F481908

General Info

Members Datasets Scaffolds Average Seq Length
812 366 1624 154

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_010229|Ga0500595_010229_1590_2111
Length 173
Sequence MKASALTGSALTEEKAYLMADRVDSKLAELGLTLPAPAAPVASYVPTVEAGGLLHVSGQLPFKDGAVMTGRLGADANLAYGQEAAQRCALMLVAQIKAALGGLHRVERIVKLGVFVNSAPGFTDQPKVANGASDLMFALFGDAGRHARSAVGVSALPLGAAVEVDAIIQIAMH

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
163 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
197 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
198 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
210 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
215 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
216 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
217 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
218 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
221 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
303 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
304 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
305 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
306 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
311 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
321 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
322 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
327 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
330 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
331 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
332 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
338 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
339 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
343 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
344 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
345 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
346 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
347 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
352 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
353 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
354 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
355 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
356 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
357 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
358 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
359 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
360 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
361 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
362 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
363 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
364 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
365 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
366 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.37
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 12.19
Nodule 0
Rhizoplane 3.57
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_010229 3300053119 Bacteria 3737
2 SwRhRL2b_contig_2687397 2162886007 Bacteria 1122
3 ARcpr5oldR_c001506 3300000041 Bacteria 2339
4 JGI24752J21851_1001224 3300001976 Bacteria 3494
5 JGI24740J21852_10025651 3300001979 Bacteria 1984
6 JGI24739J22299_10000524 3300001989 Bacteria 13667
7 JGI24739J22299_10002936 3300001989 Bacteria 6534
8 JGI24739J22299_10013165 3300001989 Bacteria 3026
9 JGI24737J22298_10007810 3300001990 Bacteria 3606
10 JGI24735J21928_10003268 3300002067 Bacteria 5544
11 JGI24735J21928_10019703 3300002067 Bacteria 2072
12 JGI24735J21928_10109069 3300002067 Bacteria 796
13 JGI24748J21848_1019863 3300002074 Bacteria 808
14 JGI24738J21930_10003430 3300002075 Bacteria 3999
15 JGI24738J21930_10003879 3300002075 Bacteria 3732
16 JGI25151J46595_10088405 3300003187 Bacteria 871
17 JGI25165J46597_1000010 3300003214 Bacteria 442113
18 JGI25153J46596_10006448 3300003215 Bacteria 5922
19 Ga0055537_1000460 3300003773 Bacteria 25614
20 Ga0055524_1000155 3300003775 Bacteria 79672
21 Ga0055536_1003969 3300003781 Bacteria 7746
22 Ga0055536_1006424 3300003781 Bacteria 5495
23 Ga0055536_1015396 3300003781 Bacteria 2621
24 Ga0055534_1019585 3300003784 Bacteria 1158
25 Ga0055530_10000115 3300003791 Bacteria 70229
26 Ga0055530_10001208 3300003791 Bacteria 19993
27 Ga0055530_10008781 3300003791 Bacteria 3991
28 Ga0055531_10000792 3300003794 Bacteria 26275
29 Ga0055531_10002671 3300003794 Bacteria 11762
30 Ga0055531_10006063 3300003794 Bacteria 6926
31 Ga0055531_10006683 3300003794 Bacteria 6467
32 Ga0065165_1007583 3300005262 Bacteria 5287
33 Ga0065165_1018077 3300005262 Bacteria 2569
34 Ga0065165_1041615 3300005262 Bacteria 1363
35 Ga0065704_10074901 3300005289 Bacteria 5927
36 Ga0065707_10081882 3300005295 Bacteria 31785
37 Ga0070658_10000003 3300005327 Bacteria 465963
38 Ga0070658_10021495 3300005327 Bacteria 5171
39 Ga0070658_10030316 3300005327 Bacteria 4346
40 Ga0070658_10033779 3300005327 Bacteria 4116
41 Ga0070658_10054034 3300005327 Bacteria 3261
42 Ga0070658_10166424 3300005327 Bacteria 1851
43 Ga0070683_100559908 3300005329 Bacteria 1093
44 Ga0070670_100000030 3300005331 Bacteria 164211
45 Ga0070670_100746266 3300005331 Bacteria 882
46 Ga0070670_101154386 3300005331 Bacteria 707
47 Ga0070680_100025459 3300005336 Bacteria 4730
48 Ga0070680_100034426 3300005336 Bacteria 4083
49 Ga0070680_100104058 3300005336 Bacteria 2359
50 Ga0070680_100837885 3300005336 Bacteria 793
51 Ga0070682_100579292 3300005337 Bacteria 883
52 Ga0068868_100565982 3300005338 Bacteria 1003
53 Ga0070660_100057997 3300005339 Bacteria 3001
54 Ga0070660_100059329 3300005339 Bacteria 2967
55 Ga0070660_100088967 3300005339 Bacteria 2432
56 Ga0070660_100107890 3300005339 Bacteria 2213
57 Ga0070660_100397916 3300005339 Bacteria 1139
58 Ga0070660_100408703 3300005339 Bacteria 1123
59 Ga0070661_100139342 3300005344 Bacteria 1827
60 Ga0070661_100267307 3300005344 Bacteria 1323
61 Ga0070661_100585399 3300005344 Bacteria 901
62 Ga0070692_10000142 3300005345 Bacteria 17361
63 Ga0070692_10159865 3300005345 Bacteria 1290
64 Ga0070668_100000011 3300005347 Bacteria 123099
65 Ga0070671_100003480 3300005355 Bacteria 12284
66 Ga0070671_100093078 3300005355 Bacteria 2526
67 Ga0070671_100671018 3300005355 Bacteria 898
68 Ga0070673_100015570 3300005364 Bacteria 5348
69 Ga0070673_100828271 3300005364 Bacteria 856
70 Ga0070659_100003069 3300005366 Bacteria 11859
71 Ga0070659_100021627 3300005366 Bacteria 4902
72 Ga0070659_100090402 3300005366 Bacteria 2453
73 Ga0070659_100157669 3300005366 Bacteria 1854
74 Ga0070659_100202257 3300005366 Bacteria 1635
75 Ga0070667_100000161 3300005367 Bacteria 83551
76 Ga0070667_100383351 3300005367 Bacteria 1277
77 Ga0070714_100263657 3300005435 Bacteria 1596
78 Ga0070714_100556978 3300005435 Bacteria 1098
79 Ga0070708_100141656 3300005445 Bacteria 2230
80 Ga0070663_100003059 3300005455 Bacteria 9565
81 Ga0070663_100044176 3300005455 Bacteria 3140
82 Ga0070663_100050017 3300005455 Bacteria 2971
83 Ga0070662_100016573 3300005457 Bacteria 4949
84 Ga0070662_100065006 3300005457 Bacteria 2673
85 Ga0070662_100121909 3300005457 Bacteria 1999
86 Ga0070681_10029494 3300005458 Bacteria 5510
87 Ga0070681_10072402 3300005458 Bacteria 3409
88 Ga0070681_10105457 3300005458 Bacteria 2760
89 Ga0070681_10172151 3300005458 Bacteria 2087
90 Ga0070706_100028793 3300005467 Bacteria 5116
91 Ga0070679_100077764 3300005530 Bacteria 3307
92 Ga0070679_100095520 3300005530 Bacteria 2960
93 Ga0070679_100173758 3300005530 Bacteria 2127
94 Ga0070679_100191645 3300005530 Bacteria 2013
95 Ga0070679_100332936 3300005530 Bacteria 1467
96 Ga0070679_100340828 3300005530 Bacteria 1447
97 Ga0070679_100650877 3300005530 Bacteria 996
98 Ga0070679_100651978 3300005530 Bacteria 995
99 Ga0070684_100329502 3300005535 Bacteria 1403
100 Ga0068853_100012834 3300005539 Bacteria 6825
101 Ga0068853_100054892 3300005539 Bacteria 3433
102 Ga0068853_100067073 3300005539 Bacteria 3117
103 Ga0068853_100072366 3300005539 Bacteria 3004
104 Ga0068853_100220247 3300005539 Bacteria 1733
105 Ga0068853_100247300 3300005539 Bacteria 1636
106 Ga0068853_100642700 3300005539 Bacteria 1009
107 Ga0068853_101379521 3300005539 Bacteria 681
108 Ga0070695_100075268 3300005545 Bacteria 2220
109 Ga0070696_100021044 3300005546 Bacteria 4420
110 Ga0070696_100461594 3300005546 Bacteria 1004
111 Ga0070693_100148555 3300005547 Bacteria 1482
112 Ga0070693_100198996 3300005547 Bacteria 1300
113 Ga0070665_100044221 3300005548 Bacteria 4472
114 Ga0070665_100291629 3300005548 Bacteria 1634
115 Ga0070665_100359322 3300005548 Bacteria 1462
116 Ga0070704_100316459 3300005549 Bacteria 1306
117 Ga0068855_100048687 3300005563 Bacteria 5001
118 Ga0068855_100051070 3300005563 Bacteria 4871
119 Ga0068855_100129913 3300005563 Bacteria 2877
120 Ga0068855_100189877 3300005563 Bacteria 2318
121 Ga0068855_100289358 3300005563 Bacteria 1817
122 Ga0068855_100302634 3300005563 Bacteria 1770
123 Ga0068855_100315793 3300005563 Bacteria 1728
124 Ga0068855_100454337 3300005563 Bacteria 1397
125 Ga0068855_100619267 3300005563 Bacteria 1166
126 Ga0070664_100107856 3300005564 Bacteria 2428
127 Ga0070664_100183721 3300005564 Bacteria 1860
128 Ga0070664_100853026 3300005564 Bacteria 853
129 Ga0070664_101305074 3300005564 Bacteria 685
130 Ga0068857_100041693 3300005577 Bacteria 4070
131 Ga0068857_100094218 3300005577 Bacteria 2681
132 Ga0068857_100142446 3300005577 Bacteria 2167
133 Ga0068857_100276997 3300005577 Bacteria 1542
134 Ga0068854_100000559 3300005578 Bacteria 22307
135 Ga0068854_100026578 3300005578 Bacteria 3980
136 Ga0068854_100039382 3300005578 Bacteria 3329
137 Ga0068854_100055677 3300005578 Bacteria 2848
138 Ga0068854_100417427 3300005578 Bacteria 1114
139 Ga0068854_100527255 3300005578 Bacteria 998
140 Ga0068854_100764096 3300005578 Bacteria 839
141 Ga0068856_100027149 3300005614 Bacteria 5586
142 Ga0068856_100052866 3300005614 Bacteria 4006
143 Ga0068856_100072762 3300005614 Bacteria 3403
144 Ga0068856_100115596 3300005614 Bacteria 2683
145 Ga0068856_100427271 3300005614 Bacteria 1345
146 Ga0068856_101210619 3300005614 Bacteria 771
147 Ga0068852_100032215 3300005616 Bacteria 4337
148 Ga0068852_100047102 3300005616 Bacteria 3676
149 Ga0068852_100048090 3300005616 Bacteria 3643
150 Ga0068852_100058186 3300005616 Bacteria 3347
151 Ga0068852_100073666 3300005616 Bacteria 3005
152 Ga0068852_100814070 3300005616 Bacteria 948
153 Ga0068852_100922176 3300005616 Bacteria 891
154 Ga0068852_101108464 3300005616 Bacteria 812
155 Ga0068859_100032942 3300005617 Bacteria 5205
156 Ga0068859_100213296 3300005617 Bacteria 2017
157 Ga0068859_100481698 3300005617 Bacteria 1336
158 Ga0068864_100000041 3300005618 Bacteria 165878
159 Ga0068864_100018954 3300005618 Bacteria 5753
160 Ga0068861_100772769 3300005719 Bacteria 899
161 Ga0068851_10021086 3300005834 Bacteria 3161
162 Ga0068851_10022086 3300005834 Bacteria 3096
163 Ga0068863_100000035 3300005841 Bacteria 165877
164 Ga0068863_100000186 3300005841 Bacteria 65963
165 Ga0068863_100593238 3300005841 Bacteria 1096
166 Ga0068858_100000102 3300005842 Bacteria 88959
167 Ga0068858_100001966 3300005842 Bacteria 20993
168 Ga0068858_100309087 3300005842 Bacteria 1509
169 Ga0068858_100575641 3300005842 Bacteria 1091
170 Ga0068862_100000042 3300005844 Bacteria 165084
171 Ga0068862_100312956 3300005844 Bacteria 1447
172 Ga0081455_10000405 3300005937 Bacteria 56782
173 Ga0075368_10116970 3300006042 Bacteria 1102
174 Ga0075369_10165462 3300006186 Bacteria 1014
175 Ga0097621_100285331 3300006237 Bacteria 1454
176 Ga0068871_100005363 3300006358 Bacteria 8984
177 Ga0068871_100682245 3300006358 Bacteria 940
178 Ga0075428_100050761 3300006844 Bacteria 4548
179 Ga0075428_101653890 3300006844 Bacteria 669
180 Ga0075429_100424676 3300006880 Bacteria 1164
181 Ga0097620_100032942 3300006931 Bacteria 5205
182 Ga0097620_100213276 3300006931 Bacteria 2017
183 Ga0097620_100481677 3300006931 Bacteria 1336
184 Ga0105240_10008649 3300009093 Bacteria 14545
185 Ga0105240_10022129 3300009093 Bacteria 8435
186 Ga0105240_10186565 3300009093 Bacteria 2442
187 Ga0105240_10699040 3300009093 Bacteria 1107
188 Ga0105240_10929977 3300009093 Bacteria 934
189 Ga0111539_10016465 3300009094 Bacteria 9167
190 Ga0105245_10001046 3300009098 Bacteria 25053
191 Ga0105247_10038819 3300009101 Bacteria 2908
192 Ga0105247_10109991 3300009101 Bacteria 1772
193 Ga0114129_10170049 3300009147 Bacteria 2972
194 Ga0105243_10028129 3300009148 Bacteria 4313
195 Ga0105241_10194511 3300009174 Bacteria 1690
196 Ga0105241_10832781 3300009174 Bacteria 852
197 Ga0105248_10000045 3300009177 Bacteria 165909
198 Ga0105248_10003638 3300009177 Bacteria 17113
199 Ga0105248_10028673 3300009177 Bacteria 6203
200 Ga0105248_10032137 3300009177 Bacteria 5866
201 Ga0105248_10392213 3300009177 Bacteria 1563
202 Ga0105237_10104546 3300009545 Bacteria 2823
203 Ga0105237_10181775 3300009545 Bacteria 2103
204 Ga0105237_10216772 3300009545 Bacteria 1914
205 Ga0105237_11559915 3300009545 Bacteria 667
206 Ga0105238_10035938 3300009551 Bacteria 5036
207 Ga0105238_10036999 3300009551 Bacteria 4963
208 Ga0105238_10067960 3300009551 Bacteria 3564
209 Ga0105238_10092085 3300009551 Bacteria 3019
210 Ga0105238_10390045 3300009551 Bacteria 1385
211 Ga0105238_10402836 3300009551 Bacteria 1361
212 Ga0105238_10707038 3300009551 Bacteria 1020
213 Ga0105249_10000055 3300009553 Bacteria 161674
214 Ga0105249_10014831 3300009553 Bacteria 6890
215 Ga0105239_10089892 3300010375 Bacteria 3387
216 Ga0105239_12106981 3300010375 Bacteria 655
217 Ga0157373_10016847 3300013100 Bacteria 5328
218 Ga0157373_10040258 3300013100 Bacteria 3344
219 Ga0157373_10075053 3300013100 Bacteria 2385
220 Ga0157373_10242676 3300013100 Bacteria 1273
221 Ga0157373_10551089 3300013100 Bacteria 836
222 Ga0157371_10155848 3300013102 Bacteria 1630
223 Ga0157371_10172510 3300013102 Bacteria 1546
224 Ga0157371_10306500 3300013102 Bacteria 1150
225 Ga0157370_10036353 3300013104 Bacteria 4779
226 Ga0157370_10125312 3300013104 Bacteria 2398
227 Ga0157370_10131295 3300013104 Bacteria 2336
228 Ga0157370_10172340 3300013104 Bacteria 2011
229 Ga0157370_10724662 3300013104 Bacteria 907
230 Ga0157369_10002615 3300013105 Bacteria 21530
231 Ga0157369_10070306 3300013105 Bacteria 3761
232 Ga0157369_10121654 3300013105 Bacteria 2769
233 Ga0157369_10322135 3300013105 Bacteria 1607
234 Ga0157374_10155077 3300013296 Bacteria 2228
235 Ga0157378_10037607 3300013297 Bacteria 4288
236 Ga0157378_10048347 3300013297 Bacteria 3782
237 Ga0163162_10009164 3300013306 Bacteria 9631
238 Ga0163162_10009790 3300013306 Bacteria 9326
239 Ga0163162_10010728 3300013306 Bacteria 8913
240 Ga0163162_10639562 3300013306 Bacteria 1188
241 Ga0157372_10002970 3300013307 Bacteria 18265
242 Ga0157372_10319859 3300013307 Bacteria 1807
243 Ga0157372_10655508 3300013307 Bacteria 1222
244 Ga0157372_10935612 3300013307 Bacteria 1005
245 Ga0157372_11340683 3300013307 Bacteria 825
246 Ga0157372_11871339 3300013307 Bacteria 690
247 Ga0157375_12321886 3300013308 Bacteria 640
248 Ga0163163_10248751 3300014325 Bacteria 1828
249 Ga0163163_10257193 3300014325 Bacteria 1797
250 Ga0163163_10450992 3300014325 Bacteria 1346
251 Ga0157380_10007873 3300014326 Bacteria 7583
252 Ga0182008_10505366 3300014497 Bacteria 665
253 Ga0157379_10021517 3300014968 Bacteria 5710
254 Ga0206356_11202361 3300020070 Bacteria 1440
255 Ga0206354_10168296 3300020081 Bacteria 1820
256 Ga0206353_12012794 3300020082 Bacteria 1711
257 Ga0213875_10005097 3300021388 Bacteria 7109
258 Ga0209437_111975 3300025233 Bacteria 1280
259 Ga0207425_1007250 3300025245 Bacteria 2948
260 Ga0209646_1015807 3300025246 Bacteria 1124
261 Ga0209233_1000044 3300025261 Bacteria 489783
262 Ga0209565_1000011 3300025263 Bacteria 637062
263 Ga0209455_1000772 3300025272 Bacteria 17958
264 Ga0209455_1025746 3300025272 Bacteria 1065
265 Ga0209673_1002122 3300025273 Bacteria 14821
266 Ga0209675_1000104 3300025291 Bacteria 121249
267 Ga0209675_1013492 3300025291 Bacteria 2549
268 Ga0209676_1000807 3300025292 Bacteria 41068
269 Ga0209676_1001060 3300025292 Bacteria 31500
270 Ga0209676_1001199 3300025292 Bacteria 27715
271 Ga0209676_1044912 3300025292 Bacteria 1207
272 Ga0209025_1006362 3300025294 Bacteria 9192
273 Ga0209758_1008891 3300025297 Bacteria 6378
274 Ga0209050_1000071 3300025298 Bacteria 295478
275 Ga0209050_1000286 3300025298 Bacteria 106566
276 Ga0209050_1002140 3300025298 Bacteria 17979
277 Ga0209050_1004981 3300025298 Bacteria 8643
278 Ga0209050_1072435 3300025298 Bacteria 763
279 Ga0209256_1000016 3300025299 Bacteria 599092
280 Ga0209257_1000027 3300025304 Bacteria 703541
281 Ga0209257_1000245 3300025304 Bacteria 125987
282 Ga0209257_1000321 3300025304 Bacteria 100476
283 Ga0209257_1001354 3300025304 Bacteria 29627
284 Ga0209257_1001434 3300025304 Bacteria 28267
285 Ga0209257_1014820 3300025304 Bacteria 3308
286 Ga0207656_10025320 3300025321 Bacteria 2408
287 Ga0207656_10039366 3300025321 Bacteria 1999
288 Ga0207656_10066705 3300025321 Bacteria 1591
289 Ga0207710_10135767 3300025900 Bacteria 1184
290 Ga0207680_10719372 3300025903 Bacteria 716
291 Ga0207647_10007714 3300025904 Bacteria 7748
292 Ga0207647_10024741 3300025904 Bacteria 3957
293 Ga0207647_10028509 3300025904 Bacteria 3624
294 Ga0207705_10002705 3300025909 Bacteria 13560
295 Ga0207705_10009941 3300025909 Bacteria 6927
296 Ga0207705_10026902 3300025909 Bacteria 4099
297 Ga0207705_10033221 3300025909 Bacteria 3685
298 Ga0207705_10106802 3300025909 Bacteria 2065
299 Ga0207705_10427571 3300025909 Bacteria 1026
300 Ga0207684_10421321 3300025910 Bacteria 1147
301 Ga0207654_10517952 3300025911 Bacteria 844
302 Ga0207654_10792998 3300025911 Bacteria 684
303 Ga0207707_10044083 3300025912 Bacteria 3890
304 Ga0207707_10149531 3300025912 Bacteria 2042
305 Ga0207707_10191173 3300025912 Bacteria 1786
306 Ga0207695_10026017 3300025913 Bacteria 6537
307 Ga0207695_10199135 3300025913 Bacteria 1918
308 Ga0207695_10660640 3300025913 Bacteria 926
309 Ga0207695_11185612 3300025913 Bacteria 644
310 Ga0207671_10024252 3300025914 Bacteria 4564
311 Ga0207671_10081045 3300025914 Bacteria 2433
312 Ga0207671_10088723 3300025914 Bacteria 2327
313 Ga0207660_10000024 3300025917 Bacteria 71220
314 Ga0207660_10060824 3300025917 Bacteria 2717
315 Ga0207660_10225842 3300025917 Bacteria 1471
316 Ga0207660_10447300 3300025917 Bacteria 1044
317 Ga0207660_10490502 3300025917 Bacteria 996
318 Ga0207660_10731325 3300025917 Bacteria 807
319 Ga0207657_10007988 3300025919 Bacteria 10787
320 Ga0207657_10010415 3300025919 Bacteria 9281
321 Ga0207657_10046672 3300025919 Bacteria 3793
322 Ga0207657_10053077 3300025919 Bacteria 3514
323 Ga0207657_10103276 3300025919 Bacteria 2363
324 Ga0207657_10109325 3300025919 Bacteria 2285
325 Ga0207657_10112964 3300025919 Bacteria 2241
326 Ga0207657_10583406 3300025919 Bacteria 873
327 Ga0207657_11032159 3300025919 Bacteria 630
328 Ga0207649_10059417 3300025920 Bacteria 2398
329 Ga0207649_10089449 3300025920 Bacteria 2013
330 Ga0207649_10095289 3300025920 Bacteria 1958
331 Ga0207649_10597774 3300025920 Bacteria 848
332 Ga0207652_10073532 3300025921 Bacteria 2974
333 Ga0207652_10092414 3300025921 Bacteria 2662
334 Ga0207652_10148018 3300025921 Bacteria 2102
335 Ga0207652_10159255 3300025921 Bacteria 2023
336 Ga0207652_10293774 3300025921 Bacteria 1466
337 Ga0207652_10410785 3300025921 Bacteria 1221
338 Ga0207652_10480000 3300025921 Bacteria 1120
339 Ga0207652_11018435 3300025921 Bacteria 727
340 Ga0207681_10190284 3300025923 Bacteria 1570
341 Ga0207694_10020412 3300025924 Bacteria 5013
342 Ga0207694_10029168 3300025924 Bacteria 4208
343 Ga0207694_10062555 3300025924 Bacteria 2898
344 Ga0207694_11336831 3300025924 Bacteria 606
345 Ga0207650_10000111 3300025925 Bacteria 107416
346 Ga0207650_10018464 3300025925 Bacteria 4895
347 Ga0207687_10000562 3300025927 Bacteria 25050
348 Ga0207664_10066774 3300025929 Bacteria 2884
349 Ga0207664_10500508 3300025929 Bacteria 1088
350 Ga0207644_10000032 3300025931 Bacteria 133759
351 Ga0207644_10051599 3300025931 Bacteria 2953
352 Ga0207644_10102939 3300025931 Bacteria 2148
353 Ga0207644_10374951 3300025931 Bacteria 1159
354 Ga0207644_10521877 3300025931 Bacteria 981
355 Ga0207644_11753146 3300025931 Bacteria 520
356 Ga0207690_10018054 3300025932 Bacteria 4321
357 Ga0207690_10063579 3300025932 Bacteria 2517
358 Ga0207690_10078402 3300025932 Bacteria 2299
359 Ga0207690_10147247 3300025932 Bacteria 1742
360 Ga0207690_10182553 3300025932 Bacteria 1581
361 Ga0207690_10675176 3300025932 Bacteria 848
362 Ga0207706_10004718 3300025933 Bacteria 12764
363 Ga0207706_10015487 3300025933 Bacteria 6889
364 Ga0207706_10067824 3300025933 Bacteria 3140
365 Ga0207691_10068308 3300025940 Bacteria 3211
366 Ga0207711_10000027 3300025941 Bacteria 236548
367 Ga0207711_10002908 3300025941 Bacteria 15009
368 Ga0207711_10012212 3300025941 Bacteria 7142
369 Ga0207711_10468112 3300025941 Bacteria 1174
370 Ga0207661_10732046 3300025944 Bacteria 910
371 Ga0207679_10033400 3300025945 Bacteria 3620
372 Ga0207679_10228292 3300025945 Bacteria 1570
373 Ga0207679_11018164 3300025945 Bacteria 759
374 Ga0207667_10025172 3300025949 Bacteria 6520
375 Ga0207667_10041234 3300025949 Bacteria 4910
376 Ga0207667_10053956 3300025949 Bacteria 4228
377 Ga0207667_10070885 3300025949 Bacteria 3626
378 Ga0207667_10357924 3300025949 Bacteria 1488
379 Ga0207667_10497892 3300025949 Bacteria 1236
380 Ga0207651_10171341 3300025960 Bacteria 1712
381 Ga0207712_10000813 3300025961 Bacteria 23020
382 Ga0207712_10033349 3300025961 Bacteria 3481
383 Ga0207668_10000034 3300025972 Bacteria 119274
384 Ga0207640_10000202 3300025981 Bacteria 42596
385 Ga0207640_10026210 3300025981 Bacteria 3537
386 Ga0207640_10111478 3300025981 Bacteria 1940
387 Ga0207640_10156959 3300025981 Bacteria 1678
388 Ga0207640_10879216 3300025981 Bacteria 781
389 Ga0207658_10000839 3300025986 Bacteria 25661
390 Ga0207703_10000190 3300026035 Bacteria 72096
391 Ga0207703_10034927 3300026035 Bacteria 3993
392 Ga0207703_10282134 3300026035 Bacteria 1509
393 Ga0207639_10002119 3300026041 Bacteria 13364
394 Ga0207639_10004994 3300026041 Bacteria 8935
395 Ga0207639_10087630 3300026041 Bacteria 2482
396 Ga0207639_10094791 3300026041 Bacteria 2397
397 Ga0207639_10110813 3300026041 Bacteria 2236
398 Ga0207639_10559991 3300026041 Bacteria 1050
399 Ga0207639_10659466 3300026041 Bacteria 968
400 Ga0207639_10846312 3300026041 Bacteria 854
401 Ga0207678_10000455 3300026067 Bacteria 37036
402 Ga0207678_10002000 3300026067 Bacteria 18558
403 Ga0207678_10046585 3300026067 Bacteria 3749
404 Ga0207678_10092769 3300026067 Bacteria 2580
405 Ga0207702_10018713 3300026078 Bacteria 5729
406 Ga0207702_10052142 3300026078 Bacteria 3460
407 Ga0207702_10066422 3300026078 Bacteria 3091
408 Ga0207702_11621557 3300026078 Bacteria 640
409 Ga0207641_10000031 3300026088 Bacteria 224320
410 Ga0207641_10000041 3300026088 Bacteria 191595
411 Ga0207641_10686291 3300026088 Bacteria 1008
412 Ga0207648_10357096 3300026089 Bacteria 1318
413 Ga0207676_10000039 3300026095 Bacteria 171142
414 Ga0207676_10000072 3300026095 Bacteria 101978
415 Ga0207674_10003053 3300026116 Bacteria 20715
416 Ga0207674_10005772 3300026116 Bacteria 14686
417 Ga0207674_10006642 3300026116 Bacteria 13588
418 Ga0207674_10236171 3300026116 Bacteria 1776
419 Ga0207683_11160850 3300026121 Bacteria 716
420 Ga0207698_10025863 3300026142 Bacteria 4143
421 Ga0207698_10041296 3300026142 Bacteria 3436
422 Ga0268266_10056076 3300028379 Bacteria 3389
423 Ga0268266_10064839 3300028379 Bacteria 3157
424 Ga0268265_10000061 3300028380 Bacteria 148625
425 Ga0268265_10146257 3300028380 Bacteria 1986
426 Ga0268264_10000785 3300028381 Bacteria 34613
427 Ga0307517_10075608 3300028786 Bacteria 2952
428 Ga0307515_10325087 3300028794 Bacteria 1201
429 Ga0307512_10435641 3300030522 Bacteria 535
430 Ga0314311_1234836 3300030733 Bacteria 1559
431 Ga0307513_10206273 3300031456 Bacteria 1801
432 Ga0307408_100058897 3300031548 Bacteria 2794
433 Ga0307508_10000011 3300031616 Bacteria 248001
434 Ga0307405_10101755 3300031731 Bacteria 1928
435 Ga0307405_10109097 3300031731 Bacteria 1871
436 Ga0307405_11004197 3300031731 Bacteria 712
437 Ga0307413_10460217 3300031824 Bacteria 1012
438 Ga0307406_10025518 3300031901 Bacteria 3539
439 Ga0307406_10135661 3300031901 Bacteria 1734
440 Ga0307406_10189804 3300031901 Bacteria 1503
441 Ga0307406_10214331 3300031901 Bacteria 1427
442 Ga0307407_10113528 3300031903 Bacteria 1705
443 Ga0307412_10001328 3300031911 Bacteria 13834
444 Ga0307412_10002668 3300031911 Bacteria 9900
445 Ga0307412_10005336 3300031911 Bacteria 7213
446 Ga0307412_10026022 3300031911 Bacteria 3632
447 Ga0307412_10042785 3300031911 Bacteria 2946
448 Ga0307412_10095174 3300031911 Bacteria 2093
449 Ga0307412_11342480 3300031911 Bacteria 645
450 Ga0307409_100021228 3300031995 Bacteria 4448
451 Ga0307409_100277372 3300031995 Bacteria 1547
452 Ga0307416_100032603 3300032002 Bacteria 3939
453 Ga0307416_100273430 3300032002 Bacteria 1660
454 Ga0307416_100339873 3300032002 Bacteria 1513
455 Ga0307414_10001684 3300032004 Bacteria 11495
456 Ga0307414_10001894 3300032004 Bacteria 10813
457 Ga0307414_10002573 3300032004 Bacteria 9542
458 Ga0307414_10009988 3300032004 Bacteria 5481
459 Ga0307414_10046896 3300032004 Bacteria 2970
460 Ga0307414_10115705 3300032004 Bacteria 2051
461 Ga0307414_10133282 3300032004 Bacteria 1932
462 Ga0307414_10159311 3300032004 Bacteria 1791
463 Ga0307414_10365512 3300032004 Bacteria 1243
464 Ga0307414_10393190 3300032004 Bacteria 1202
465 Ga0307414_11189774 3300032004 Bacteria 705
466 Ga0307415_100044257 3300032126 Bacteria 2975
467 Ga0316583_10008044 3300032133 Bacteria 3799
468 Ga0307510_10066895 3300033180 Bacteria 3623
469 Ga0373954_0103957 3300035118 Bacteria 1371
470 Ga0373956_0348221 3300035119 Bacteria 706
471 Ga0373955_0007600 3300035172 Bacteria 4992
472 Ga0373961_0391148 3300035241 Bacteria 532
473 Ga0316574_0203301 3300035398 Bacteria 1272
474 Ga0373935_0578125 3300035692 Bacteria 820
475 Ga0373933_0013243 3300035724 Bacteria 4568
476 Ga0373937_0047729 3300036401 Bacteria 3919
477 Ga0373937_0102021 3300036401 Bacteria 2663
478 Ga0316582_0000490 3300036647 Bacteria 14883
479 Ga0316582_0578966 3300036647 Bacteria 773
480 Ga0316584_0167688 3300036712 Bacteria 1630
481 Ga0316584_0337297 3300036712 Bacteria 1084
482 Ga0395899_0002299 3300037312 Bacteria 15586
483 Ga0395899_0019311 3300037312 Bacteria 5178
484 Ga0395899_0037173 3300037312 Bacteria 3650
485 Ga0395899_0063584 3300037312 Bacteria 2714
486 Ga0395899_0174455 3300037312 Bacteria 1512
487 Ga0395899_0213365 3300037312 Bacteria 1340
488 Ga0395899_0256610 3300037312 Bacteria 1197
489 Ga0395900_0002548 3300037418 Bacteria 19966
490 Ga0395900_0044846 3300037418 Bacteria 4554
491 Ga0395900_0066250 3300037418 Bacteria 3711
492 Ga0395900_0096980 3300037418 Bacteria 3029
493 Ga0395900_0131864 3300037418 Bacteria 2560
494 Ga0395900_0192374 3300037418 Bacteria 2069
495 Ga0395900_0211241 3300037418 Bacteria 1959
496 Ga0395900_0245869 3300037418 Bacteria 1792
497 Ga0395900_0316383 3300037418 Bacteria 1542
498 Ga0395900_0333416 3300037418 Bacteria 1494
499 Ga0395900_0667608 3300037418 Bacteria 975
500 Ga0395900_1286347 3300037418 Bacteria 645
501 Ga0395898_0025707 3300037466 Bacteria 5929
502 Ga0395898_0093802 3300037466 Bacteria 2884
503 Ga0395898_0164557 3300037466 Bacteria 2121
504 Ga0395898_0233521 3300037466 Bacteria 1754
505 Ga0395898_0235873 3300037466 Bacteria 1744
506 Ga0395898_0652849 3300037466 Bacteria 994
507 Ga0395905_0000409 3300037471 Bacteria 60283
508 Ga0395905_0007919 3300037471 Bacteria 10511
509 Ga0395905_0029823 3300037471 Bacteria 5142
510 Ga0395905_0031015 3300037471 Bacteria 5034
511 Ga0395905_0053376 3300037471 Bacteria 3783
512 Ga0395905_0057214 3300037471 Bacteria 3647
513 Ga0395905_0193828 3300037471 Bacteria 1905
514 Ga0395905_0287733 3300037471 Bacteria 1530
515 Ga0395905_0294247 3300037471 Bacteria 1510
516 Ga0395905_0310813 3300037471 Bacteria 1464
517 Ga0395905_0396107 3300037471 Bacteria 1275
518 Ga0395905_0670827 3300037471 Bacteria 939
519 Ga0395905_0836201 3300037471 Bacteria 823
520 Ga0436364_1172297 3300037853 Bacteria 30221
521 Ga0395901_0010738 3300038443 Bacteria 9284
522 Ga0395901_0011872 3300038443 Bacteria 8833
523 Ga0395901_0173259 3300038443 Bacteria 2264
524 Ga0395901_0271979 3300038443 Bacteria 1762
525 Ga0395901_0300704 3300038443 Bacteria 1664
526 Ga0395901_0440581 3300038443 Bacteria 1333
527 Ga0395901_0468286 3300038443 Bacteria 1286
528 Ga0395901_0521168 3300038443 Bacteria 1207
529 Ga0395901_1006920 3300038443 Bacteria 809
530 Ga0436365_1054374 3300039437 Bacteria 1165
531 Ga0436365_1325832 3300039437 Bacteria 2552
532 Ga0439436_0003483 3300041404 Bacteria 4783
533 Ga0439436_0055151 3300041404 Bacteria 1117
534 Ga0439439_0006576 3300041406 Bacteria 2691
535 Ga0439447_019635 3300041407 Bacteria 1800
536 Ga0439461_0000178 3300041410 Bacteria 8637
537 Ga0439461_0014873 3300041410 Bacteria 1485
538 Ga0439466_0130849 3300041411 Bacteria 772
539 Ga0439465_0009623 3300041413 Bacteria 3044
540 Ga0439465_0030423 3300041413 Bacteria 1717
541 Ga0451800_1680169 3300041459 Bacteria 602
542 Ga0451802_0494763 3300041460 Bacteria 1032
543 Ga0451837_0848718 3300041494 Bacteria 599
544 Ga0451841_0580323 3300041498 Bacteria 679
545 Ga0439431_0000015 3300041997 Bacteria 27396
546 Ga0439431_0004975 3300041997 Bacteria 2929
547 Ga0439442_001570 3300042002 Bacteria 4481
548 Ga0439442_008630 3300042002 Bacteria 2057
549 Ga0439445_0003451 3300042004 Bacteria 3546
550 Ga0439445_0003697 3300042004 Bacteria 3433
551 Ga0439432_006574 3300042006 Bacteria 4143
552 Ga0439432_013379 3300042006 Bacteria 2792
553 Ga0439452_028811 3300042010 Bacteria 1382
554 Ga0439457_033383 3300042014 Bacteria 1142
555 Ga0439462_0010019 3300042015 Bacteria 2399
556 Ga0439462_0010888 3300042015 Bacteria 2309
557 Ga0450919_012947 3300042121 Bacteria 945
558 Ga0450920_035414 3300042122 Bacteria 989
559 Ga0450923_066810 3300042125 Bacteria 792
560 Ga0450894_030654 3300042131 Bacteria 750
561 Ga0450905_000807 3300042142 Bacteria 3880
562 Ga0450889_000518 3300042144 Bacteria 4304
563 Ga0450910_047813 3300042147 Bacteria 702
564 Ga0439446_0006326 3300042156 Bacteria 3083
565 Ga0450908_028476 3300042184 Bacteria 973
566 Ga0450909_005358 3300042185 Bacteria 1846
567 Ga0439434_0002354 3300042435 Bacteria 5498
568 Ga0439434_0005342 3300042435 Bacteria 3759
569 Ga0466969_0253822 3300044656 Bacteria 797
570 Ga0466972_0054673 3300044658 Bacteria 1920
571 Ga0466972_0054969 3300044658 Bacteria 1915
572 Ga0466972_0096323 3300044658 Bacteria 1402
573 Ga0466965_0202783 3300044683 Bacteria 1053
574 Ga0466965_0684844 3300044683 Bacteria 587
575 Ga0466966_0047420 3300044684 Bacteria 2739
576 Ga0466966_0490891 3300044684 Bacteria 738
577 Ga0466966_0538916 3300044684 Bacteria 702
578 Ga0466966_0910100 3300044684 Bacteria 530
579 Ga0466961_0353616 3300044693 Bacteria 894
580 Ga0466963_0062599 3300044694 Bacteria 2488
581 Ga0466963_0280400 3300044694 Bacteria 1171
582 Ga0466963_0461350 3300044694 Bacteria 896
583 Ga0466971_0025809 3300044719 Bacteria 2624
584 Ga0466971_0040567 3300044719 Bacteria 2091
585 Ga0466971_0209539 3300044719 Bacteria 921
586 Ga0466968_0239433 3300044735 Bacteria 859
587 Ga0466957_0002469 3300044842 Bacteria 9932
588 Ga0466957_0060558 3300044842 Bacteria 2321
589 Ga0466960_0021758 3300044901 Bacteria 2859
590 Ga0466959_0296613 3300045049 Bacteria 1107
591 Ga0466958_0000506 3300045836 Bacteria 16309
592 Ga0466958_0240527 3300045836 Bacteria 1157
593 Ga0466958_0588751 3300045836 Bacteria 723
594 Ga0466967_0021699 3300045976 Bacteria 5223
595 Ga0466967_0072671 3300045976 Bacteria 3083
596 Ga0466967_0118471 3300045976 Bacteria 2442
597 Ga0466967_0196153 3300045976 Bacteria 1910
598 Ga0466967_0359547 3300045976 Bacteria 1410
599 Ga0466967_0402299 3300045976 Bacteria 1332
600 Ga0466967_0449707 3300045976 Bacteria 1259
601 Ga0466967_1591370 3300045976 Bacteria 651
602 Ga0466967_1844498 3300045976 Bacteria 602
603 Ga0466967_2108633 3300045976 Bacteria 560
604 Ga0466967_2218823 3300045976 Bacteria 545
605 Ga0466967_2255187 3300045976 Bacteria 540
606 Ga0495617_011727 3300046452 Bacteria 2989
607 Ga0495627_025915 3300046453 Bacteria 1897
608 Ga0495638_0000012 3300046460 Bacteria 435577
609 Ga0495638_0000207 3300046460 Bacteria 83805
610 Ga0495638_0059419 3300046460 Bacteria 2367
611 Ga0495650_0023973 3300046471 Bacteria 2892
612 Ga0495605_0174557 3300046474 Bacteria 948
613 Ga0495585_0033580 3300046492 Bacteria 2904
614 Ga0495583_0000180 3300046506 Bacteria 108471
615 Ga0495583_0000643 3300046506 Bacteria 46051
616 Ga0495583_0004661 3300046506 Bacteria 9669
617 Ga0495606_0081466 3300046507 Bacteria 2012
618 Ga0495606_0455880 3300046507 Bacteria 654
619 Ga0495610_0263897 3300046512 Bacteria 677
620 Ga0495616_0000010 3300046513 Bacteria 224378
621 Ga0495632_0000248 3300046519 Bacteria 53538
622 Ga0495643_0039984 3300046522 Bacteria 2563
623 Ga0495643_0200499 3300046522 Bacteria 958
624 Ga0495648_0000151 3300046524 Bacteria 83011
625 Ga0495648_0026719 3300046524 Bacteria 3881
626 Ga0495663_0107436 3300046525 Bacteria 924
627 Ga0495652_0484320 3300046529 Bacteria 860
628 Ga0495654_0059377 3300046530 Bacteria 1842
629 Ga0495654_0077322 3300046530 Bacteria 1566
630 Ga0495654_0077426 3300046530 Bacteria 1565
631 Ga0495654_0096319 3300046530 Bacteria 1367
632 Ga0495633_0009411 3300046558 Bacteria 5401
633 Ga0495668_0000004 3300046616 Bacteria 574236
634 Ga0495668_0002391 3300046616 Bacteria 15550
635 Ga0495668_0006873 3300046616 Bacteria 7376
636 Ga0495668_0040848 3300046616 Bacteria 2586
637 Ga0495668_0176176 3300046616 Bacteria 1172
638 Ga0495625_0001182 3300046660 Bacteria 33512
639 Ga0495625_0003111 3300046660 Bacteria 16956
640 Ga0495625_0068441 3300046660 Bacteria 2496
641 Ga0495625_0164006 3300046660 Bacteria 1487
642 Ga0495625_0320073 3300046660 Bacteria 988
643 Ga0495623_0034060 3300046679 Bacteria 3267
644 Ga0495669_0002918 3300046684 Bacteria 7027
645 Ga0495669_0105850 3300046684 Bacteria 1310
646 Ga0495669_0211987 3300046684 Bacteria 927
647 Ga0495670_0006307 3300046691 Bacteria 5824
648 Ga0495670_0090704 3300046691 Bacteria 1564
649 Ga0495670_0260499 3300046691 Bacteria 925
650 Ga0495671_0000023 3300046692 Bacteria 252939
651 Ga0495671_0008914 3300046692 Bacteria 5634
652 Ga0495671_0220005 3300046692 Bacteria 919
653 Ga0495687_121374 3300047443 Bacteria 942
654 Ga0495677_0007182 3300047445 Bacteria 4169
655 Ga0495685_071854 3300047447 Bacteria 1158
656 Ga0495685_123399 3300047447 Bacteria 849
657 Ga0495673_0000054 3300047469 Bacteria 252207
658 Ga0495686_0006227 3300047472 Bacteria 9193
659 Ga0495686_0007366 3300047472 Bacteria 8255
660 Ga0495686_0018195 3300047472 Bacteria 4720
661 Ga0495686_0084881 3300047472 Bacteria 1929
662 Ga0495686_0211929 3300047472 Bacteria 1106
663 Ga0495602_0064575 3300048088 Bacteria 3164
664 Ga0495626_0193598 3300048091 Bacteria 837
665 Ga0496100_0648349 3300048903 Bacteria 822
666 Ga0496101_0075810 3300048904 Bacteria 2476
667 Ga0496101_0179780 3300048904 Bacteria 1629
668 Ga0496101_0679483 3300048904 Bacteria 813
669 Ga0496102_0000481 3300048905 Bacteria 44268
670 Ga0496103_0000347 3300048906 Bacteria 42198
671 Ga0496103_0141373 3300048906 Unclassified 1539
672 Ga0496103_0473379 3300048906 Bacteria 803
673 Ga0496106_0077572 3300048909 Bacteria 2548
674 Ga0496107_0024108 3300048910 Bacteria 4303
675 Ga0496107_0385240 3300048910 Bacteria 1043
676 Ga0496108_0264936 3300048911 Bacteria 1495
677 Ga0496109_0027277 3300048912 Bacteria 5097
678 Ga0496109_0793114 3300048912 Bacteria 885
679 Ga0496110_0078443 3300048913 Bacteria 2940
680 Ga0496110_1216993 3300048913 Bacteria 662
681 Ga0496111_0003794 3300048914 Bacteria 9425
682 Ga0496111_0556205 3300048914 Bacteria 842
683 Ga0496111_1301184 3300048914 Bacteria 512
684 Ga0496112_0009881 3300048915 Bacteria 8625
685 Ga0496112_0084606 3300048915 Bacteria 3137
686 Ga0496112_1108622 3300048915 Bacteria 709
687 Ga0496113_0008196 3300048916 Bacteria 6790
688 Ga0496113_0216587 3300048916 Bacteria 1525
689 Ga0496113_0508911 3300048916 Bacteria 967
690 Ga0496115_0000534 3300048918 Bacteria 29632
691 Ga0496116_0002244 3300048919 Bacteria 20540
692 Ga0496117_0001149 3300048920 Bacteria 39861
693 Ga0496117_0002571 3300048920 Bacteria 22586
694 Ga0496117_0094080 3300048920 Bacteria 1920
695 Ga0496118_0000493 3300048921 Bacteria 65468
696 Ga0496118_0001071 3300048921 Bacteria 42731
697 Ga0496119_0017078 3300048922 Bacteria 5485
698 Ga0496119_0150677 3300048922 Bacteria 1247
699 Ga0496120_0023307 3300048923 Bacteria 3877
700 Ga0496121_0046213 3300048924 Bacteria 3729
701 Ga0496121_0338970 3300048924 Bacteria 1005
702 Ga0496122_0126510 3300048925 Bacteria 1634
703 Ga0496122_0329098 3300048925 Bacteria 808
704 Ga0496122_0330217 3300048925 Bacteria 806
705 Ga0496123_0065252 3300048926 Bacteria 2315
706 Ga0496123_0077610 3300048926 Bacteria 2039
707 Ga0496124_0000889 3300048927 Bacteria 48520
708 Ga0496124_0000996 3300048927 Bacteria 44925
709 Ga0496124_0073812 3300048927 Bacteria 2821
710 Ga0496124_0325858 3300048927 Bacteria 1098
711 Ga0496125_0091212 3300048928 Bacteria 2284
712 Ga0496126_0140950 3300048929 Bacteria 2075
713 Ga0496126_0171090 3300048929 Bacteria 1851
714 Ga0495678_141173 3300049459 Bacteria 788
715 Ga0495682_0056187 3300049460 Bacteria 1427
716 Ga0501031_0020490 3300049568 Bacteria 4311
717 Ga0501032_0167496 3300049569 Bacteria 1441
718 Ga0501034_0051979 3300049571 Bacteria 4130
719 Ga0501034_0180614 3300049571 Bacteria 2075
720 Ga0501034_0255901 3300049571 Bacteria 1695
721 Ga0501034_1698074 3300049571 Bacteria 504
722 Ga0501036_0021382 3300049572 Bacteria 5438
723 Ga0501038_0275900 3300049574 Bacteria 1324
724 Ga0501043_0074501 3300049579 Bacteria 2666
725 Ga0501046_0248288 3300049580 Bacteria 1311
726 Ga0501046_0567953 3300049580 Bacteria 807
727 Ga0501047_0039638 3300049581 Bacteria 4555
728 Ga0501047_0072301 3300049581 Bacteria 3320
729 Ga0501048_0074744 3300049582 Bacteria 2391
730 Ga0501070_0076252 3300049586 Bacteria 2776
731 Ga0501224_000007 3300049664 Bacteria 127654
732 Ga0501233_000599 3300049668 Bacteria 5875
733 Ga0501225_0000055 3300049705 Bacteria 38821
734 Ga0501234_000955 3300049707 Bacteria 4571
735 Ga0501241_083320 3300049758 Bacteria 668
736 Ga0501035_0012295 3300049822 Bacteria 7913
737 Ga0501035_0278680 3300049822 Bacteria 1414
738 Ga0501044_0203278 3300049823 Bacteria 1938
739 Ga0501045_0866897 3300049824 Bacteria 664
740 Ga0501226_000025 3300049853 Bacteria 91197
741 nmdc:mga03683_34509_c1 3300050489 Bacteria 2047
742 nmdc:mga04h51_117222_c1 3300050495 Bacteria 988
743 nmdc:mga07m45_25838_c1 3300050496 Bacteria 3224
744 nmdc:mga05p37_243419_c1 3300050507 Bacteria 2161
745 nmdc:mga09592_922564_c1 3300050508 Bacteria 733
746 nmdc:mga08y16_61453_c1 3300050511 Bacteria 3923
747 nmdc:mga0sz30_65946_c1 3300050516 Bacteria 1552
748 Ga0495612_0056875 3300053078 Bacteria 1615
749 Ga0495619_0757630 3300053085 Bacteria 658
750 Ga0500643_000293 3300053087 Bacteria 42902
751 Ga0500643_000904 3300053087 Bacteria 18780
752 Ga0500646_0385219 3300053090 Bacteria 516
753 Ga0500647_0070056 3300053091 Bacteria 1686
754 Ga0500651_0220937 3300053093 Bacteria 1111
755 Ga0500566_0000285 3300053094 Bacteria 27164
756 Ga0500555_007751 3300053103 Bacteria 3053
757 Ga0500556_0008222 3300053104 Bacteria 3006
758 Ga0500592_000213 3300053116 Bacteria 10649
759 Ga0500592_031987 3300053116 Bacteria 849
760 Ga0500594_0001763 3300053118 Bacteria 4714
761 Ga0500595_004422 3300053119 Bacteria 6311
762 Ga0500608_000327 3300053122 Bacteria 18285
763 Ga0500608_033290 3300053122 Bacteria 2452
764 Ga0500618_014525 3300053125 Bacteria 2008
765 Ga0500618_156611 3300053125 Bacteria 520
766 Ga0500642_0000002 3300053130 Bacteria 795093
767 Ga0500655_012842 3300053133 Bacteria 1524
768 Ga0500658_0000662 3300053134 Bacteria 14169
769 Ga0500658_0033119 3300053134 Bacteria 2030
770 Ga0500559_0003325 3300053136 Bacteria 7963
771 Ga0500559_0007104 3300053136 Bacteria 4992
772 Ga0500559_0035376 3300053136 Bacteria 2157
773 Ga0500564_000959 3300053138 Bacteria 9360
774 Ga0500568_0004150 3300053139 Bacteria 7824
775 Ga0500573_0002298 3300053140 Bacteria 9502
776 Ga0500573_0177095 3300053140 Bacteria 1149
777 Ga0500573_0246625 3300053140 Bacteria 923
778 Ga0500577_0173313 3300053142 Bacteria 923
779 Ga0500588_0391161 3300053146 Bacteria 529
780 Ga0500604_0140797 3300053151 Bacteria 815
781 Ga0500622_0197561 3300053156 Bacteria 917
782 Ga0500624_000011 3300053157 Bacteria 168125
783 Ga0500627_0000009 3300053158 Bacteria 153203
784 Ga0500627_0001047 3300053158 Bacteria 7536
785 Ga0500627_0057845 3300053158 Bacteria 1701
786 Ga0500627_0094683 3300053158 Bacteria 1338
787 Ga0500627_0241872 3300053158 Bacteria 800
788 Ga0500636_0040341 3300053177 Bacteria 2761
789 Ga0500567_001496 3300053723 Bacteria 9477
790 Ga0500611_133902 3300053727 Bacteria 670
791 Ga0500625_000001 3300053729 Bacteria 395993
792 Ga0500645_000064 3300053730 Bacteria 84824
793 Ga0500645_000705 3300053730 Bacteria 20743
794 Ga0500645_071059 3300053730 Bacteria 999
795 Ga0500596_006952 3300053735 Bacteria 1881
796 Ga0466962_0038732 3300061719 Bacteria 2283
797 2600228428 2599185359 Bacteria 4772316
798 2676486109 2675903059 Bacteria 8644972
799 2739648892 2739367664 Bacteria 4114334
800 2740027365 2739367865 Bacteria 4114482
801 2819715221 2818991466 Bacteria 4748179
802 2879163412 2879163058 Bacteria 4223965
803 2885430973 2885429604 Bacteria 3642894
804 2928031156 2928027323 Bacteria 4382488
805 2928528039 2928526807 Bacteria 4760224
806 2928971457 2928968154 Bacteria 4633371
807 2984556467 2984555340 Bacteria 4247089
808 2984565359 2984564862 Bacteria 4339992
809 2990268925 2990265787 Bacteria 3943888
810 2993356435 2993356040 Bacteria 4247105
811 2993697264 2993693658 Bacteria 4040749
812 8057101428 8057101203 Bacteria 5034064
813 Ga0500595_010229
814 SwRhRL2b_contig_2687397
815 ARcpr5oldR_c001506
816 JGI24752J21851_1001224
817 JGI24740J21852_10025651
818 JGI24739J22299_10000524
819 JGI24739J22299_10002936
820 JGI24739J22299_10013165
821 JGI24737J22298_10007810
822 JGI24735J21928_10003268
823 JGI24735J21928_10019703
824 JGI24735J21928_10109069
825 JGI24748J21848_1019863
826 JGI24738J21930_10003430
827 JGI24738J21930_10003879
828 JGI25151J46595_10088405
829 JGI25165J46597_1000010
830 JGI25153J46596_10006448
831 Ga0055537_1000460
832 Ga0055524_1000155
833 Ga0055536_1003969
834 Ga0055536_1006424
835 Ga0055536_1015396
836 Ga0055534_1019585
837 Ga0055530_10000115
838 Ga0055530_10001208
839 Ga0055530_10008781
840 Ga0055531_10000792
841 Ga0055531_10002671
842 Ga0055531_10006063
843 Ga0055531_10006683
844 Ga0065165_1007583
845 Ga0065165_1018077
846 Ga0065165_1041615
847 Ga0065704_10074901
848 Ga0065707_10081882
849 Ga0070658_10000003
850 Ga0070658_10021495
851 Ga0070658_10030316
852 Ga0070658_10033779
853 Ga0070658_10054034
854 Ga0070658_10166424
855 Ga0070683_100559908
856 Ga0070670_100000030
857 Ga0070670_100746266
858 Ga0070670_101154386
859 Ga0070680_100025459
860 Ga0070680_100034426
861 Ga0070680_100104058
862 Ga0070680_100837885
863 Ga0070682_100579292
864 Ga0068868_100565982
865 Ga0070660_100057997
866 Ga0070660_100059329
867 Ga0070660_100088967
868 Ga0070660_100107890
869 Ga0070660_100397916
870 Ga0070660_100408703
871 Ga0070661_100139342
872 Ga0070661_100267307
873 Ga0070661_100585399
874 Ga0070692_10000142
875 Ga0070692_10159865
876 Ga0070668_100000011
877 Ga0070671_100003480
878 Ga0070671_100093078
879 Ga0070671_100671018
880 Ga0070673_100015570
881 Ga0070673_100828271
882 Ga0070659_100003069
883 Ga0070659_100021627
884 Ga0070659_100090402
885 Ga0070659_100157669
886 Ga0070659_100202257
887 Ga0070667_100000161
888 Ga0070667_100383351
889 Ga0070714_100263657
890 Ga0070714_100556978
891 Ga0070708_100141656
892 Ga0070663_100003059
893 Ga0070663_100044176
894 Ga0070663_100050017
895 Ga0070662_100016573
896 Ga0070662_100065006
897 Ga0070662_100121909
898 Ga0070681_10029494
899 Ga0070681_10072402
900 Ga0070681_10105457
901 Ga0070681_10172151
902 Ga0070706_100028793
903 Ga0070679_100077764
904 Ga0070679_100095520
905 Ga0070679_100173758
906 Ga0070679_100191645
907 Ga0070679_100332936
908 Ga0070679_100340828
909 Ga0070679_100650877
910 Ga0070679_100651978
911 Ga0070684_100329502
912 Ga0068853_100012834
913 Ga0068853_100054892
914 Ga0068853_100067073
915 Ga0068853_100072366
916 Ga0068853_100220247
917 Ga0068853_100247300
918 Ga0068853_100642700
919 Ga0068853_101379521
920 Ga0070695_100075268
921 Ga0070696_100021044
922 Ga0070696_100461594
923 Ga0070693_100148555
924 Ga0070693_100198996
925 Ga0070665_100044221
926 Ga0070665_100291629
927 Ga0070665_100359322
928 Ga0070704_100316459
929 Ga0068855_100048687
930 Ga0068855_100051070
931 Ga0068855_100129913
932 Ga0068855_100189877
933 Ga0068855_100289358
934 Ga0068855_100302634
935 Ga0068855_100315793
936 Ga0068855_100454337
937 Ga0068855_100619267
938 Ga0070664_100107856
939 Ga0070664_100183721
940 Ga0070664_100853026
941 Ga0070664_101305074
942 Ga0068857_100041693
943 Ga0068857_100094218
944 Ga0068857_100142446
945 Ga0068857_100276997
946 Ga0068854_100000559
947 Ga0068854_100026578
948 Ga0068854_100039382
949 Ga0068854_100055677
950 Ga0068854_100417427
951 Ga0068854_100527255
952 Ga0068854_100764096
953 Ga0068856_100027149
954 Ga0068856_100052866
955 Ga0068856_100072762
956 Ga0068856_100115596
957 Ga0068856_100427271
958 Ga0068856_101210619
959 Ga0068852_100032215
960 Ga0068852_100047102
961 Ga0068852_100048090
962 Ga0068852_100058186
963 Ga0068852_100073666
964 Ga0068852_100814070
965 Ga0068852_100922176
966 Ga0068852_101108464
967 Ga0068859_100032942
968 Ga0068859_100213296
969 Ga0068859_100481698
970 Ga0068864_100000041
971 Ga0068864_100018954
972 Ga0068861_100772769
973 Ga0068851_10021086
974 Ga0068851_10022086
975 Ga0068863_100000035
976 Ga0068863_100000186
977 Ga0068863_100593238
978 Ga0068858_100000102
979 Ga0068858_100001966
980 Ga0068858_100309087
981 Ga0068858_100575641
982 Ga0068862_100000042
983 Ga0068862_100312956
984 Ga0081455_10000405
985 Ga0075368_10116970
986 Ga0075369_10165462
987 Ga0097621_100285331
988 Ga0068871_100005363
989 Ga0068871_100682245
990 Ga0075428_100050761
991 Ga0075428_101653890
992 Ga0075429_100424676
993 Ga0097620_100032942
994 Ga0097620_100213276
995 Ga0097620_100481677
996 Ga0105240_10008649
997 Ga0105240_10022129
998 Ga0105240_10186565
999 Ga0105240_10699040
1000 Ga0105240_10929977
1001 Ga0111539_10016465
1002 Ga0105245_10001046
1003 Ga0105247_10038819
1004 Ga0105247_10109991
1005 Ga0114129_10170049
1006 Ga0105243_10028129
1007 Ga0105241_10194511
1008 Ga0105241_10832781
1009 Ga0105248_10000045
1010 Ga0105248_10003638
1011 Ga0105248_10028673
1012 Ga0105248_10032137
1013 Ga0105248_10392213
1014 Ga0105237_10104546
1015 Ga0105237_10181775
1016 Ga0105237_10216772
1017 Ga0105237_11559915
1018 Ga0105238_10035938
1019 Ga0105238_10036999
1020 Ga0105238_10067960
1021 Ga0105238_10092085
1022 Ga0105238_10390045
1023 Ga0105238_10402836
1024 Ga0105238_10707038
1025 Ga0105249_10000055
1026 Ga0105249_10014831
1027 Ga0105239_10089892
1028 Ga0105239_12106981
1029 Ga0157373_10016847
1030 Ga0157373_10040258
1031 Ga0157373_10075053
1032 Ga0157373_10242676
1033 Ga0157373_10551089
1034 Ga0157371_10155848
1035 Ga0157371_10172510
1036 Ga0157371_10306500
1037 Ga0157370_10036353
1038 Ga0157370_10125312
1039 Ga0157370_10131295
1040 Ga0157370_10172340
1041 Ga0157370_10724662
1042 Ga0157369_10002615
1043 Ga0157369_10070306
1044 Ga0157369_10121654
1045 Ga0157369_10322135
1046 Ga0157374_10155077
1047 Ga0157378_10037607
1048 Ga0157378_10048347
1049 Ga0163162_10009164
1050 Ga0163162_10009790
1051 Ga0163162_10010728
1052 Ga0163162_10639562
1053 Ga0157372_10002970
1054 Ga0157372_10319859
1055 Ga0157372_10655508
1056 Ga0157372_10935612
1057 Ga0157372_11340683
1058 Ga0157372_11871339
1059 Ga0157375_12321886
1060 Ga0163163_10248751
1061 Ga0163163_10257193
1062 Ga0163163_10450992
1063 Ga0157380_10007873
1064 Ga0182008_10505366
1065 Ga0157379_10021517
1066 Ga0206356_11202361
1067 Ga0206354_10168296
1068 Ga0206353_12012794
1069 Ga0213875_10005097
1070 Ga0209437_111975
1071 Ga0207425_1007250
1072 Ga0209646_1015807
1073 Ga0209233_1000044
1074 Ga0209565_1000011
1075 Ga0209455_1000772
1076 Ga0209455_1025746
1077 Ga0209673_1002122
1078 Ga0209675_1000104
1079 Ga0209675_1013492
1080 Ga0209676_1000807
1081 Ga0209676_1001060
1082 Ga0209676_1001199
1083 Ga0209676_1044912
1084 Ga0209025_1006362
1085 Ga0209758_1008891
1086 Ga0209050_1000071
1087 Ga0209050_1000286
1088 Ga0209050_1002140
1089 Ga0209050_1004981
1090 Ga0209050_1072435
1091 Ga0209256_1000016
1092 Ga0209257_1000027
1093 Ga0209257_1000245
1094 Ga0209257_1000321
1095 Ga0209257_1001354
1096 Ga0209257_1001434
1097 Ga0209257_1014820
1098 Ga0207656_10025320
1099 Ga0207656_10039366
1100 Ga0207656_10066705
1101 Ga0207710_10135767
1102 Ga0207680_10719372
1103 Ga0207647_10007714
1104 Ga0207647_10024741
1105 Ga0207647_10028509
1106 Ga0207705_10002705
1107 Ga0207705_10009941
1108 Ga0207705_10026902
1109 Ga0207705_10033221
1110 Ga0207705_10106802
1111 Ga0207705_10427571
1112 Ga0207684_10421321
1113 Ga0207654_10517952
1114 Ga0207654_10792998
1115 Ga0207707_10044083
1116 Ga0207707_10149531
1117 Ga0207707_10191173
1118 Ga0207695_10026017
1119 Ga0207695_10199135
1120 Ga0207695_10660640
1121 Ga0207695_11185612
1122 Ga0207671_10024252
1123 Ga0207671_10081045
1124 Ga0207671_10088723
1125 Ga0207660_10000024
1126 Ga0207660_10060824
1127 Ga0207660_10225842
1128 Ga0207660_10447300
1129 Ga0207660_10490502
1130 Ga0207660_10731325
1131 Ga0207657_10007988
1132 Ga0207657_10010415
1133 Ga0207657_10046672
1134 Ga0207657_10053077
1135 Ga0207657_10103276
1136 Ga0207657_10109325
1137 Ga0207657_10112964
1138 Ga0207657_10583406
1139 Ga0207657_11032159
1140 Ga0207649_10059417
1141 Ga0207649_10089449
1142 Ga0207649_10095289
1143 Ga0207649_10597774
1144 Ga0207652_10073532
1145 Ga0207652_10092414
1146 Ga0207652_10148018
1147 Ga0207652_10159255
1148 Ga0207652_10293774
1149 Ga0207652_10410785
1150 Ga0207652_10480000
1151 Ga0207652_11018435
1152 Ga0207681_10190284
1153 Ga0207694_10020412
1154 Ga0207694_10029168
1155 Ga0207694_10062555
1156 Ga0207694_11336831
1157 Ga0207650_10000111
1158 Ga0207650_10018464
1159 Ga0207687_10000562
1160 Ga0207664_10066774
1161 Ga0207664_10500508
1162 Ga0207644_10000032
1163 Ga0207644_10051599
1164 Ga0207644_10102939
1165 Ga0207644_10374951
1166 Ga0207644_10521877
1167 Ga0207644_11753146
1168 Ga0207690_10018054
1169 Ga0207690_10063579
1170 Ga0207690_10078402
1171 Ga0207690_10147247
1172 Ga0207690_10182553
1173 Ga0207690_10675176
1174 Ga0207706_10004718
1175 Ga0207706_10015487
1176 Ga0207706_10067824
1177 Ga0207691_10068308
1178 Ga0207711_10000027
1179 Ga0207711_10002908
1180 Ga0207711_10012212
1181 Ga0207711_10468112
1182 Ga0207661_10732046
1183 Ga0207679_10033400
1184 Ga0207679_10228292
1185 Ga0207679_11018164
1186 Ga0207667_10025172
1187 Ga0207667_10041234
1188 Ga0207667_10053956
1189 Ga0207667_10070885
1190 Ga0207667_10357924
1191 Ga0207667_10497892
1192 Ga0207651_10171341
1193 Ga0207712_10000813
1194 Ga0207712_10033349
1195 Ga0207668_10000034
1196 Ga0207640_10000202
1197 Ga0207640_10026210
1198 Ga0207640_10111478
1199 Ga0207640_10156959
1200 Ga0207640_10879216
1201 Ga0207658_10000839
1202 Ga0207703_10000190
1203 Ga0207703_10034927
1204 Ga0207703_10282134
1205 Ga0207639_10002119
1206 Ga0207639_10004994
1207 Ga0207639_10087630
1208 Ga0207639_10094791
1209 Ga0207639_10110813
1210 Ga0207639_10559991
1211 Ga0207639_10659466
1212 Ga0207639_10846312
1213 Ga0207678_10000455
1214 Ga0207678_10002000
1215 Ga0207678_10046585
1216 Ga0207678_10092769
1217 Ga0207702_10018713
1218 Ga0207702_10052142
1219 Ga0207702_10066422
1220 Ga0207702_11621557
1221 Ga0207641_10000031
1222 Ga0207641_10000041
1223 Ga0207641_10686291
1224 Ga0207648_10357096
1225 Ga0207676_10000039
1226 Ga0207676_10000072
1227 Ga0207674_10003053
1228 Ga0207674_10005772
1229 Ga0207674_10006642
1230 Ga0207674_10236171
1231 Ga0207683_11160850
1232 Ga0207698_10025863
1233 Ga0207698_10041296
1234 Ga0268266_10056076
1235 Ga0268266_10064839
1236 Ga0268265_10000061
1237 Ga0268265_10146257
1238 Ga0268264_10000785
1239 Ga0307517_10075608
1240 Ga0307515_10325087
1241 Ga0307512_10435641
1242 Ga0314311_1234836
1243 Ga0307513_10206273
1244 Ga0307408_100058897
1245 Ga0307508_10000011
1246 Ga0307405_10101755
1247 Ga0307405_10109097
1248 Ga0307405_11004197
1249 Ga0307413_10460217
1250 Ga0307406_10025518
1251 Ga0307406_10135661
1252 Ga0307406_10189804
1253 Ga0307406_10214331
1254 Ga0307407_10113528
1255 Ga0307412_10001328
1256 Ga0307412_10002668
1257 Ga0307412_10005336
1258 Ga0307412_10026022
1259 Ga0307412_10042785
1260 Ga0307412_10095174
1261 Ga0307412_11342480
1262 Ga0307409_100021228
1263 Ga0307409_100277372
1264 Ga0307416_100032603
1265 Ga0307416_100273430
1266 Ga0307416_100339873
1267 Ga0307414_10001684
1268 Ga0307414_10001894
1269 Ga0307414_10002573
1270 Ga0307414_10009988
1271 Ga0307414_10046896
1272 Ga0307414_10115705
1273 Ga0307414_10133282
1274 Ga0307414_10159311
1275 Ga0307414_10365512
1276 Ga0307414_10393190
1277 Ga0307414_11189774
1278 Ga0307415_100044257
1279 Ga0316583_10008044
1280 Ga0307510_10066895
1281 Ga0373954_0103957
1282 Ga0373956_0348221
1283 Ga0373955_0007600
1284 Ga0373961_0391148
1285 Ga0316574_0203301
1286 Ga0373935_0578125
1287 Ga0373933_0013243
1288 Ga0373937_0047729
1289 Ga0373937_0102021
1290 Ga0316582_0000490
1291 Ga0316582_0578966
1292 Ga0316584_0167688
1293 Ga0316584_0337297
1294 Ga0395899_0002299
1295 Ga0395899_0019311
1296 Ga0395899_0037173
1297 Ga0395899_0063584
1298 Ga0395899_0174455
1299 Ga0395899_0213365
1300 Ga0395899_0256610
1301 Ga0395900_0002548
1302 Ga0395900_0044846
1303 Ga0395900_0066250
1304 Ga0395900_0096980
1305 Ga0395900_0131864
1306 Ga0395900_0192374
1307 Ga0395900_0211241
1308 Ga0395900_0245869
1309 Ga0395900_0316383
1310 Ga0395900_0333416
1311 Ga0395900_0667608
1312 Ga0395900_1286347
1313 Ga0395898_0025707
1314 Ga0395898_0093802
1315 Ga0395898_0164557
1316 Ga0395898_0233521
1317 Ga0395898_0235873
1318 Ga0395898_0652849
1319 Ga0395905_0000409
1320 Ga0395905_0007919
1321 Ga0395905_0029823
1322 Ga0395905_0031015
1323 Ga0395905_0053376
1324 Ga0395905_0057214
1325 Ga0395905_0193828
1326 Ga0395905_0287733
1327 Ga0395905_0294247
1328 Ga0395905_0310813
1329 Ga0395905_0396107
1330 Ga0395905_0670827
1331 Ga0395905_0836201
1332 Ga0436364_1172297
1333 Ga0395901_0010738
1334 Ga0395901_0011872
1335 Ga0395901_0173259
1336 Ga0395901_0271979
1337 Ga0395901_0300704
1338 Ga0395901_0440581
1339 Ga0395901_0468286
1340 Ga0395901_0521168
1341 Ga0395901_1006920
1342 Ga0436365_1054374
1343 Ga0436365_1325832
1344 Ga0439436_0003483
1345 Ga0439436_0055151
1346 Ga0439439_0006576
1347 Ga0439447_019635
1348 Ga0439461_0000178
1349 Ga0439461_0014873
1350 Ga0439466_0130849
1351 Ga0439465_0009623
1352 Ga0439465_0030423
1353 Ga0451800_1680169
1354 Ga0451802_0494763
1355 Ga0451837_0848718
1356 Ga0451841_0580323
1357 Ga0439431_0000015
1358 Ga0439431_0004975
1359 Ga0439442_001570
1360 Ga0439442_008630
1361 Ga0439445_0003451
1362 Ga0439445_0003697
1363 Ga0439432_006574
1364 Ga0439432_013379
1365 Ga0439452_028811
1366 Ga0439457_033383
1367 Ga0439462_0010019
1368 Ga0439462_0010888
1369 Ga0450919_012947
1370 Ga0450920_035414
1371 Ga0450923_066810
1372 Ga0450894_030654
1373 Ga0450905_000807
1374 Ga0450889_000518
1375 Ga0450910_047813
1376 Ga0439446_0006326
1377 Ga0450908_028476
1378 Ga0450909_005358
1379 Ga0439434_0002354
1380 Ga0439434_0005342
1381 Ga0466969_0253822
1382 Ga0466972_0054673
1383 Ga0466972_0054969
1384 Ga0466972_0096323
1385 Ga0466965_0202783
1386 Ga0466965_0684844
1387 Ga0466966_0047420
1388 Ga0466966_0490891
1389 Ga0466966_0538916
1390 Ga0466966_0910100
1391 Ga0466961_0353616
1392 Ga0466963_0062599
1393 Ga0466963_0280400
1394 Ga0466963_0461350
1395 Ga0466971_0025809
1396 Ga0466971_0040567
1397 Ga0466971_0209539
1398 Ga0466968_0239433
1399 Ga0466957_0002469
1400 Ga0466957_0060558
1401 Ga0466960_0021758
1402 Ga0466959_0296613
1403 Ga0466958_0000506
1404 Ga0466958_0240527
1405 Ga0466958_0588751
1406 Ga0466967_0021699
1407 Ga0466967_0072671
1408 Ga0466967_0118471
1409 Ga0466967_0196153
1410 Ga0466967_0359547
1411 Ga0466967_0402299
1412 Ga0466967_0449707
1413 Ga0466967_1591370
1414 Ga0466967_1844498
1415 Ga0466967_2108633
1416 Ga0466967_2218823
1417 Ga0466967_2255187
1418 Ga0495617_011727
1419 Ga0495627_025915
1420 Ga0495638_0000012
1421 Ga0495638_0000207
1422 Ga0495638_0059419
1423 Ga0495650_0023973
1424 Ga0495605_0174557
1425 Ga0495585_0033580
1426 Ga0495583_0000180
1427 Ga0495583_0000643
1428 Ga0495583_0004661
1429 Ga0495606_0081466
1430 Ga0495606_0455880
1431 Ga0495610_0263897
1432 Ga0495616_0000010
1433 Ga0495632_0000248
1434 Ga0495643_0039984
1435 Ga0495643_0200499
1436 Ga0495648_0000151
1437 Ga0495648_0026719
1438 Ga0495663_0107436
1439 Ga0495652_0484320
1440 Ga0495654_0059377
1441 Ga0495654_0077322
1442 Ga0495654_0077426
1443 Ga0495654_0096319
1444 Ga0495633_0009411
1445 Ga0495668_0000004
1446 Ga0495668_0002391
1447 Ga0495668_0006873
1448 Ga0495668_0040848
1449 Ga0495668_0176176
1450 Ga0495625_0001182
1451 Ga0495625_0003111
1452 Ga0495625_0068441
1453 Ga0495625_0164006
1454 Ga0495625_0320073
1455 Ga0495623_0034060
1456 Ga0495669_0002918
1457 Ga0495669_0105850
1458 Ga0495669_0211987
1459 Ga0495670_0006307
1460 Ga0495670_0090704
1461 Ga0495670_0260499
1462 Ga0495671_0000023
1463 Ga0495671_0008914
1464 Ga0495671_0220005
1465 Ga0495687_121374
1466 Ga0495677_0007182
1467 Ga0495685_071854
1468 Ga0495685_123399
1469 Ga0495673_0000054
1470 Ga0495686_0006227
1471 Ga0495686_0007366
1472 Ga0495686_0018195
1473 Ga0495686_0084881
1474 Ga0495686_0211929
1475 Ga0495602_0064575
1476 Ga0495626_0193598
1477 Ga0496100_0648349
1478 Ga0496101_0075810
1479 Ga0496101_0179780
1480 Ga0496101_0679483
1481 Ga0496102_0000481
1482 Ga0496103_0000347
1483 Ga0496103_0141373
1484 Ga0496103_0473379
1485 Ga0496106_0077572
1486 Ga0496107_0024108
1487 Ga0496107_0385240
1488 Ga0496108_0264936
1489 Ga0496109_0027277
1490 Ga0496109_0793114
1491 Ga0496110_0078443
1492 Ga0496110_1216993
1493 Ga0496111_0003794
1494 Ga0496111_0556205
1495 Ga0496111_1301184
1496 Ga0496112_0009881
1497 Ga0496112_0084606
1498 Ga0496112_1108622
1499 Ga0496113_0008196
1500 Ga0496113_0216587
1501 Ga0496113_0508911
1502 Ga0496115_0000534
1503 Ga0496116_0002244
1504 Ga0496117_0001149
1505 Ga0496117_0002571
1506 Ga0496117_0094080
1507 Ga0496118_0000493
1508 Ga0496118_0001071
1509 Ga0496119_0017078
1510 Ga0496119_0150677
1511 Ga0496120_0023307
1512 Ga0496121_0046213
1513 Ga0496121_0338970
1514 Ga0496122_0126510
1515 Ga0496122_0329098
1516 Ga0496122_0330217
1517 Ga0496123_0065252
1518 Ga0496123_0077610
1519 Ga0496124_0000889
1520 Ga0496124_0000996
1521 Ga0496124_0073812
1522 Ga0496124_0325858
1523 Ga0496125_0091212
1524 Ga0496126_0140950
1525 Ga0496126_0171090
1526 Ga0495678_141173
1527 Ga0495682_0056187
1528 Ga0501031_0020490
1529 Ga0501032_0167496
1530 Ga0501034_0051979
1531 Ga0501034_0180614
1532 Ga0501034_0255901
1533 Ga0501034_1698074
1534 Ga0501036_0021382
1535 Ga0501038_0275900
1536 Ga0501043_0074501
1537 Ga0501046_0248288
1538 Ga0501046_0567953
1539 Ga0501047_0039638
1540 Ga0501047_0072301
1541 Ga0501048_0074744
1542 Ga0501070_0076252
1543 Ga0501224_000007
1544 Ga0501233_000599
1545 Ga0501225_0000055
1546 Ga0501234_000955
1547 Ga0501241_083320
1548 Ga0501035_0012295
1549 Ga0501035_0278680
1550 Ga0501044_0203278
1551 Ga0501045_0866897
1552 Ga0501226_000025
1553 nmdc:mga03683_34509_c1
1554 nmdc:mga04h51_117222_c1
1555 nmdc:mga07m45_25838_c1
1556 nmdc:mga05p37_243419_c1
1557 nmdc:mga09592_922564_c1
1558 nmdc:mga08y16_61453_c1
1559 nmdc:mga0sz30_65946_c1
1560 Ga0495612_0056875
1561 Ga0495619_0757630
1562 Ga0500643_000293
1563 Ga0500643_000904
1564 Ga0500646_0385219
1565 Ga0500647_0070056
1566 Ga0500651_0220937
1567 Ga0500566_0000285
1568 Ga0500555_007751
1569 Ga0500556_0008222
1570 Ga0500592_000213
1571 Ga0500592_031987
1572 Ga0500594_0001763
1573 Ga0500595_004422
1574 Ga0500608_000327
1575 Ga0500608_033290
1576 Ga0500618_014525
1577 Ga0500618_156611
1578 Ga0500642_0000002
1579 Ga0500655_012842
1580 Ga0500658_0000662
1581 Ga0500658_0033119
1582 Ga0500559_0003325
1583 Ga0500559_0007104
1584 Ga0500559_0035376
1585 Ga0500564_000959
1586 Ga0500568_0004150
1587 Ga0500573_0002298
1588 Ga0500573_0177095
1589 Ga0500573_0246625
1590 Ga0500577_0173313
1591 Ga0500588_0391161
1592 Ga0500604_0140797
1593 Ga0500622_0197561
1594 Ga0500624_000011
1595 Ga0500627_0000009
1596 Ga0500627_0001047
1597 Ga0500627_0057845
1598 Ga0500627_0094683
1599 Ga0500627_0241872
1600 Ga0500636_0040341
1601 Ga0500567_001496
1602 Ga0500611_133902
1603 Ga0500625_000001
1604 Ga0500645_000064
1605 Ga0500645_000705
1606 Ga0500645_071059
1607 Ga0500596_006952
1608 Ga0466962_0038732
1609 2600228428
1610 2676486109
1611 2739648892
1612 2740027365
1613 2819715221
1614 2879163412
1615 2885430973
1616 2928031156
1617 2928528039
1618 2928971457
1619 2984556467
1620 2984565359
1621 2990268925
1622 2993356435
1623 2993697264
1624 8057101428

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14588

YjgF_endoribonc

YjgF/chorismate_mutase-like, putative endoribonuclease

24

169

0.95

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

10

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d01-assembly1.cif.gz_K error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9751 3 154
3d01-assembly2.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9723 3 153
3d01-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9721 3 153
3d01-assembly4.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9656 3 154
3d01-assembly1.cif.gz_I error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9634 3 153
ID Description Score Start End Superfamily
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.977 3 153 3.30.1330.40
3d01E00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9633 3 153 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9481 1 152 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9421 1 152 3.30.1330.40
2otmC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.936 1 152 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A4Q3I1J2-F1-model_v4 deleted 0.9971 58 153
AF-A0A4Q3AEF4-F1-model_v4 RidA family protein 0.9964 18 153
AF-A0A847ZXD2-F1-model_v4 RidA family protein 0.9963 58 153
AF-A0A2A4UHN9-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9963 65 153
AF-A0A6L8G997-F1-model_v4 RidA family protein 0.996 35 153

Map