 | |||
| 1045 | Ga0207677_10035608 | |||
| 1046 | Ga0207703_10034619 | |||
| 1047 | Ga0207703_10101106 | |||
| 1048 | Ga0207639_10025841 | |||
| 1049 | Ga0207678_10014301 | |||
| 1050 | Ga0207678_10017811 | |||
| 1051 | Ga0207678_10018068 | |||
| 1052 | Ga0207678_10139876 | |||
| 1053 | Ga0207708_10087412 | |||
| 1054 | Ga0207648_10067620 | |||
| 1055 | Ga0207676_10259124 | |||
| 1056 | Ga0207674_10014693 | |||
| 1057 | Ga0207674_10042218 | |||
| 1058 | Ga0207675_100289962 | |||
| 1059 | Ga0207683_10157971 | |||
| 1060 | Ga0207683_10290724 | |||
| 1061 | Ga0209389_1000015 | |||
| 1062 | Ga0209389_1000029 | |||
| 1063 | Ga0209589_1000012 | |||
| 1064 | Ga0209589_1000013 | |||
| 1065 | Ga0209489_100013 | |||
| 1066 | Ga0209489_100072 | |||
| 1067 | Ga0209700_100034 | |||
| 1068 | Ga0209179_1030212 | |||
| 1069 | Ga0209588_1006189 | |||
| 1070 | Ga0268266_10003057 | |||
| 1071 | Ga0268266_10021201 | |||
| 1072 | Ga0268266_10359461 | |||
| 1073 | Ga0268265_10207514 | |||
| 1074 | Ga0268265_10265389 | |||
| 1075 | Ga0268264_10053346 | |||
| 1076 | Ga0265336_10000668 | |||
| 1077 | Ga0307517_10146593 | |||
| 1078 | Ga0265338_10000013 | |||
| 1079 | Ga0307508_10240232 | |||
| 1080 | Ga0265314_10099150 | |||
| 1081 | Ga0307507_10218251 | |||
| 1082 | Ga0307510_10011942 | |||
| 1083 | Ga0315911_1000019 | |||
| 1084 | Ga0316215_1003491 | |||
| 1085 | Ga0373956_0032446 | |||
| 1086 | Ga0373943_0005135 | |||
| 1087 | Ga0373946_0101210 | |||
| 1088 | Ga0373955_0114567 | |||
| 1089 | Ga0373955_0217559 | |||
| 1090 | Ga0373924_0008201 | |||
| 1091 | Ga0373935_0001046 | |||
| 1092 | Ga0373927_0003698 | |||
| 1093 | Ga0373927_0008512 | |||
| 1094 | Ga0373933_0024598 | |||
| 1095 | Ga0373947_0004655 | |||
| 1096 | Ga0373947_0080060 | |||
| 1097 | Ga0373937_0053168 | |||
| 1098 | Ga0373937_0215582 | |||
| 1099 | Ga0373925_0000882 | |||
| 1100 | Ga0395899_0181750 | |||
| 1101 | Ga0395900_0000833 | |||
| 1102 | Ga0395900_0524697 | |||
| 1103 | Ga0395898_0013271 | |||
| 1104 | Ga0395898_0262525 | |||
| 1105 | Ga0395905_0005852 | |||
| 1106 | Ga0395905_0044831 | |||
| 1107 | Ga0395905_0198963 | |||
| 1108 | Ga0395901_0342661 | |||
| 1109 | Ga0436365_1449098 | |||
| 1110 | Ga0436363_0152674 | |||
| 1111 | Ga0436363_1170546 | |||
| 1112 | Ga0451802_1490081 | |||
| 1113 | Ga0439444_0015312 | |||
| 1114 | Ga0466969_0045038 | |||
| 1115 | Ga0466972_0000258 | |||
| 1116 | Ga0466966_0000238 | |||
| 1117 | Ga0466961_0000044 | |||
| 1118 | Ga0466963_0016295 | |||
| 1119 | Ga0466968_0004945 | |||
| 1120 | Ga0466957_0215670 | |||
| 1121 | Ga0466960_0162101 | |||
| 1122 | Ga0466959_0334523 | |||
| 1123 | Ga0466967_0519702 | |||
| 1124 | Ga0495592_0033641 | |||
| 1125 | Ga0495603_0002460 | |||
| 1126 | Ga0495603_0005987 | |||
| 1127 | Ga0495629_0002171 | |||
| 1128 | Ga0495629_0016658 | |||
| 1129 | Ga0495629_0055779 | |||
| 1130 | Ga0495638_0005818 | |||
| 1131 | Ga0495638_0022787 | |||
| 1132 | Ga0495638_0252165 | |||
| 1133 | Ga0495641_0012155 | |||
| 1134 | Ga0495651_0047178 | |||
| 1135 | Ga0495651_0052817 | |||
| 1136 | Ga0495653_0031884 | |||
| 1137 | Ga0495653_0136054 | |||
| 1138 | Ga0495653_0296988 | |||
| 1139 | Ga0495580_0005485 | |||
| 1140 | Ga0495582_0000535 | |||
| 1141 | Ga0495605_0164518 | |||
| 1142 | Ga0495639_0000244 | |||
| 1143 | Ga0495662_0001710 | |||
| 1144 | Ga0495664_0015373 | |||
| 1145 | Ga0495584_0138228 | |||
| 1146 | Ga0495585_0044202 | |||
| 1147 | Ga0495594_0001209 | |||
| 1148 | Ga0495594_0062339 | |||
| 1149 | Ga0495607_0018452 | |||
| 1150 | Ga0495606_0022953 | |||
| 1151 | Ga0495606_0052046 | |||
| 1152 | Ga0495608_0033003 | |||
| 1153 | Ga0495608_0057267 | |||
| 1154 | Ga0495608_0077929 | |||
| 1155 | Ga0495616_0021483 | |||
| 1156 | Ga0495616_0097955 | |||
| 1157 | Ga0495616_0143346 | |||
| 1158 | Ga0495618_0149979 | |||
| 1159 | Ga0495620_0070271 | |||
| 1160 | Ga0495628_0074059 | |||
| 1161 | Ga0495628_0362317 | |||
| 1162 | Ga0495630_0008971 | |||
| 1163 | Ga0495631_0034805 | |||
| 1164 | Ga0495631_0095131 | |||
| 1165 | Ga0495637_0023152 | |||
| 1166 | Ga0495643_0037331 | |||
| 1167 | Ga0495644_0046228 | |||
| 1168 | Ga0495648_0015033 | |||
| 1169 | Ga0495648_0018081 | |||
| 1170 | Ga0495648_0022334 | |||
| 1171 | Ga0495648_0117542 | |||
| 1172 | Ga0495652_0006687 | |||
| 1173 | Ga0495652_0092769 | |||
| 1174 | Ga0495652_0116127 | |||
| 1175 | Ga0495665_0001927 | |||
| 1176 | Ga0495640_0011531 | |||
| 1177 | Ga0495640_0030678 | |||
| 1178 | Ga0495640_0038204 | |||
| 1179 | Ga0495640_0042066 | |||
| 1180 | Ga0495587_0046902 | |||
| 1181 | Ga0495609_0035942 | |||
| 1182 | Ga0495597_0031143 | |||
| 1183 | Ga0495597_0035593 | |||
| 1184 | Ga0495645_0022180 | |||
| 1185 | Ga0495622_0003099 | |||
| 1186 | Ga0495622_0021149 | |||
| 1187 | Ga0495622_0047249 | |||
| 1188 | Ga0495667_0036546 | |||
| 1189 | Ga0495667_0188679 | |||
| 1190 | Ga0495656_0016437 | |||
| 1191 | Ga0495668_0073887 | |||
| 1192 | Ga0495668_0131715 | |||
| 1193 | Ga0495668_0163237 | |||
| 1194 | Ga0495634_0009148 | |||
| 1195 | Ga0495634_0120745 | |||
| 1196 | Ga0495634_0172734 | |||
| 1197 | Ga0495635_0010698 | |||
| 1198 | Ga0495635_0014509 | |||
| 1199 | Ga0495635_0149767 | |||
| 1200 | Ga0495588_0001193 | |||
| 1201 | Ga0495588_0058679 | |||
| 1202 | Ga0495588_0083342 | |||
| 1203 | Ga0495657_0012827 | |||
| 1204 | Ga0495657_0014120 | |||
| 1205 | Ga0495657_0044727 | |||
| 1206 | Ga0495599_0015254 | |||
| 1207 | Ga0495599_0030631 | |||
| 1208 | Ga0495623_0012533 | |||
| 1209 | Ga0495646_0014943 | |||
| 1210 | Ga0495646_0087275 | |||
| 1211 | Ga0495647_0001826 | |||
| 1212 | Ga0495658_0139698 | |||
| 1213 | Ga0495613_0033811 | |||
| 1214 | Ga0495624_0003980 | |||
| 1215 | Ga0495624_0053135 | |||
| 1216 | Ga0495670_0018866 | |||
| 1217 | Ga0495670_0030396 | |||
| 1218 | Ga0495671_0079710 | |||
| 1219 | Ga0495649_0021090 | |||
| 1220 | Ga0495589_0095991 | |||
| 1221 | Ga0495600_0004461 | |||
| 1222 | Ga0495581_0000264 | |||
| 1223 | Ga0495581_0042277 | |||
| 1224 | Ga0495581_0073663 | |||
| 1225 | Ga0495604_0013466 | |||
| 1226 | Ga0495604_0018489 | |||
| 1227 | Ga0495604_0024608 | |||
| 1228 | Ga0495674_0019160 | |||
| 1229 | Ga0495674_0039658 | |||
| 1230 | Ga0495674_0396562 | |||
| 1231 | Ga0495672_0015945 | |||
| 1232 | Ga0495672_0204690 | |||
| 1233 | Ga0495676_0035575 | |||
| 1234 | Ga0495676_0081735 | |||
| 1235 | Ga0495676_0086954 | |||
| 1236 | Ga0495676_0143954 | |||
| 1237 | Ga0495680_0027951 | |||
| 1238 | Ga0495680_0051282 | |||
| 1239 | Ga0495687_016529 | |||
| 1240 | Ga0495675_0010276 | |||
| 1241 | Ga0495677_0109223 | |||
| 1242 | Ga0495677_0148432 | |||
| 1243 | Ga0495673_0035289 | |||
| 1244 | Ga0495673_0072381 | |||
| 1245 | Ga0495681_0178914 | |||
| 1246 | Ga0495684_0098047 | |||
| 1247 | Ga0495686_0085563 | |||
| 1248 | Ga0495686_0128524 | |||
| 1249 | Ga0495593_0009834 | |||
| 1250 | Ga0495602_0035417 | |||
| 1251 | Ga0495602_0115265 | |||
| 1252 | Ga0495614_0010397 | |||
| 1253 | Ga0495615_0006910 | |||
| 1254 | Ga0496101_0182190 | |||
| 1255 | Ga0496102_0042791 | |||
| 1256 | Ga0496102_0047156 | |||
| 1257 | Ga0496102_0087218 | |||
| 1258 | Ga0496102_0868426 | |||
| 1259 | Ga0496103_0014246 | |||
| 1260 | Ga0496103_0205421 | |||
| 1261 | Ga0496104_0001527 | |||
| 1262 | Ga0496104_0165226 | |||
| 1263 | Ga0496104_0217273 | |||
| 1264 | Ga0496104_0245271 | |||
| 1265 | Ga0496105_0022915 | |||
| 1266 | Ga0496105_0034191 | |||
| 1267 | Ga0496105_0117212 | |||
| 1268 | Ga0496106_0207173 | |||
| 1269 | Ga0496106_0291084 | |||
| 1270 | Ga0496107_0084351 | |||
| 1271 | Ga0496107_0177432 | |||
| 1272 | Ga0496107_0207282 | |||
| 1273 | Ga0496108_0344508 | |||
| 1274 | Ga0496109_0375385 | |||
| 1275 | Ga0496110_0101641 | |||
| 1276 | Ga0496110_0243276 | |||
| 1277 | Ga0496111_0104195 | |||
| 1278 | Ga0496111_0391621 | |||
| 1279 | Ga0496112_0067048 | |||
| 1280 | Ga0496112_0137037 | |||
| 1281 | Ga0496112_0211128 | |||
| 1282 | Ga0496112_0242836 | |||
| 1283 | Ga0496113_0105718 | |||
| 1284 | Ga0496113_0392417 | |||
| 1285 | Ga0496114_0147645 | |||
| 1286 | Ga0496115_0027627 | |||
| 1287 | Ga0496115_0246876 | |||
| 1288 | Ga0496116_0004921 | |||
| 1289 | Ga0496116_0024999 | |||
| 1290 | Ga0496116_0120391 | |||
| 1291 | Ga0496117_0063202 | |||
| 1292 | Ga0496117_0077757 | |||
| 1293 | Ga0496117_0093791 | |||
| 1294 | Ga0496117_0149679 | |||
| 1295 | Ga0496118_0022470 | |||
| 1296 | Ga0496118_0044354 | |||
| 1297 | Ga0496118_0062035 | |||
| 1298 | Ga0496119_0040487 | |||
| 1299 | Ga0496119_0076492 | |||
| 1300 | Ga0496119_0151590 | |||
| 1301 | Ga0496119_0169471 | |||
| 1302 | Ga0496120_0005676 | |||
| 1303 | Ga0496120_0026012 | |||
| 1304 | Ga0496121_0006604 | |||
| 1305 | Ga0496121_0006859 | |||
| 1306 | Ga0496121_0036077 | |||
| 1307 | Ga0496121_0046487 | |||
| 1308 | Ga0496121_0082638 | |||
| 1309 | Ga0496121_0087594 | |||
| 1310 | Ga0496121_0137321 | |||
| 1311 | Ga0496121_0141556 | |||
| 1312 | Ga0496121_0189086 | |||
| 1313 | Ga0496121_0193092 | |||
| 1314 | Ga0496122_0045609 | |||
| 1315 | Ga0496122_0226682 | |||
| 1316 | Ga0496123_0101067 | |||
| 1317 | Ga0496124_0023449 | |||
| 1318 | Ga0496124_0043186 | |||
| 1319 | Ga0496124_0089346 | |||
| 1320 | Ga0496124_0170038 | |||
| 1321 | Ga0496125_0007927 | |||
| 1322 | Ga0496125_0016974 | |||
| 1323 | Ga0496125_0061209 | |||
| 1324 | Ga0496125_0094053 | |||
| 1325 | Ga0496125_0125224 | |||
| 1326 | Ga0496125_0220286 | |||
| 1327 | Ga0496126_0017021 | |||
| 1328 | Ga0496126_0052786 | |||
| 1329 | Ga0496126_0059832 | |||
| 1330 | Ga0496126_0247609 | |||
| 1331 | Ga0496126_0270259 | |||
| 1332 | Ga0501079_0328435 | |||
| 1333 | nmdc:mga03683_86224_c1 | |||
| 1334 | nmdc:mga03n38_139933_c1 | |||
| 1335 | nmdc:mga00v17_26969_c1 | |||
| 1336 | nmdc:mga00v17_286890_c1 | |||
| 1337 | nmdc:mga00v17_62020_c1 | |||
| 1338 | nmdc:mga0yw44_129872_c1 | |||
| 1339 | nmdc:mga0yw44_14033_c1 | |||
| 1340 | nmdc:mga0yw44_21950_c1 | |||
| 1341 | nmdc:mga0yw44_3590_c1 | |||
| 1342 | nmdc:mga0yw44_76043_c1 | |||
| 1343 | nmdc:mga0yw44_89462_c1 | |||
| 1344 | nmdc:mga0yw44_95057_c1 | |||
| 1345 | nmdc:mga0yw44_96208_c1 | |||
| 1346 | nmdc:mga0k408_55414_c1 | |||
| 1347 | nmdc:mga06z11_122121_c1 | |||
| 1348 | nmdc:mga06z11_29098_c1 | |||
| 1349 | nmdc:mga07m45_13136_c1 | |||
| 1350 | nmdc:mga07m45_78151_c1 | |||
| 1351 | nmdc:mga05p37_341124_c1 | |||
| 1352 | nmdc:mga08y16_342172_c1 | |||
| 1353 | nmdc:mga0sz30_207623_c1 | |||
| 1354 | nmdc:mga0sz30_95436_c1 | |||
| 1355 | Ga0495612_0006842 | |||
| 1356 | Ga0495595_0028782 | |||
| 1357 | Ga0500578_0120652 | |||
| 1358 | Ga0500578_0142288 | |||
| 1359 | Ga0500643_000091 | |||
| 1360 | Ga0500646_0022320 | |||
| 1361 | Ga0500651_0001429 | |||
| 1362 | Ga0500651_0021819 | |||
| 1363 | Ga0500566_0000199 | |||
| 1364 | Ga0500566_0001852 | |||
| 1365 | Ga0500650_0098265 | |||
| 1366 | Ga0500650_0170985 | |||
| 1367 | Ga0500555_009112 | |||
| 1368 | Ga0500555_030650 | |||
| 1369 | Ga0500556_0000267 | |||
| 1370 | Ga0500557_000043 | |||
| 1371 | Ga0500562_006383 | |||
| 1372 | Ga0500562_006987 | |||
| 1373 | Ga0500569_001915 | |||
| 1374 | Ga0500595_022371 | |||
| 1375 | Ga0500595_036005 | |||
| 1376 | Ga0500595_065251 | |||
| 1377 | Ga0500607_087066 | |||
| 1378 | Ga0500642_0000582 | |||
| 1379 | Ga0500642_0056276 | |||
| 1380 | Ga0500642_0094796 | |||
| 1381 | Ga0500655_013151 | |||
| 1382 | Ga0500658_0026391 | |||
| 1383 | Ga0500559_0054545 | |||
| 1384 | Ga0500559_0092826 | |||
| 1385 | Ga0500564_094409 | |||
| 1386 | Ga0500568_0001711 | |||
| 1387 | Ga0500568_0014409 | |||
| 1388 | Ga0500568_0034178 | |||
| 1389 | Ga0500568_0045480 | |||
| 1390 | Ga0500586_008951 | |||
| 1391 | Ga0500588_0115984 | |||
| 1392 | Ga0500604_0105976 | |||
| 1393 | Ga0500616_0000197 | |||
| 1394 | Ga0500616_0045474 | |||
| 1395 | Ga0500616_0083129 | |||
| 1396 | Ga0500620_002074 | |||
| 1397 | Ga0500622_0003992 | |||
| 1398 | Ga0500622_0007515 | |||
| 1399 | Ga0500622_0021604 | |||
| 1400 | Ga0500622_0176558 | |||
| 1401 | Ga0500633_0013684 | |||
| 1402 | Ga0500634_0015616 | |||
| 1403 | Ga0500634_0039728 | |||
| 1404 | Ga0500638_028725 | |||
| 1405 | Ga0500639_129349 | |||
| 1406 | Ga0500636_0000958 | |||
| 1407 | Ga0500636_0005903 | |||
| 1408 | Ga0500637_0138137 | |||
| 1409 | Ga0500625_000057 | |||
| 1410 | Ga0500601_000162 | |||
| 1411 | 2507504794 | |||
| 1412 | 2508546148 | |||
| 1413 | 2508695084 | |||
| 1414 | 2511400464 | |||
| 1415 | 2513626181 | |||
| 1416 | 2513641864 | |||
| 1417 | 2513694096 | |||
| 1418 | 2513702870 | |||
| 1419 | 2513715648 | |||
| 1420 | 2513855891 | |||
| 1421 | 2513873962 | |||
| 1422 | 2513894307 | |||
| 1423 | 2514012936 | |||
| 1424 | 2515625913 | |||
| 1425 | 2517102438 | |||
| 1426 | 2517888507 | |||
| 1427 | 2524435694 | |||
| 1428 | 2524535190 | |||
| 1429 | 2528850351 | |||
| 1430 | 2603857504 | |||
| 1431 | 2617353008 | |||
| 1432 | 2617374180 | |||
| 1433 | 2644741994 | |||
| 1434 | 2745078990 | |||
| 1435 | 2793063148 | |||
| 1436 | 2793067328 | |||
| 1437 | 2793077049 | |||
| 1438 | 2805919451 | |||
| 1439 | 2818237230 | |||
| 1440 | 2824624802 | |||
| 1441 | 2824633674 | |||
| 1442 | 2824641544 | |||
| 1443 | 2824663615 | |||
| 1444 | 2824675408 | |||
| 1445 | 2824691626 | |||
| 1446 | 2824709452 | |||
| 1447 | 2824731199 | |||
| 1448 | 2824748176 | |||
| 1449 | 2824758443 | |||
| 1450 | 2824768855 | |||
| 1451 | 2824774991 | |||
| 1452 | 2838129508 | |||
| 1453 | 2841763401 | |||
| 1454 | 2841944409 | |||
| 1455 | 2841951550 | |||
| 1456 | 2841964662 | |||
| 1457 | 2841969186 | |||
| 1458 | 2841982987 | |||
| 1459 | 2841990859 | |||
| 1460 | 2842043932 | |||
| 1461 | 2842052078 | |||
| 1462 | 2844108728 | |||
| 1463 | 2844321778 | |||
| 1464 | 2847939744 | |||
| 1465 | 2849082630 | |||
| 1466 | 2851182641 | |||
| 1467 | 2851250835 | |||
| 1468 | 2857511519 | |||
| 1469 | 2857526891 | |||
| 1470 | 2874594243 | |||
| 1471 | 2874608373 | |||
| 1472 | 2874615504 | |||
| 1473 | 2874624372 | |||
| 1474 | 2874636659 | |||
| 1475 | 2874647669 | |||
| 1476 | 2876764992 | |||
| 1477 | 2876771891 | |||
| 1478 | 2876815893 | |||
| 1479 | 2876819197 | |||
| 1480 | 2879075742 | |||
| 1481 | 2879089996 | |||
| 1482 | 2879101296 | |||
| 1483 | 2879112860 | |||
| 1484 | 2879130727 | |||
| 1485 | 2879146113 | |||
| 1486 | 2881672896 | |||
| 1487 | 2885371445 | |||
| 1488 | 2885410841 | |||
| 1489 | 2888380017 | |||
| 1490 | 2888391085 | |||
| 1491 | 2888420822 | |||
| 1492 | 2889035815 | |||
| 1493 | 2903727672 | |||
| 1494 | 2903756755 | |||
| 1495 | 2904672289 | |||
| 1496 | 2904699339 | |||
| 1497 | 2904708030 | |||
| 1498 | 2904716018 | |||
| 1499 | 2906602838 | |||
| 1500 | 2906614126 | |||
| 1501 | 2906634433 | |||
| 1502 | 2906644992 | |||
| 1503 | 2908747047 | |||
| 1504 | 2908764749 | |||
| 1505 | 2908776655 | |||
| 1506 | 2919078008 | |||
| 1507 | 2922364298 | |||
| 1508 | 2922378399 | |||
| 1509 | 2922388996 | |||
| 1510 | 2922400315 | |||
| 1511 | 2922425955 | |||
| 1512 | 2929622501 | |||
| 1513 | 2929631281 | |||
| 1514 | 2932786298 | |||
| 1515 | 2932794733 | |||
| 1516 | 2932805457 | |||
| 1517 | 2932812628 | |||
| 1518 | 2932822990 | |||
| 1519 | 2932829536 | |||
| 1520 | 2933584420 | |||
| 1521 | 2935615005 | |||
| 1522 | 2935618054 | |||
| 1523 | 2935636685 | |||
| 1524 | 2935641548 | |||
| 1525 | 2935651647 | |||
| 1526 | 2935659585 | |||
| 1527 | 2935669394 | |||
| 1528 | 2935678008 | |||
| 1529 | 2935693671 | |||
| 1530 | 2935701753 | |||
| 1531 | 2935707218 | |||
| 1532 | 2935717060 | |||
| 1533 | 2935730106 | |||
| 1534 | 2935738474 | |||
| 1535 | 2935750262 | |||
| 1536 | 2935759856 | |||
| 1537 | 2935764493 | |||
| 1538 | 2935772822 | |||
| 1539 | 2935778042 | |||
| 1540 | 2935787269 | |||
| 1541 | 2935795943 | |||
| 1542 | 2935804402 | |||
| 1543 | 2935817263 | |||
| 1544 | 2935825957 | |||
| 1545 | 2935831279 | |||
| 1546 | 2935841888 | |||
| 1547 | 2935851576 | |||
| 1548 | 2935856447 | |||
| 1549 | 2935871011 | |||
| 1550 | 2935874527 | |||
| 1551 | 2935888946 | |||
| 1552 | 2935910401 | |||
| 1553 | 2935918313 | |||
| 1554 | 2935927688 | |||
| 1555 | 2935936440 | |||
| 1556 | 2935944007 | |||
| 1557 | 2935952444 | |||
| 1558 | 2935964192 | |||
| 1559 | 2935969284 | |||
| 1560 | 2935977955 | |||
| 1561 | 2935984745 | |||
| 1562 | 2935993988 | |||
| 1563 | 2936005001 | |||
| 1564 | 2936014001 | |||
| 1565 | 2936023090 | |||
| 1566 | 2936031226 | |||
| 1567 | 2936044059 | |||
| 1568 | 2936049348 | |||
| 1569 | 2936055915 | |||
| 1570 | 2940565690 | |||
| 1571 | 2941513321 | |||
| 1572 | 2941521284 | |||
| 1573 | 2941529004 | |||
| 1574 | 2941532306 | |||
| 1575 | 2941543961 | |||
| 1576 | 3003670037 | |||
| 1577 | 3005483598 | |||
| 1578 | 3005491047 | |||
| 1579 | 3005509592 | |||
| 1580 | 3005594190 | |||
| 1581 | 3005602124 | |||
| 1582 | 3005717880 | |||
| 1583 | 3005724912 | |||
| 1584 | 643597897 | |||
| 1585 | 8006930535 | |||
| 1586 | 8006936654 | |||
| 1587 | 8006976624 | |||
| 1588 | 8006992395 | |||
| 1589 | 8007000016 | |||
| 1590 | 8016518692 | |||
| 1591 | 8016526653 | |||
| 1592 | 8016531739 | |||
| 1593 | 8016544938 | |||
| 1594 | 8016557132 | |||
| 1595 | 8016565483 | |||
| 1596 | 8016570015 | |||
| 1597 | 8016582585 | |||
| 1598 | 8016586896 | |||
| 1599 | 8016603114 | |||
| 1600 | 8016606023 | |||
| 1601 | 8016617912 | |||
| 1602 | 8016623663 | |||
| 1603 | 8016636135 | |||
| 1604 | 8017057981 | |||
| 1605 | 8019531563 | |||
| 1606 | 8019539971 | |||
| 1607 | 8019550684 | |||
| 1608 | 8019562061 | |||
| 1609 | 8019572127 | |||
| 1610 | 8019577739 | |||
| 1611 | 8019595840 | |||
| 1612 | 8019605920 | |||
| 1613 | 8019612615 | |||
| 1614 | 8019622502 | |||
| 1615 | 8019630615 | |||
| 1616 | 8019640001 | |||
| 1617 | 8019652031 | |||
| 1618 | 8019677209 | |||
| 1619 | 8019678775 | |||
| 1620 | 8019696750 | |||
| 1621 | 8055750952 | |||
| 1622 | 8056693922 | |||
| 1623 | 8056970866 | |||
| 1624 | 8057534670 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hk8-assembly2.cif.gz_B | crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution | 0.9392 | 11 | 277 |
| 2cy0-assembly1.cif.gz_B | crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with nadp | 0.936 | 12 | 283 |
| 3jyo-assembly1.cif.gz_A | quinate dehydrogenase from corynebacterium glutamicum in complex with nad | 0.9339 | 10 | 280 |
| 2d5c-assembly1.cif.gz_B | crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with shikimate | 0.9319 | 12 | 283 |
| 1o9b-assembly2.cif.gz_B | quinate/shikimate dehydrogenase ydib complexed with nadh | 0.9259 | 12 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tozG01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9325 | 11 | 113 | 3.40.50.10860 |
| af_P0A6D5_8_104_1.10.560.10 | Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain | 0.9289 | 13 | 111 | 1.10.560.10 |
| 2eggB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9277 | 10 | 277 | 3.40.50.10860 |
| af_Q58484_1_94_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9211 | 9 | 100 | 3.40.50.10860 |
| 2ez3A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9163 | 112 | 247 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W6C3N2-F1-model_v4 | shikimate dehydrogenase (NADP(+)) (EC 1.1.1.25) | 0.9597 | 9 | 287 |
GO:0004764
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0019632 GO:0050661 |
| AF-A0A7W6BF78-F1-model_v4 | Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) | 0.9589 | 9 | 281 |
GO:0004764
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0019632 GO:0050661 |
| AF-A0A1S1PFM4-F1-model_v4 | deleted | 0.9575 | 8 | 285 |
|
| AF-A0A2G8TFV1-F1-model_v4 | Shikimate dehydrogenase | 0.9559 | 9 | 290 |
GO:0004764
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0019632 GO:0050661 |
| AF-A0A829XXG9-F1-model_v4 | deleted | 0.9555 | 30 | 281 |
|