F481908
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 366 | 1624 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_010229|Ga0500595_010229_1590_2111 |
| Length | 173 |
| Sequence | MKASALTGSALTEEKAYLMADRVDSKLAELGLTLPAPAAPVASYVPTVEAGGLLHVSGQLPFKDGAVMTGRLGADANLAYGQEAAQRCALMLVAQIKAALGGLHRVERIVKLGVFVNSAPGFTDQPKVANGASDLMFALFGDAGRHARSAVGVSALPLGAAVEVDAIIQIAMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 163 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 187 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 196 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 197 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 198 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 199 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 200 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 201 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 204 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 205 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 206 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 207 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 208 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 209 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 210 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 211 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 212 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 213 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 214 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 215 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 216 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 217 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 218 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 221 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 280 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 283 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 284 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 285 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 286 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 287 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 288 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 289 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 290 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 321 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 322 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 323 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 324 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 328 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 329 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 330 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 338 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 340 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 341 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 342 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 343 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 346 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 347 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 350 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 351 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 352 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 353 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 354 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 355 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 356 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 357 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 358 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 359 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 360 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 361 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 362 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 363 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 364 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 365 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 366 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.66 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.62 |
| Bulb | 0 |
| Endosphere | 12.19 |
| Nodule | 0 |
| Rhizoplane | 3.57 |
| Rhizosphere | 78.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500595_010229 | 3300053119 | Bacteria | 3737 |
| 2 | SwRhRL2b_contig_2687397 | 2162886007 | Bacteria | 1122 |
| 3 | ARcpr5oldR_c001506 | 3300000041 | Bacteria | 2339 |
| 4 | JGI24752J21851_1001224 | 3300001976 | Bacteria | 3494 |
| 5 | JGI24740J21852_10025651 | 3300001979 | Bacteria | 1984 |
| 6 | JGI24739J22299_10000524 | 3300001989 | Bacteria | 13667 |
| 7 | JGI24739J22299_10002936 | 3300001989 | Bacteria | 6534 |
| 8 | JGI24739J22299_10013165 | 3300001989 | Bacteria | 3026 |
| 9 | JGI24737J22298_10007810 | 3300001990 | Bacteria | 3606 |
| 10 | JGI24735J21928_10003268 | 3300002067 | Bacteria | 5544 |
| 11 | JGI24735J21928_10019703 | 3300002067 | Bacteria | 2072 |
| 12 | JGI24735J21928_10109069 | 3300002067 | Bacteria | 796 |
| 13 | JGI24748J21848_1019863 | 3300002074 | Bacteria | 808 |
| 14 | JGI24738J21930_10003430 | 3300002075 | Bacteria | 3999 |
| 15 | JGI24738J21930_10003879 | 3300002075 | Bacteria | 3732 |
| 16 | JGI25151J46595_10088405 | 3300003187 | Bacteria | 871 |
| 17 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 18 | JGI25153J46596_10006448 | 3300003215 | Bacteria | 5922 |
| 19 | Ga0055537_1000460 | 3300003773 | Bacteria | 25614 |
| 20 | Ga0055524_1000155 | 3300003775 | Bacteria | 79672 |
| 21 | Ga0055536_1003969 | 3300003781 | Bacteria | 7746 |
| 22 | Ga0055536_1006424 | 3300003781 | Bacteria | 5495 |
| 23 | Ga0055536_1015396 | 3300003781 | Bacteria | 2621 |
| 24 | Ga0055534_1019585 | 3300003784 | Bacteria | 1158 |
| 25 | Ga0055530_10000115 | 3300003791 | Bacteria | 70229 |
| 26 | Ga0055530_10001208 | 3300003791 | Bacteria | 19993 |
| 27 | Ga0055530_10008781 | 3300003791 | Bacteria | 3991 |
| 28 | Ga0055531_10000792 | 3300003794 | Bacteria | 26275 |
| 29 | Ga0055531_10002671 | 3300003794 | Bacteria | 11762 |
| 30 | Ga0055531_10006063 | 3300003794 | Bacteria | 6926 |
| 31 | Ga0055531_10006683 | 3300003794 | Bacteria | 6467 |
| 32 | Ga0065165_1007583 | 3300005262 | Bacteria | 5287 |
| 33 | Ga0065165_1018077 | 3300005262 | Bacteria | 2569 |
| 34 | Ga0065165_1041615 | 3300005262 | Bacteria | 1363 |
| 35 | Ga0065704_10074901 | 3300005289 | Bacteria | 5927 |
| 36 | Ga0065707_10081882 | 3300005295 | Bacteria | 31785 |
| 37 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 38 | Ga0070658_10021495 | 3300005327 | Bacteria | 5171 |
| 39 | Ga0070658_10030316 | 3300005327 | Bacteria | 4346 |
| 40 | Ga0070658_10033779 | 3300005327 | Bacteria | 4116 |
| 41 | Ga0070658_10054034 | 3300005327 | Bacteria | 3261 |
| 42 | Ga0070658_10166424 | 3300005327 | Bacteria | 1851 |
| 43 | Ga0070683_100559908 | 3300005329 | Bacteria | 1093 |
| 44 | Ga0070670_100000030 | 3300005331 | Bacteria | 164211 |
| 45 | Ga0070670_100746266 | 3300005331 | Bacteria | 882 |
| 46 | Ga0070670_101154386 | 3300005331 | Bacteria | 707 |
| 47 | Ga0070680_100025459 | 3300005336 | Bacteria | 4730 |
| 48 | Ga0070680_100034426 | 3300005336 | Bacteria | 4083 |
| 49 | Ga0070680_100104058 | 3300005336 | Bacteria | 2359 |
| 50 | Ga0070680_100837885 | 3300005336 | Bacteria | 793 |
| 51 | Ga0070682_100579292 | 3300005337 | Bacteria | 883 |
| 52 | Ga0068868_100565982 | 3300005338 | Bacteria | 1003 |
| 53 | Ga0070660_100057997 | 3300005339 | Bacteria | 3001 |
| 54 | Ga0070660_100059329 | 3300005339 | Bacteria | 2967 |
| 55 | Ga0070660_100088967 | 3300005339 | Bacteria | 2432 |
| 56 | Ga0070660_100107890 | 3300005339 | Bacteria | 2213 |
| 57 | Ga0070660_100397916 | 3300005339 | Bacteria | 1139 |
| 58 | Ga0070660_100408703 | 3300005339 | Bacteria | 1123 |
| 59 | Ga0070661_100139342 | 3300005344 | Bacteria | 1827 |
| 60 | Ga0070661_100267307 | 3300005344 | Bacteria | 1323 |
| 61 | Ga0070661_100585399 | 3300005344 | Bacteria | 901 |
| 62 | Ga0070692_10000142 | 3300005345 | Bacteria | 17361 |
| 63 | Ga0070692_10159865 | 3300005345 | Bacteria | 1290 |
| 64 | Ga0070668_100000011 | 3300005347 | Bacteria | 123099 |
| 65 | Ga0070671_100003480 | 3300005355 | Bacteria | 12284 |
| 66 | Ga0070671_100093078 | 3300005355 | Bacteria | 2526 |
| 67 | Ga0070671_100671018 | 3300005355 | Bacteria | 898 |
| 68 | Ga0070673_100015570 | 3300005364 | Bacteria | 5348 |
| 69 | Ga0070673_100828271 | 3300005364 | Bacteria | 856 |
| 70 | Ga0070659_100003069 | 3300005366 | Bacteria | 11859 |
| 71 | Ga0070659_100021627 | 3300005366 | Bacteria | 4902 |
| 72 | Ga0070659_100090402 | 3300005366 | Bacteria | 2453 |
| 73 | Ga0070659_100157669 | 3300005366 | Bacteria | 1854 |
| 74 | Ga0070659_100202257 | 3300005366 | Bacteria | 1635 |
| 75 | Ga0070667_100000161 | 3300005367 | Bacteria | 83551 |
| 76 | Ga0070667_100383351 | 3300005367 | Bacteria | 1277 |
| 77 | Ga0070714_100263657 | 3300005435 | Bacteria | 1596 |
| 78 | Ga0070714_100556978 | 3300005435 | Bacteria | 1098 |
| 79 | Ga0070708_100141656 | 3300005445 | Bacteria | 2230 |
| 80 | Ga0070663_100003059 | 3300005455 | Bacteria | 9565 |
| 81 | Ga0070663_100044176 | 3300005455 | Bacteria | 3140 |
| 82 | Ga0070663_100050017 | 3300005455 | Bacteria | 2971 |
| 83 | Ga0070662_100016573 | 3300005457 | Bacteria | 4949 |
| 84 | Ga0070662_100065006 | 3300005457 | Bacteria | 2673 |
| 85 | Ga0070662_100121909 | 3300005457 | Bacteria | 1999 |
| 86 | Ga0070681_10029494 | 3300005458 | Bacteria | 5510 |
| 87 | Ga0070681_10072402 | 3300005458 | Bacteria | 3409 |
| 88 | Ga0070681_10105457 | 3300005458 | Bacteria | 2760 |
| 89 | Ga0070681_10172151 | 3300005458 | Bacteria | 2087 |
| 90 | Ga0070706_100028793 | 3300005467 | Bacteria | 5116 |
| 91 | Ga0070679_100077764 | 3300005530 | Bacteria | 3307 |
| 92 | Ga0070679_100095520 | 3300005530 | Bacteria | 2960 |
| 93 | Ga0070679_100173758 | 3300005530 | Bacteria | 2127 |
| 94 | Ga0070679_100191645 | 3300005530 | Bacteria | 2013 |
| 95 | Ga0070679_100332936 | 3300005530 | Bacteria | 1467 |
| 96 | Ga0070679_100340828 | 3300005530 | Bacteria | 1447 |
| 97 | Ga0070679_100650877 | 3300005530 | Bacteria | 996 |
| 98 | Ga0070679_100651978 | 3300005530 | Bacteria | 995 |
| 99 | Ga0070684_100329502 | 3300005535 | Bacteria | 1403 |
| 100 | Ga0068853_100012834 | 3300005539 | Bacteria | 6825 |
| 101 | Ga0068853_100054892 | 3300005539 | Bacteria | 3433 |
| 102 | Ga0068853_100067073 | 3300005539 | Bacteria | 3117 |
| 103 | Ga0068853_100072366 | 3300005539 | Bacteria | 3004 |
| 104 | Ga0068853_100220247 | 3300005539 | Bacteria | 1733 |
| 105 | Ga0068853_100247300 | 3300005539 | Bacteria | 1636 |
| 106 | Ga0068853_100642700 | 3300005539 | Bacteria | 1009 |
| 107 | Ga0068853_101379521 | 3300005539 | Bacteria | 681 |
| 108 | Ga0070695_100075268 | 3300005545 | Bacteria | 2220 |
| 109 | Ga0070696_100021044 | 3300005546 | Bacteria | 4420 |
| 110 | Ga0070696_100461594 | 3300005546 | Bacteria | 1004 |
| 111 | Ga0070693_100148555 | 3300005547 | Bacteria | 1482 |
| 112 | Ga0070693_100198996 | 3300005547 | Bacteria | 1300 |
| 113 | Ga0070665_100044221 | 3300005548 | Bacteria | 4472 |
| 114 | Ga0070665_100291629 | 3300005548 | Bacteria | 1634 |
| 115 | Ga0070665_100359322 | 3300005548 | Bacteria | 1462 |
| 116 | Ga0070704_100316459 | 3300005549 | Bacteria | 1306 |
| 117 | Ga0068855_100048687 | 3300005563 | Bacteria | 5001 |
| 118 | Ga0068855_100051070 | 3300005563 | Bacteria | 4871 |
| 119 | Ga0068855_100129913 | 3300005563 | Bacteria | 2877 |
| 120 | Ga0068855_100189877 | 3300005563 | Bacteria | 2318 |
| 121 | Ga0068855_100289358 | 3300005563 | Bacteria | 1817 |
| 122 | Ga0068855_100302634 | 3300005563 | Bacteria | 1770 |
| 123 | Ga0068855_100315793 | 3300005563 | Bacteria | 1728 |
| 124 | Ga0068855_100454337 | 3300005563 | Bacteria | 1397 |
| 125 | Ga0068855_100619267 | 3300005563 | Bacteria | 1166 |
| 126 | Ga0070664_100107856 | 3300005564 | Bacteria | 2428 |
| 127 | Ga0070664_100183721 | 3300005564 | Bacteria | 1860 |
| 128 | Ga0070664_100853026 | 3300005564 | Bacteria | 853 |
| 129 | Ga0070664_101305074 | 3300005564 | Bacteria | 685 |
| 130 | Ga0068857_100041693 | 3300005577 | Bacteria | 4070 |
| 131 | Ga0068857_100094218 | 3300005577 | Bacteria | 2681 |
| 132 | Ga0068857_100142446 | 3300005577 | Bacteria | 2167 |
| 133 | Ga0068857_100276997 | 3300005577 | Bacteria | 1542 |
| 134 | Ga0068854_100000559 | 3300005578 | Bacteria | 22307 |
| 135 | Ga0068854_100026578 | 3300005578 | Bacteria | 3980 |
| 136 | Ga0068854_100039382 | 3300005578 | Bacteria | 3329 |
| 137 | Ga0068854_100055677 | 3300005578 | Bacteria | 2848 |
| 138 | Ga0068854_100417427 | 3300005578 | Bacteria | 1114 |
| 139 | Ga0068854_100527255 | 3300005578 | Bacteria | 998 |
| 140 | Ga0068854_100764096 | 3300005578 | Bacteria | 839 |
| 141 | Ga0068856_100027149 | 3300005614 | Bacteria | 5586 |
| 142 | Ga0068856_100052866 | 3300005614 | Bacteria | 4006 |
| 143 | Ga0068856_100072762 | 3300005614 | Bacteria | 3403 |
| 144 | Ga0068856_100115596 | 3300005614 | Bacteria | 2683 |
| 145 | Ga0068856_100427271 | 3300005614 | Bacteria | 1345 |
| 146 | Ga0068856_101210619 | 3300005614 | Bacteria | 771 |
| 147 | Ga0068852_100032215 | 3300005616 | Bacteria | 4337 |
| 148 | Ga0068852_100047102 | 3300005616 | Bacteria | 3676 |
| 149 | Ga0068852_100048090 | 3300005616 | Bacteria | 3643 |
| 150 | Ga0068852_100058186 | 3300005616 | Bacteria | 3347 |
| 151 | Ga0068852_100073666 | 3300005616 | Bacteria | 3005 |
| 152 | Ga0068852_100814070 | 3300005616 | Bacteria | 948 |
| 153 | Ga0068852_100922176 | 3300005616 | Bacteria | 891 |
| 154 | Ga0068852_101108464 | 3300005616 | Bacteria | 812 |
| 155 | Ga0068859_100032942 | 3300005617 | Bacteria | 5205 |
| 156 | Ga0068859_100213296 | 3300005617 | Bacteria | 2017 |
| 157 | Ga0068859_100481698 | 3300005617 | Bacteria | 1336 |
| 158 | Ga0068864_100000041 | 3300005618 | Bacteria | 165878 |
| 159 | Ga0068864_100018954 | 3300005618 | Bacteria | 5753 |
| 160 | Ga0068861_100772769 | 3300005719 | Bacteria | 899 |
| 161 | Ga0068851_10021086 | 3300005834 | Bacteria | 3161 |
| 162 | Ga0068851_10022086 | 3300005834 | Bacteria | 3096 |
| 163 | Ga0068863_100000035 | 3300005841 | Bacteria | 165877 |
| 164 | Ga0068863_100000186 | 3300005841 | Bacteria | 65963 |
| 165 | Ga0068863_100593238 | 3300005841 | Bacteria | 1096 |
| 166 | Ga0068858_100000102 | 3300005842 | Bacteria | 88959 |
| 167 | Ga0068858_100001966 | 3300005842 | Bacteria | 20993 |
| 168 | Ga0068858_100309087 | 3300005842 | Bacteria | 1509 |
| 169 | Ga0068858_100575641 | 3300005842 | Bacteria | 1091 |
| 170 | Ga0068862_100000042 | 3300005844 | Bacteria | 165084 |
| 171 | Ga0068862_100312956 | 3300005844 | Bacteria | 1447 |
| 172 | Ga0081455_10000405 | 3300005937 | Bacteria | 56782 |
| 173 | Ga0075368_10116970 | 3300006042 | Bacteria | 1102 |
| 174 | Ga0075369_10165462 | 3300006186 | Bacteria | 1014 |
| 175 | Ga0097621_100285331 | 3300006237 | Bacteria | 1454 |
| 176 | Ga0068871_100005363 | 3300006358 | Bacteria | 8984 |
| 177 | Ga0068871_100682245 | 3300006358 | Bacteria | 940 |
| 178 | Ga0075428_100050761 | 3300006844 | Bacteria | 4548 |
| 179 | Ga0075428_101653890 | 3300006844 | Bacteria | 669 |
| 180 | Ga0075429_100424676 | 3300006880 | Bacteria | 1164 |
| 181 | Ga0097620_100032942 | 3300006931 | Bacteria | 5205 |
| 182 | Ga0097620_100213276 | 3300006931 | Bacteria | 2017 |
| 183 | Ga0097620_100481677 | 3300006931 | Bacteria | 1336 |
| 184 | Ga0105240_10008649 | 3300009093 | Bacteria | 14545 |
| 185 | Ga0105240_10022129 | 3300009093 | Bacteria | 8435 |
| 186 | Ga0105240_10186565 | 3300009093 | Bacteria | 2442 |
| 187 | Ga0105240_10699040 | 3300009093 | Bacteria | 1107 |
| 188 | Ga0105240_10929977 | 3300009093 | Bacteria | 934 |
| 189 | Ga0111539_10016465 | 3300009094 | Bacteria | 9167 |
| 190 | Ga0105245_10001046 | 3300009098 | Bacteria | 25053 |
| 191 | Ga0105247_10038819 | 3300009101 | Bacteria | 2908 |
| 192 | Ga0105247_10109991 | 3300009101 | Bacteria | 1772 |
| 193 | Ga0114129_10170049 | 3300009147 | Bacteria | 2972 |
| 194 | Ga0105243_10028129 | 3300009148 | Bacteria | 4313 |
| 195 | Ga0105241_10194511 | 3300009174 | Bacteria | 1690 |
| 196 | Ga0105241_10832781 | 3300009174 | Bacteria | 852 |
| 197 | Ga0105248_10000045 | 3300009177 | Bacteria | 165909 |
| 198 | Ga0105248_10003638 | 3300009177 | Bacteria | 17113 |
| 199 | Ga0105248_10028673 | 3300009177 | Bacteria | 6203 |
| 200 | Ga0105248_10032137 | 3300009177 | Bacteria | 5866 |
| 201 | Ga0105248_10392213 | 3300009177 | Bacteria | 1563 |
| 202 | Ga0105237_10104546 | 3300009545 | Bacteria | 2823 |
| 203 | Ga0105237_10181775 | 3300009545 | Bacteria | 2103 |
| 204 | Ga0105237_10216772 | 3300009545 | Bacteria | 1914 |
| 205 | Ga0105237_11559915 | 3300009545 | Bacteria | 667 |
| 206 | Ga0105238_10035938 | 3300009551 | Bacteria | 5036 |
| 207 | Ga0105238_10036999 | 3300009551 | Bacteria | 4963 |
| 208 | Ga0105238_10067960 | 3300009551 | Bacteria | 3564 |
| 209 | Ga0105238_10092085 | 3300009551 | Bacteria | 3019 |
| 210 | Ga0105238_10390045 | 3300009551 | Bacteria | 1385 |
| 211 | Ga0105238_10402836 | 3300009551 | Bacteria | 1361 |
| 212 | Ga0105238_10707038 | 3300009551 | Bacteria | 1020 |
| 213 | Ga0105249_10000055 | 3300009553 | Bacteria | 161674 |
| 214 | Ga0105249_10014831 | 3300009553 | Bacteria | 6890 |
| 215 | Ga0105239_10089892 | 3300010375 | Bacteria | 3387 |
| 216 | Ga0105239_12106981 | 3300010375 | Bacteria | 655 |
| 217 | Ga0157373_10016847 | 3300013100 | Bacteria | 5328 |
| 218 | Ga0157373_10040258 | 3300013100 | Bacteria | 3344 |
| 219 | Ga0157373_10075053 | 3300013100 | Bacteria | 2385 |
| 220 | Ga0157373_10242676 | 3300013100 | Bacteria | 1273 |
| 221 | Ga0157373_10551089 | 3300013100 | Bacteria | 836 |
| 222 | Ga0157371_10155848 | 3300013102 | Bacteria | 1630 |
| 223 | Ga0157371_10172510 | 3300013102 | Bacteria | 1546 |
| 224 | Ga0157371_10306500 | 3300013102 | Bacteria | 1150 |
| 225 | Ga0157370_10036353 | 3300013104 | Bacteria | 4779 |
| 226 | Ga0157370_10125312 | 3300013104 | Bacteria | 2398 |
| 227 | Ga0157370_10131295 | 3300013104 | Bacteria | 2336 |
| 228 | Ga0157370_10172340 | 3300013104 | Bacteria | 2011 |
| 229 | Ga0157370_10724662 | 3300013104 | Bacteria | 907 |
| 230 | Ga0157369_10002615 | 3300013105 | Bacteria | 21530 |
| 231 | Ga0157369_10070306 | 3300013105 | Bacteria | 3761 |
| 232 | Ga0157369_10121654 | 3300013105 | Bacteria | 2769 |
| 233 | Ga0157369_10322135 | 3300013105 | Bacteria | 1607 |
| 234 | Ga0157374_10155077 | 3300013296 | Bacteria | 2228 |
| 235 | Ga0157378_10037607 | 3300013297 | Bacteria | 4288 |
| 236 | Ga0157378_10048347 | 3300013297 | Bacteria | 3782 |
| 237 | Ga0163162_10009164 | 3300013306 | Bacteria | 9631 |
| 238 | Ga0163162_10009790 | 3300013306 | Bacteria | 9326 |
| 239 | Ga0163162_10010728 | 3300013306 | Bacteria | 8913 |
| 240 | Ga0163162_10639562 | 3300013306 | Bacteria | 1188 |
| 241 | Ga0157372_10002970 | 3300013307 | Bacteria | 18265 |
| 242 | Ga0157372_10319859 | 3300013307 | Bacteria | 1807 |
| 243 | Ga0157372_10655508 | 3300013307 | Bacteria | 1222 |
| 244 | Ga0157372_10935612 | 3300013307 | Bacteria | 1005 |
| 245 | Ga0157372_11340683 | 3300013307 | Bacteria | 825 |
| 246 | Ga0157372_11871339 | 3300013307 | Bacteria | 690 |
| 247 | Ga0157375_12321886 | 3300013308 | Bacteria | 640 |
| 248 | Ga0163163_10248751 | 3300014325 | Bacteria | 1828 |
| 249 | Ga0163163_10257193 | 3300014325 | Bacteria | 1797 |
| 250 | Ga0163163_10450992 | 3300014325 | Bacteria | 1346 |
| 251 | Ga0157380_10007873 | 3300014326 | Bacteria | 7583 |
| 252 | Ga0182008_10505366 | 3300014497 | Bacteria | 665 |
| 253 | Ga0157379_10021517 | 3300014968 | Bacteria | 5710 |
| 254 | Ga0206356_11202361 | 3300020070 | Bacteria | 1440 |
| 255 | Ga0206354_10168296 | 3300020081 | Bacteria | 1820 |
| 256 | Ga0206353_12012794 | 3300020082 | Bacteria | 1711 |
| 257 | Ga0213875_10005097 | 3300021388 | Bacteria | 7109 |
| 258 | Ga0209437_111975 | 3300025233 | Bacteria | 1280 |
| 259 | Ga0207425_1007250 | 3300025245 | Bacteria | 2948 |
| 260 | Ga0209646_1015807 | 3300025246 | Bacteria | 1124 |
| 261 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 262 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 263 | Ga0209455_1000772 | 3300025272 | Bacteria | 17958 |
| 264 | Ga0209455_1025746 | 3300025272 | Bacteria | 1065 |
| 265 | Ga0209673_1002122 | 3300025273 | Bacteria | 14821 |
| 266 | Ga0209675_1000104 | 3300025291 | Bacteria | 121249 |
| 267 | Ga0209675_1013492 | 3300025291 | Bacteria | 2549 |
| 268 | Ga0209676_1000807 | 3300025292 | Bacteria | 41068 |
| 269 | Ga0209676_1001060 | 3300025292 | Bacteria | 31500 |
| 270 | Ga0209676_1001199 | 3300025292 | Bacteria | 27715 |
| 271 | Ga0209676_1044912 | 3300025292 | Bacteria | 1207 |
| 272 | Ga0209025_1006362 | 3300025294 | Bacteria | 9192 |
| 273 | Ga0209758_1008891 | 3300025297 | Bacteria | 6378 |
| 274 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 275 | Ga0209050_1000286 | 3300025298 | Bacteria | 106566 |
| 276 | Ga0209050_1002140 | 3300025298 | Bacteria | 17979 |
| 277 | Ga0209050_1004981 | 3300025298 | Bacteria | 8643 |
| 278 | Ga0209050_1072435 | 3300025298 | Bacteria | 763 |
| 279 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 280 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 281 | Ga0209257_1000245 | 3300025304 | Bacteria | 125987 |
| 282 | Ga0209257_1000321 | 3300025304 | Bacteria | 100476 |
| 283 | Ga0209257_1001354 | 3300025304 | Bacteria | 29627 |
| 284 | Ga0209257_1001434 | 3300025304 | Bacteria | 28267 |
| 285 | Ga0209257_1014820 | 3300025304 | Bacteria | 3308 |
| 286 | Ga0207656_10025320 | 3300025321 | Bacteria | 2408 |
| 287 | Ga0207656_10039366 | 3300025321 | Bacteria | 1999 |
| 288 | Ga0207656_10066705 | 3300025321 | Bacteria | 1591 |
| 289 | Ga0207710_10135767 | 3300025900 | Bacteria | 1184 |
| 290 | Ga0207680_10719372 | 3300025903 | Bacteria | 716 |
| 291 | Ga0207647_10007714 | 3300025904 | Bacteria | 7748 |
| 292 | Ga0207647_10024741 | 3300025904 | Bacteria | 3957 |
| 293 | Ga0207647_10028509 | 3300025904 | Bacteria | 3624 |
| 294 | Ga0207705_10002705 | 3300025909 | Bacteria | 13560 |
| 295 | Ga0207705_10009941 | 3300025909 | Bacteria | 6927 |
| 296 | Ga0207705_10026902 | 3300025909 | Bacteria | 4099 |
| 297 | Ga0207705_10033221 | 3300025909 | Bacteria | 3685 |
| 298 | Ga0207705_10106802 | 3300025909 | Bacteria | 2065 |
| 299 | Ga0207705_10427571 | 3300025909 | Bacteria | 1026 |
| 300 | Ga0207684_10421321 | 3300025910 | Bacteria | 1147 |
| 301 | Ga0207654_10517952 | 3300025911 | Bacteria | 844 |
| 302 | Ga0207654_10792998 | 3300025911 | Bacteria | 684 |
| 303 | Ga0207707_10044083 | 3300025912 | Bacteria | 3890 |
| 304 | Ga0207707_10149531 | 3300025912 | Bacteria | 2042 |
| 305 | Ga0207707_10191173 | 3300025912 | Bacteria | 1786 |
| 306 | Ga0207695_10026017 | 3300025913 | Bacteria | 6537 |
| 307 | Ga0207695_10199135 | 3300025913 | Bacteria | 1918 |
| 308 | Ga0207695_10660640 | 3300025913 | Bacteria | 926 |
| 309 | Ga0207695_11185612 | 3300025913 | Bacteria | 644 |
| 310 | Ga0207671_10024252 | 3300025914 | Bacteria | 4564 |
| 311 | Ga0207671_10081045 | 3300025914 | Bacteria | 2433 |
| 312 | Ga0207671_10088723 | 3300025914 | Bacteria | 2327 |
| 313 | Ga0207660_10000024 | 3300025917 | Bacteria | 71220 |
| 314 | Ga0207660_10060824 | 3300025917 | Bacteria | 2717 |
| 315 | Ga0207660_10225842 | 3300025917 | Bacteria | 1471 |
| 316 | Ga0207660_10447300 | 3300025917 | Bacteria | 1044 |
| 317 | Ga0207660_10490502 | 3300025917 | Bacteria | 996 |
| 318 | Ga0207660_10731325 | 3300025917 | Bacteria | 807 |
| 319 | Ga0207657_10007988 | 3300025919 | Bacteria | 10787 |
| 320 | Ga0207657_10010415 | 3300025919 | Bacteria | 9281 |
| 321 | Ga0207657_10046672 | 3300025919 | Bacteria | 3793 |
| 322 | Ga0207657_10053077 | 3300025919 | Bacteria | 3514 |
| 323 | Ga0207657_10103276 | 3300025919 | Bacteria | 2363 |
| 324 | Ga0207657_10109325 | 3300025919 | Bacteria | 2285 |
| 325 | Ga0207657_10112964 | 3300025919 | Bacteria | 2241 |
| 326 | Ga0207657_10583406 | 3300025919 | Bacteria | 873 |
| 327 | Ga0207657_11032159 | 3300025919 | Bacteria | 630 |
| 328 | Ga0207649_10059417 | 3300025920 | Bacteria | 2398 |
| 329 | Ga0207649_10089449 | 3300025920 | Bacteria | 2013 |
| 330 | Ga0207649_10095289 | 3300025920 | Bacteria | 1958 |
| 331 | Ga0207649_10597774 | 3300025920 | Bacteria | 848 |
| 332 | Ga0207652_10073532 | 3300025921 | Bacteria | 2974 |
| 333 | Ga0207652_10092414 | 3300025921 | Bacteria | 2662 |
| 334 | Ga0207652_10148018 | 3300025921 | Bacteria | 2102 |
| 335 | Ga0207652_10159255 | 3300025921 | Bacteria | 2023 |
| 336 | Ga0207652_10293774 | 3300025921 | Bacteria | 1466 |
| 337 | Ga0207652_10410785 | 3300025921 | Bacteria | 1221 |
| 338 | Ga0207652_10480000 | 3300025921 | Bacteria | 1120 |
| 339 | Ga0207652_11018435 | 3300025921 | Bacteria | 727 |
| 340 | Ga0207681_10190284 | 3300025923 | Bacteria | 1570 |
| 341 | Ga0207694_10020412 | 3300025924 | Bacteria | 5013 |
| 342 | Ga0207694_10029168 | 3300025924 | Bacteria | 4208 |
| 343 | Ga0207694_10062555 | 3300025924 | Bacteria | 2898 |
| 344 | Ga0207694_11336831 | 3300025924 | Bacteria | 606 |
| 345 | Ga0207650_10000111 | 3300025925 | Bacteria | 107416 |
| 346 | Ga0207650_10018464 | 3300025925 | Bacteria | 4895 |
| 347 | Ga0207687_10000562 | 3300025927 | Bacteria | 25050 |
| 348 | Ga0207664_10066774 | 3300025929 | Bacteria | 2884 |
| 349 | Ga0207664_10500508 | 3300025929 | Bacteria | 1088 |
| 350 | Ga0207644_10000032 | 3300025931 | Bacteria | 133759 |
| 351 | Ga0207644_10051599 | 3300025931 | Bacteria | 2953 |
| 352 | Ga0207644_10102939 | 3300025931 | Bacteria | 2148 |
| 353 | Ga0207644_10374951 | 3300025931 | Bacteria | 1159 |
| 354 | Ga0207644_10521877 | 3300025931 | Bacteria | 981 |
| 355 | Ga0207644_11753146 | 3300025931 | Bacteria | 520 |
| 356 | Ga0207690_10018054 | 3300025932 | Bacteria | 4321 |
| 357 | Ga0207690_10063579 | 3300025932 | Bacteria | 2517 |
| 358 | Ga0207690_10078402 | 3300025932 | Bacteria | 2299 |
| 359 | Ga0207690_10147247 | 3300025932 | Bacteria | 1742 |
| 360 | Ga0207690_10182553 | 3300025932 | Bacteria | 1581 |
| 361 | Ga0207690_10675176 | 3300025932 | Bacteria | 848 |
| 362 | Ga0207706_10004718 | 3300025933 | Bacteria | 12764 |
| 363 | Ga0207706_10015487 | 3300025933 | Bacteria | 6889 |
| 364 | Ga0207706_10067824 | 3300025933 | Bacteria | 3140 |
| 365 | Ga0207691_10068308 | 3300025940 | Bacteria | 3211 |
| 366 | Ga0207711_10000027 | 3300025941 | Bacteria | 236548 |
| 367 | Ga0207711_10002908 | 3300025941 | Bacteria | 15009 |
| 368 | Ga0207711_10012212 | 3300025941 | Bacteria | 7142 |
| 369 | Ga0207711_10468112 | 3300025941 | Bacteria | 1174 |
| 370 | Ga0207661_10732046 | 3300025944 | Bacteria | 910 |
| 371 | Ga0207679_10033400 | 3300025945 | Bacteria | 3620 |
| 372 | Ga0207679_10228292 | 3300025945 | Bacteria | 1570 |
| 373 | Ga0207679_11018164 | 3300025945 | Bacteria | 759 |
| 374 | Ga0207667_10025172 | 3300025949 | Bacteria | 6520 |
| 375 | Ga0207667_10041234 | 3300025949 | Bacteria | 4910 |
| 376 | Ga0207667_10053956 | 3300025949 | Bacteria | 4228 |
| 377 | Ga0207667_10070885 | 3300025949 | Bacteria | 3626 |
| 378 | Ga0207667_10357924 | 3300025949 | Bacteria | 1488 |
| 379 | Ga0207667_10497892 | 3300025949 | Bacteria | 1236 |
| 380 | Ga0207651_10171341 | 3300025960 | Bacteria | 1712 |
| 381 | Ga0207712_10000813 | 3300025961 | Bacteria | 23020 |
| 382 | Ga0207712_10033349 | 3300025961 | Bacteria | 3481 |
| 383 | Ga0207668_10000034 | 3300025972 | Bacteria | 119274 |
| 384 | Ga0207640_10000202 | 3300025981 | Bacteria | 42596 |
| 385 | Ga0207640_10026210 | 3300025981 | Bacteria | 3537 |
| 386 | Ga0207640_10111478 | 3300025981 | Bacteria | 1940 |
| 387 | Ga0207640_10156959 | 3300025981 | Bacteria | 1678 |
| 388 | Ga0207640_10879216 | 3300025981 | Bacteria | 781 |
| 389 | Ga0207658_10000839 | 3300025986 | Bacteria | 25661 |
| 390 | Ga0207703_10000190 | 3300026035 | Bacteria | 72096 |
| 391 | Ga0207703_10034927 | 3300026035 | Bacteria | 3993 |
| 392 | Ga0207703_10282134 | 3300026035 | Bacteria | 1509 |
| 393 | Ga0207639_10002119 | 3300026041 | Bacteria | 13364 |
| 394 | Ga0207639_10004994 | 3300026041 | Bacteria | 8935 |
| 395 | Ga0207639_10087630 | 3300026041 | Bacteria | 2482 |
| 396 | Ga0207639_10094791 | 3300026041 | Bacteria | 2397 |
| 397 | Ga0207639_10110813 | 3300026041 | Bacteria | 2236 |
| 398 | Ga0207639_10559991 | 3300026041 | Bacteria | 1050 |
| 399 | Ga0207639_10659466 | 3300026041 | Bacteria | 968 |
| 400 | Ga0207639_10846312 | 3300026041 | Bacteria | 854 |
| 401 | Ga0207678_10000455 | 3300026067 | Bacteria | 37036 |
| 402 | Ga0207678_10002000 | 3300026067 | Bacteria | 18558 |
| 403 | Ga0207678_10046585 | 3300026067 | Bacteria | 3749 |
| 404 | Ga0207678_10092769 | 3300026067 | Bacteria | 2580 |
| 405 | Ga0207702_10018713 | 3300026078 | Bacteria | 5729 |
| 406 | Ga0207702_10052142 | 3300026078 | Bacteria | 3460 |
| 407 | Ga0207702_10066422 | 3300026078 | Bacteria | 3091 |
| 408 | Ga0207702_11621557 | 3300026078 | Bacteria | 640 |
| 409 | Ga0207641_10000031 | 3300026088 | Bacteria | 224320 |
| 410 | Ga0207641_10000041 | 3300026088 | Bacteria | 191595 |
| 411 | Ga0207641_10686291 | 3300026088 | Bacteria | 1008 |
| 412 | Ga0207648_10357096 | 3300026089 | Bacteria | 1318 |
| 413 | Ga0207676_10000039 | 3300026095 | Bacteria | 171142 |
| 414 | Ga0207676_10000072 | 3300026095 | Bacteria | 101978 |
| 415 | Ga0207674_10003053 | 3300026116 | Bacteria | 20715 |
| 416 | Ga0207674_10005772 | 3300026116 | Bacteria | 14686 |
| 417 | Ga0207674_10006642 | 3300026116 | Bacteria | 13588 |
| 418 | Ga0207674_10236171 | 3300026116 | Bacteria | 1776 |
| 419 | Ga0207683_11160850 | 3300026121 | Bacteria | 716 |
| 420 | Ga0207698_10025863 | 3300026142 | Bacteria | 4143 |
| 421 | Ga0207698_10041296 | 3300026142 | Bacteria | 3436 |
| 422 | Ga0268266_10056076 | 3300028379 | Bacteria | 3389 |
| 423 | Ga0268266_10064839 | 3300028379 | Bacteria | 3157 |
| 424 | Ga0268265_10000061 | 3300028380 | Bacteria | 148625 |
| 425 | Ga0268265_10146257 | 3300028380 | Bacteria | 1986 |
| 426 | Ga0268264_10000785 | 3300028381 | Bacteria | 34613 |
| 427 | Ga0307517_10075608 | 3300028786 | Bacteria | 2952 |
| 428 | Ga0307515_10325087 | 3300028794 | Bacteria | 1201 |
| 429 | Ga0307512_10435641 | 3300030522 | Bacteria | 535 |
| 430 | Ga0314311_1234836 | 3300030733 | Bacteria | 1559 |
| 431 | Ga0307513_10206273 | 3300031456 | Bacteria | 1801 |
| 432 | Ga0307408_100058897 | 3300031548 | Bacteria | 2794 |
| 433 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 434 | Ga0307405_10101755 | 3300031731 | Bacteria | 1928 |
| 435 | Ga0307405_10109097 | 3300031731 | Bacteria | 1871 |
| 436 | Ga0307405_11004197 | 3300031731 | Bacteria | 712 |
| 437 | Ga0307413_10460217 | 3300031824 | Bacteria | 1012 |
| 438 | Ga0307406_10025518 | 3300031901 | Bacteria | 3539 |
| 439 | Ga0307406_10135661 | 3300031901 | Bacteria | 1734 |
| 440 | Ga0307406_10189804 | 3300031901 | Bacteria | 1503 |
| 441 | Ga0307406_10214331 | 3300031901 | Bacteria | 1427 |
| 442 | Ga0307407_10113528 | 3300031903 | Bacteria | 1705 |
| 443 | Ga0307412_10001328 | 3300031911 | Bacteria | 13834 |
| 444 | Ga0307412_10002668 | 3300031911 | Bacteria | 9900 |
| 445 | Ga0307412_10005336 | 3300031911 | Bacteria | 7213 |
| 446 | Ga0307412_10026022 | 3300031911 | Bacteria | 3632 |
| 447 | Ga0307412_10042785 | 3300031911 | Bacteria | 2946 |
| 448 | Ga0307412_10095174 | 3300031911 | Bacteria | 2093 |
| 449 | Ga0307412_11342480 | 3300031911 | Bacteria | 645 |
| 450 | Ga0307409_100021228 | 3300031995 | Bacteria | 4448 |
| 451 | Ga0307409_100277372 | 3300031995 | Bacteria | 1547 |
| 452 | Ga0307416_100032603 | 3300032002 | Bacteria | 3939 |
| 453 | Ga0307416_100273430 | 3300032002 | Bacteria | 1660 |
| 454 | Ga0307416_100339873 | 3300032002 | Bacteria | 1513 |
| 455 | Ga0307414_10001684 | 3300032004 | Bacteria | 11495 |
| 456 | Ga0307414_10001894 | 3300032004 | Bacteria | 10813 |
| 457 | Ga0307414_10002573 | 3300032004 | Bacteria | 9542 |
| 458 | Ga0307414_10009988 | 3300032004 | Bacteria | 5481 |
| 459 | Ga0307414_10046896 | 3300032004 | Bacteria | 2970 |
| 460 | Ga0307414_10115705 | 3300032004 | Bacteria | 2051 |
| 461 | Ga0307414_10133282 | 3300032004 | Bacteria | 1932 |
| 462 | Ga0307414_10159311 | 3300032004 | Bacteria | 1791 |
| 463 | Ga0307414_10365512 | 3300032004 | Bacteria | 1243 |
| 464 | Ga0307414_10393190 | 3300032004 | Bacteria | 1202 |
| 465 | Ga0307414_11189774 | 3300032004 | Bacteria | 705 |
| 466 | Ga0307415_100044257 | 3300032126 | Bacteria | 2975 |
| 467 | Ga0316583_10008044 | 3300032133 | Bacteria | 3799 |
| 468 | Ga0307510_10066895 | 3300033180 | Bacteria | 3623 |
| 469 | Ga0373954_0103957 | 3300035118 | Bacteria | 1371 |
| 470 | Ga0373956_0348221 | 3300035119 | Bacteria | 706 |
| 471 | Ga0373955_0007600 | 3300035172 | Bacteria | 4992 |
| 472 | Ga0373961_0391148 | 3300035241 | Bacteria | 532 |
| 473 | Ga0316574_0203301 | 3300035398 | Bacteria | 1272 |
| 474 | Ga0373935_0578125 | 3300035692 | Bacteria | 820 |
| 475 | Ga0373933_0013243 | 3300035724 | Bacteria | 4568 |
| 476 | Ga0373937_0047729 | 3300036401 | Bacteria | 3919 |
| 477 | Ga0373937_0102021 | 3300036401 | Bacteria | 2663 |
| 478 | Ga0316582_0000490 | 3300036647 | Bacteria | 14883 |
| 479 | Ga0316582_0578966 | 3300036647 | Bacteria | 773 |
| 480 | Ga0316584_0167688 | 3300036712 | Bacteria | 1630 |
| 481 | Ga0316584_0337297 | 3300036712 | Bacteria | 1084 |
| 482 | Ga0395899_0002299 | 3300037312 | Bacteria | 15586 |
| 483 | Ga0395899_0019311 | 3300037312 | Bacteria | 5178 |
| 484 | Ga0395899_0037173 | 3300037312 | Bacteria | 3650 |
| 485 | Ga0395899_0063584 | 3300037312 | Bacteria | 2714 |
| 486 | Ga0395899_0174455 | 3300037312 | Bacteria | 1512 |
| 487 | Ga0395899_0213365 | 3300037312 | Bacteria | 1340 |
| 488 | Ga0395899_0256610 | 3300037312 | Bacteria | 1197 |
| 489 | Ga0395900_0002548 | 3300037418 | Bacteria | 19966 |
| 490 | Ga0395900_0044846 | 3300037418 | Bacteria | 4554 |
| 491 | Ga0395900_0066250 | 3300037418 | Bacteria | 3711 |
| 492 | Ga0395900_0096980 | 3300037418 | Bacteria | 3029 |
| 493 | Ga0395900_0131864 | 3300037418 | Bacteria | 2560 |
| 494 | Ga0395900_0192374 | 3300037418 | Bacteria | 2069 |
| 495 | Ga0395900_0211241 | 3300037418 | Bacteria | 1959 |
| 496 | Ga0395900_0245869 | 3300037418 | Bacteria | 1792 |
| 497 | Ga0395900_0316383 | 3300037418 | Bacteria | 1542 |
| 498 | Ga0395900_0333416 | 3300037418 | Bacteria | 1494 |
| 499 | Ga0395900_0667608 | 3300037418 | Bacteria | 975 |
| 500 | Ga0395900_1286347 | 3300037418 | Bacteria | 645 |
| 501 | Ga0395898_0025707 | 3300037466 | Bacteria | 5929 |
| 502 | Ga0395898_0093802 | 3300037466 | Bacteria | 2884 |
| 503 | Ga0395898_0164557 | 3300037466 | Bacteria | 2121 |
| 504 | Ga0395898_0233521 | 3300037466 | Bacteria | 1754 |
| 505 | Ga0395898_0235873 | 3300037466 | Bacteria | 1744 |
| 506 | Ga0395898_0652849 | 3300037466 | Bacteria | 994 |
| 507 | Ga0395905_0000409 | 3300037471 | Bacteria | 60283 |
| 508 | Ga0395905_0007919 | 3300037471 | Bacteria | 10511 |
| 509 | Ga0395905_0029823 | 3300037471 | Bacteria | 5142 |
| 510 | Ga0395905_0031015 | 3300037471 | Bacteria | 5034 |
| 511 | Ga0395905_0053376 | 3300037471 | Bacteria | 3783 |
| 512 | Ga0395905_0057214 | 3300037471 | Bacteria | 3647 |
| 513 | Ga0395905_0193828 | 3300037471 | Bacteria | 1905 |
| 514 | Ga0395905_0287733 | 3300037471 | Bacteria | 1530 |
| 515 | Ga0395905_0294247 | 3300037471 | Bacteria | 1510 |
| 516 | Ga0395905_0310813 | 3300037471 | Bacteria | 1464 |
| 517 | Ga0395905_0396107 | 3300037471 | Bacteria | 1275 |
| 518 | Ga0395905_0670827 | 3300037471 | Bacteria | 939 |
| 519 | Ga0395905_0836201 | 3300037471 | Bacteria | 823 |
| 520 | Ga0436364_1172297 | 3300037853 | Bacteria | 30221 |
| 521 | Ga0395901_0010738 | 3300038443 | Bacteria | 9284 |
| 522 | Ga0395901_0011872 | 3300038443 | Bacteria | 8833 |
| 523 | Ga0395901_0173259 | 3300038443 | Bacteria | 2264 |
| 524 | Ga0395901_0271979 | 3300038443 | Bacteria | 1762 |
| 525 | Ga0395901_0300704 | 3300038443 | Bacteria | 1664 |
| 526 | Ga0395901_0440581 | 3300038443 | Bacteria | 1333 |
| 527 | Ga0395901_0468286 | 3300038443 | Bacteria | 1286 |
| 528 | Ga0395901_0521168 | 3300038443 | Bacteria | 1207 |
| 529 | Ga0395901_1006920 | 3300038443 | Bacteria | 809 |
| 530 | Ga0436365_1054374 | 3300039437 | Bacteria | 1165 |
| 531 | Ga0436365_1325832 | 3300039437 | Bacteria | 2552 |
| 532 | Ga0439436_0003483 | 3300041404 | Bacteria | 4783 |
| 533 | Ga0439436_0055151 | 3300041404 | Bacteria | 1117 |
| 534 | Ga0439439_0006576 | 3300041406 | Bacteria | 2691 |
| 535 | Ga0439447_019635 | 3300041407 | Bacteria | 1800 |
| 536 | Ga0439461_0000178 | 3300041410 | Bacteria | 8637 |
| 537 | Ga0439461_0014873 | 3300041410 | Bacteria | 1485 |
| 538 | Ga0439466_0130849 | 3300041411 | Bacteria | 772 |
| 539 | Ga0439465_0009623 | 3300041413 | Bacteria | 3044 |
| 540 | Ga0439465_0030423 | 3300041413 | Bacteria | 1717 |
| 541 | Ga0451800_1680169 | 3300041459 | Bacteria | 602 |
| 542 | Ga0451802_0494763 | 3300041460 | Bacteria | 1032 |
| 543 | Ga0451837_0848718 | 3300041494 | Bacteria | 599 |
| 544 | Ga0451841_0580323 | 3300041498 | Bacteria | 679 |
| 545 | Ga0439431_0000015 | 3300041997 | Bacteria | 27396 |
| 546 | Ga0439431_0004975 | 3300041997 | Bacteria | 2929 |
| 547 | Ga0439442_001570 | 3300042002 | Bacteria | 4481 |
| 548 | Ga0439442_008630 | 3300042002 | Bacteria | 2057 |
| 549 | Ga0439445_0003451 | 3300042004 | Bacteria | 3546 |
| 550 | Ga0439445_0003697 | 3300042004 | Bacteria | 3433 |
| 551 | Ga0439432_006574 | 3300042006 | Bacteria | 4143 |
| 552 | Ga0439432_013379 | 3300042006 | Bacteria | 2792 |
| 553 | Ga0439452_028811 | 3300042010 | Bacteria | 1382 |
| 554 | Ga0439457_033383 | 3300042014 | Bacteria | 1142 |
| 555 | Ga0439462_0010019 | 3300042015 | Bacteria | 2399 |
| 556 | Ga0439462_0010888 | 3300042015 | Bacteria | 2309 |
| 557 | Ga0450919_012947 | 3300042121 | Bacteria | 945 |
| 558 | Ga0450920_035414 | 3300042122 | Bacteria | 989 |
| 559 | Ga0450923_066810 | 3300042125 | Bacteria | 792 |
| 560 | Ga0450894_030654 | 3300042131 | Bacteria | 750 |
| 561 | Ga0450905_000807 | 3300042142 | Bacteria | 3880 |
| 562 | Ga0450889_000518 | 3300042144 | Bacteria | 4304 |
| 563 | Ga0450910_047813 | 3300042147 | Bacteria | 702 |
| 564 | Ga0439446_0006326 | 3300042156 | Bacteria | 3083 |
| 565 | Ga0450908_028476 | 3300042184 | Bacteria | 973 |
| 566 | Ga0450909_005358 | 3300042185 | Bacteria | 1846 |
| 567 | Ga0439434_0002354 | 3300042435 | Bacteria | 5498 |
| 568 | Ga0439434_0005342 | 3300042435 | Bacteria | 3759 |
| 569 | Ga0466969_0253822 | 3300044656 | Bacteria | 797 |
| 570 | Ga0466972_0054673 | 3300044658 | Bacteria | 1920 |
| 571 | Ga0466972_0054969 | 3300044658 | Bacteria | 1915 |
| 572 | Ga0466972_0096323 | 3300044658 | Bacteria | 1402 |
| 573 | Ga0466965_0202783 | 3300044683 | Bacteria | 1053 |
| 574 | Ga0466965_0684844 | 3300044683 | Bacteria | 587 |
| 575 | Ga0466966_0047420 | 3300044684 | Bacteria | 2739 |
| 576 | Ga0466966_0490891 | 3300044684 | Bacteria | 738 |
| 577 | Ga0466966_0538916 | 3300044684 | Bacteria | 702 |
| 578 | Ga0466966_0910100 | 3300044684 | Bacteria | 530 |
| 579 | Ga0466961_0353616 | 3300044693 | Bacteria | 894 |
| 580 | Ga0466963_0062599 | 3300044694 | Bacteria | 2488 |
| 581 | Ga0466963_0280400 | 3300044694 | Bacteria | 1171 |
| 582 | Ga0466963_0461350 | 3300044694 | Bacteria | 896 |
| 583 | Ga0466971_0025809 | 3300044719 | Bacteria | 2624 |
| 584 | Ga0466971_0040567 | 3300044719 | Bacteria | 2091 |
| 585 | Ga0466971_0209539 | 3300044719 | Bacteria | 921 |
| 586 | Ga0466968_0239433 | 3300044735 | Bacteria | 859 |
| 587 | Ga0466957_0002469 | 3300044842 | Bacteria | 9932 |
| 588 | Ga0466957_0060558 | 3300044842 | Bacteria | 2321 |
| 589 | Ga0466960_0021758 | 3300044901 | Bacteria | 2859 |
| 590 | Ga0466959_0296613 | 3300045049 | Bacteria | 1107 |
| 591 | Ga0466958_0000506 | 3300045836 | Bacteria | 16309 |
| 592 | Ga0466958_0240527 | 3300045836 | Bacteria | 1157 |
| 593 | Ga0466958_0588751 | 3300045836 | Bacteria | 723 |
| 594 | Ga0466967_0021699 | 3300045976 | Bacteria | 5223 |
| 595 | Ga0466967_0072671 | 3300045976 | Bacteria | 3083 |
| 596 | Ga0466967_0118471 | 3300045976 | Bacteria | 2442 |
| 597 | Ga0466967_0196153 | 3300045976 | Bacteria | 1910 |
| 598 | Ga0466967_0359547 | 3300045976 | Bacteria | 1410 |
| 599 | Ga0466967_0402299 | 3300045976 | Bacteria | 1332 |
| 600 | Ga0466967_0449707 | 3300045976 | Bacteria | 1259 |
| 601 | Ga0466967_1591370 | 3300045976 | Bacteria | 651 |
| 602 | Ga0466967_1844498 | 3300045976 | Bacteria | 602 |
| 603 | Ga0466967_2108633 | 3300045976 | Bacteria | 560 |
| 604 | Ga0466967_2218823 | 3300045976 | Bacteria | 545 |
| 605 | Ga0466967_2255187 | 3300045976 | Bacteria | 540 |
| 606 | Ga0495617_011727 | 3300046452 | Bacteria | 2989 |
| 607 | Ga0495627_025915 | 3300046453 | Bacteria | 1897 |
| 608 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 609 | Ga0495638_0000207 | 3300046460 | Bacteria | 83805 |
| 610 | Ga0495638_0059419 | 3300046460 | Bacteria | 2367 |
| 611 | Ga0495650_0023973 | 3300046471 | Bacteria | 2892 |
| 612 | Ga0495605_0174557 | 3300046474 | Bacteria | 948 |
| 613 | Ga0495585_0033580 | 3300046492 | Bacteria | 2904 |
| 614 | Ga0495583_0000180 | 3300046506 | Bacteria | 108471 |
| 615 | Ga0495583_0000643 | 3300046506 | Bacteria | 46051 |
| 616 | Ga0495583_0004661 | 3300046506 | Bacteria | 9669 |
| 617 | Ga0495606_0081466 | 3300046507 | Bacteria | 2012 |
| 618 | Ga0495606_0455880 | 3300046507 | Bacteria | 654 |
| 619 | Ga0495610_0263897 | 3300046512 | Bacteria | 677 |
| 620 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 621 | Ga0495632_0000248 | 3300046519 | Bacteria | 53538 |
| 622 | Ga0495643_0039984 | 3300046522 | Bacteria | 2563 |
| 623 | Ga0495643_0200499 | 3300046522 | Bacteria | 958 |
| 624 | Ga0495648_0000151 | 3300046524 | Bacteria | 83011 |
| 625 | Ga0495648_0026719 | 3300046524 | Bacteria | 3881 |
| 626 | Ga0495663_0107436 | 3300046525 | Bacteria | 924 |
| 627 | Ga0495652_0484320 | 3300046529 | Bacteria | 860 |
| 628 | Ga0495654_0059377 | 3300046530 | Bacteria | 1842 |
| 629 | Ga0495654_0077322 | 3300046530 | Bacteria | 1566 |
| 630 | Ga0495654_0077426 | 3300046530 | Bacteria | 1565 |
| 631 | Ga0495654_0096319 | 3300046530 | Bacteria | 1367 |
| 632 | Ga0495633_0009411 | 3300046558 | Bacteria | 5401 |
| 633 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 634 | Ga0495668_0002391 | 3300046616 | Bacteria | 15550 |
| 635 | Ga0495668_0006873 | 3300046616 | Bacteria | 7376 |
| 636 | Ga0495668_0040848 | 3300046616 | Bacteria | 2586 |
| 637 | Ga0495668_0176176 | 3300046616 | Bacteria | 1172 |
| 638 | Ga0495625_0001182 | 3300046660 | Bacteria | 33512 |
| 639 | Ga0495625_0003111 | 3300046660 | Bacteria | 16956 |
| 640 | Ga0495625_0068441 | 3300046660 | Bacteria | 2496 |
| 641 | Ga0495625_0164006 | 3300046660 | Bacteria | 1487 |
| 642 | Ga0495625_0320073 | 3300046660 | Bacteria | 988 |
| 643 | Ga0495623_0034060 | 3300046679 | Bacteria | 3267 |
| 644 | Ga0495669_0002918 | 3300046684 | Bacteria | 7027 |
| 645 | Ga0495669_0105850 | 3300046684 | Bacteria | 1310 |
| 646 | Ga0495669_0211987 | 3300046684 | Bacteria | 927 |
| 647 | Ga0495670_0006307 | 3300046691 | Bacteria | 5824 |
| 648 | Ga0495670_0090704 | 3300046691 | Bacteria | 1564 |
| 649 | Ga0495670_0260499 | 3300046691 | Bacteria | 925 |
| 650 | Ga0495671_0000023 | 3300046692 | Bacteria | 252939 |
| 651 | Ga0495671_0008914 | 3300046692 | Bacteria | 5634 |
| 652 | Ga0495671_0220005 | 3300046692 | Bacteria | 919 |
| 653 | Ga0495687_121374 | 3300047443 | Bacteria | 942 |
| 654 | Ga0495677_0007182 | 3300047445 | Bacteria | 4169 |
| 655 | Ga0495685_071854 | 3300047447 | Bacteria | 1158 |
| 656 | Ga0495685_123399 | 3300047447 | Bacteria | 849 |
| 657 | Ga0495673_0000054 | 3300047469 | Bacteria | 252207 |
| 658 | Ga0495686_0006227 | 3300047472 | Bacteria | 9193 |
| 659 | Ga0495686_0007366 | 3300047472 | Bacteria | 8255 |
| 660 | Ga0495686_0018195 | 3300047472 | Bacteria | 4720 |
| 661 | Ga0495686_0084881 | 3300047472 | Bacteria | 1929 |
| 662 | Ga0495686_0211929 | 3300047472 | Bacteria | 1106 |
| 663 | Ga0495602_0064575 | 3300048088 | Bacteria | 3164 |
| 664 | Ga0495626_0193598 | 3300048091 | Bacteria | 837 |
| 665 | Ga0496100_0648349 | 3300048903 | Bacteria | 822 |
| 666 | Ga0496101_0075810 | 3300048904 | Bacteria | 2476 |
| 667 | Ga0496101_0179780 | 3300048904 | Bacteria | 1629 |
| 668 | Ga0496101_0679483 | 3300048904 | Bacteria | 813 |
| 669 | Ga0496102_0000481 | 3300048905 | Bacteria | 44268 |
| 670 | Ga0496103_0000347 | 3300048906 | Bacteria | 42198 |
| 671 | Ga0496103_0141373 | 3300048906 | Unclassified | 1539 |
| 672 | Ga0496103_0473379 | 3300048906 | Bacteria | 803 |
| 673 | Ga0496106_0077572 | 3300048909 | Bacteria | 2548 |
| 674 | Ga0496107_0024108 | 3300048910 | Bacteria | 4303 |
| 675 | Ga0496107_0385240 | 3300048910 | Bacteria | 1043 |
| 676 | Ga0496108_0264936 | 3300048911 | Bacteria | 1495 |
| 677 | Ga0496109_0027277 | 3300048912 | Bacteria | 5097 |
| 678 | Ga0496109_0793114 | 3300048912 | Bacteria | 885 |
| 679 | Ga0496110_0078443 | 3300048913 | Bacteria | 2940 |
| 680 | Ga0496110_1216993 | 3300048913 | Bacteria | 662 |
| 681 | Ga0496111_0003794 | 3300048914 | Bacteria | 9425 |
| 682 | Ga0496111_0556205 | 3300048914 | Bacteria | 842 |
| 683 | Ga0496111_1301184 | 3300048914 | Bacteria | 512 |
| 684 | Ga0496112_0009881 | 3300048915 | Bacteria | 8625 |
| 685 | Ga0496112_0084606 | 3300048915 | Bacteria | 3137 |
| 686 | Ga0496112_1108622 | 3300048915 | Bacteria | 709 |
| 687 | Ga0496113_0008196 | 3300048916 | Bacteria | 6790 |
| 688 | Ga0496113_0216587 | 3300048916 | Bacteria | 1525 |
| 689 | Ga0496113_0508911 | 3300048916 | Bacteria | 967 |
| 690 | Ga0496115_0000534 | 3300048918 | Bacteria | 29632 |
| 691 | Ga0496116_0002244 | 3300048919 | Bacteria | 20540 |
| 692 | Ga0496117_0001149 | 3300048920 | Bacteria | 39861 |
| 693 | Ga0496117_0002571 | 3300048920 | Bacteria | 22586 |
| 694 | Ga0496117_0094080 | 3300048920 | Bacteria | 1920 |
| 695 | Ga0496118_0000493 | 3300048921 | Bacteria | 65468 |
| 696 | Ga0496118_0001071 | 3300048921 | Bacteria | 42731 |
| 697 | Ga0496119_0017078 | 3300048922 | Bacteria | 5485 |
| 698 | Ga0496119_0150677 | 3300048922 | Bacteria | 1247 |
| 699 | Ga0496120_0023307 | 3300048923 | Bacteria | 3877 |
| 700 | Ga0496121_0046213 | 3300048924 | Bacteria | 3729 |
| 701 | Ga0496121_0338970 | 3300048924 | Bacteria | 1005 |
| 702 | Ga0496122_0126510 | 3300048925 | Bacteria | 1634 |
| 703 | Ga0496122_0329098 | 3300048925 | Bacteria | 808 |
| 704 | Ga0496122_0330217 | 3300048925 | Bacteria | 806 |
| 705 | Ga0496123_0065252 | 3300048926 | Bacteria | 2315 |
| 706 | Ga0496123_0077610 | 3300048926 | Bacteria | 2039 |
| 707 | Ga0496124_0000889 | 3300048927 | Bacteria | 48520 |
| 708 | Ga0496124_0000996 | 3300048927 | Bacteria | 44925 |
| 709 | Ga0496124_0073812 | 3300048927 | Bacteria | 2821 |
| 710 | Ga0496124_0325858 | 3300048927 | Bacteria | 1098 |
| 711 | Ga0496125_0091212 | 3300048928 | Bacteria | 2284 |
| 712 | Ga0496126_0140950 | 3300048929 | Bacteria | 2075 |
| 713 | Ga0496126_0171090 | 3300048929 | Bacteria | 1851 |
| 714 | Ga0495678_141173 | 3300049459 | Bacteria | 788 |
| 715 | Ga0495682_0056187 | 3300049460 | Bacteria | 1427 |
| 716 | Ga0501031_0020490 | 3300049568 | Bacteria | 4311 |
| 717 | Ga0501032_0167496 | 3300049569 | Bacteria | 1441 |
| 718 | Ga0501034_0051979 | 3300049571 | Bacteria | 4130 |
| 719 | Ga0501034_0180614 | 3300049571 | Bacteria | 2075 |
| 720 | Ga0501034_0255901 | 3300049571 | Bacteria | 1695 |
| 721 | Ga0501034_1698074 | 3300049571 | Bacteria | 504 |
| 722 | Ga0501036_0021382 | 3300049572 | Bacteria | 5438 |
| 723 | Ga0501038_0275900 | 3300049574 | Bacteria | 1324 |
| 724 | Ga0501043_0074501 | 3300049579 | Bacteria | 2666 |
| 725 | Ga0501046_0248288 | 3300049580 | Bacteria | 1311 |
| 726 | Ga0501046_0567953 | 3300049580 | Bacteria | 807 |
| 727 | Ga0501047_0039638 | 3300049581 | Bacteria | 4555 |
| 728 | Ga0501047_0072301 | 3300049581 | Bacteria | 3320 |
| 729 | Ga0501048_0074744 | 3300049582 | Bacteria | 2391 |
| 730 | Ga0501070_0076252 | 3300049586 | Bacteria | 2776 |
| 731 | Ga0501224_000007 | 3300049664 | Bacteria | 127654 |
| 732 | Ga0501233_000599 | 3300049668 | Bacteria | 5875 |
| 733 | Ga0501225_0000055 | 3300049705 | Bacteria | 38821 |
| 734 | Ga0501234_000955 | 3300049707 | Bacteria | 4571 |
| 735 | Ga0501241_083320 | 3300049758 | Bacteria | 668 |
| 736 | Ga0501035_0012295 | 3300049822 | Bacteria | 7913 |
| 737 | Ga0501035_0278680 | 3300049822 | Bacteria | 1414 |
| 738 | Ga0501044_0203278 | 3300049823 | Bacteria | 1938 |
| 739 | Ga0501045_0866897 | 3300049824 | Bacteria | 664 |
| 740 | Ga0501226_000025 | 3300049853 | Bacteria | 91197 |
| 741 | nmdc:mga03683_34509_c1 | 3300050489 | Bacteria | 2047 |
| 742 | nmdc:mga04h51_117222_c1 | 3300050495 | Bacteria | 988 |
| 743 | nmdc:mga07m45_25838_c1 | 3300050496 | Bacteria | 3224 |
| 744 | nmdc:mga05p37_243419_c1 | 3300050507 | Bacteria | 2161 |
| 745 | nmdc:mga09592_922564_c1 | 3300050508 | Bacteria | 733 |
| 746 | nmdc:mga08y16_61453_c1 | 3300050511 | Bacteria | 3923 |
| 747 | nmdc:mga0sz30_65946_c1 | 3300050516 | Bacteria | 1552 |
| 748 | Ga0495612_0056875 | 3300053078 | Bacteria | 1615 |
| 749 | Ga0495619_0757630 | 3300053085 | Bacteria | 658 |
| 750 | Ga0500643_000293 | 3300053087 | Bacteria | 42902 |
| 751 | Ga0500643_000904 | 3300053087 | Bacteria | 18780 |
| 752 | Ga0500646_0385219 | 3300053090 | Bacteria | 516 |
| 753 | Ga0500647_0070056 | 3300053091 | Bacteria | 1686 |
| 754 | Ga0500651_0220937 | 3300053093 | Bacteria | 1111 |
| 755 | Ga0500566_0000285 | 3300053094 | Bacteria | 27164 |
| 756 | Ga0500555_007751 | 3300053103 | Bacteria | 3053 |
| 757 | Ga0500556_0008222 | 3300053104 | Bacteria | 3006 |
| 758 | Ga0500592_000213 | 3300053116 | Bacteria | 10649 |
| 759 | Ga0500592_031987 | 3300053116 | Bacteria | 849 |
| 760 | Ga0500594_0001763 | 3300053118 | Bacteria | 4714 |
| 761 | Ga0500595_004422 | 3300053119 | Bacteria | 6311 |
| 762 | Ga0500608_000327 | 3300053122 | Bacteria | 18285 |
| 763 | Ga0500608_033290 | 3300053122 | Bacteria | 2452 |
| 764 | Ga0500618_014525 | 3300053125 | Bacteria | 2008 |
| 765 | Ga0500618_156611 | 3300053125 | Bacteria | 520 |
| 766 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 767 | Ga0500655_012842 | 3300053133 | Bacteria | 1524 |
| 768 | Ga0500658_0000662 | 3300053134 | Bacteria | 14169 |
| 769 | Ga0500658_0033119 | 3300053134 | Bacteria | 2030 |
| 770 | Ga0500559_0003325 | 3300053136 | Bacteria | 7963 |
| 771 | Ga0500559_0007104 | 3300053136 | Bacteria | 4992 |
| 772 | Ga0500559_0035376 | 3300053136 | Bacteria | 2157 |
| 773 | Ga0500564_000959 | 3300053138 | Bacteria | 9360 |
| 774 | Ga0500568_0004150 | 3300053139 | Bacteria | 7824 |
| 775 | Ga0500573_0002298 | 3300053140 | Bacteria | 9502 |
| 776 | Ga0500573_0177095 | 3300053140 | Bacteria | 1149 |
| 777 | Ga0500573_0246625 | 3300053140 | Bacteria | 923 |
| 778 | Ga0500577_0173313 | 3300053142 | Bacteria | 923 |
| 779 | Ga0500588_0391161 | 3300053146 | Bacteria | 529 |
| 780 | Ga0500604_0140797 | 3300053151 | Bacteria | 815 |
| 781 | Ga0500622_0197561 | 3300053156 | Bacteria | 917 |
| 782 | Ga0500624_000011 | 3300053157 | Bacteria | 168125 |
| 783 | Ga0500627_0000009 | 3300053158 | Bacteria | 153203 |
| 784 | Ga0500627_0001047 | 3300053158 | Bacteria | 7536 |
| 785 | Ga0500627_0057845 | 3300053158 | Bacteria | 1701 |
| 786 | Ga0500627_0094683 | 3300053158 | Bacteria | 1338 |
| 787 | Ga0500627_0241872 | 3300053158 | Bacteria | 800 |
| 788 | Ga0500636_0040341 | 3300053177 | Bacteria | 2761 |
| 789 | Ga0500567_001496 | 3300053723 | Bacteria | 9477 |
| 790 | Ga0500611_133902 | 3300053727 | Bacteria | 670 |
| 791 | Ga0500625_000001 | 3300053729 | Bacteria | 395993 |
| 792 | Ga0500645_000064 | 3300053730 | Bacteria | 84824 |
| 793 | Ga0500645_000705 | 3300053730 | Bacteria | 20743 |
| 794 | Ga0500645_071059 | 3300053730 | Bacteria | 999 |
| 795 | Ga0500596_006952 | 3300053735 | Bacteria | 1881 |
| 796 | Ga0466962_0038732 | 3300061719 | Bacteria | 2283 |
| 797 | 2600228428 | 2599185359 | Bacteria | 4772316 |
| 798 | 2676486109 | 2675903059 | Bacteria | 8644972 |
| 799 | 2739648892 | 2739367664 | Bacteria | 4114334 |
| 800 | 2740027365 | 2739367865 | Bacteria | 4114482 |
| 801 | 2819715221 | 2818991466 | Bacteria | 4748179 |
| 802 | 2879163412 | 2879163058 | Bacteria | 4223965 |
| 803 | 2885430973 | 2885429604 | Bacteria | 3642894 |
| 804 | 2928031156 | 2928027323 | Bacteria | 4382488 |
| 805 | 2928528039 | 2928526807 | Bacteria | 4760224 |
| 806 | 2928971457 | 2928968154 | Bacteria | 4633371 |
| 807 | 2984556467 | 2984555340 | Bacteria | 4247089 |
| 808 | 2984565359 | 2984564862 | Bacteria | 4339992 |
| 809 | 2990268925 | 2990265787 | Bacteria | 3943888 |
| 810 | 2993356435 | 2993356040 | Bacteria | 4247105 |
| 811 | 2993697264 | 2993693658 | Bacteria | 4040749 |
| 812 | 8057101428 | 8057101203 | Bacteria | 5034064 |
| 813 | Ga0500595_010229 | |||
| 814 | SwRhRL2b_contig_2687397 | |||
| 815 | ARcpr5oldR_c001506 | |||
| 816 | JGI24752J21851_1001224 | |||
| 817 | JGI24740J21852_10025651 | |||
| 818 | JGI24739J22299_10000524 | |||
| 819 | JGI24739J22299_10002936 | |||
| 820 | JGI24739J22299_10013165 | |||
| 821 | JGI24737J22298_10007810 | |||
| 822 | JGI24735J21928_10003268 | |||
| 823 | JGI24735J21928_10019703 | |||
| 824 | JGI24735J21928_10109069 | |||
| 825 | JGI24748J21848_1019863 | |||
| 826 | JGI24738J21930_10003430 | |||
| 827 | JGI24738J21930_10003879 | |||
| 828 | JGI25151J46595_10088405 | |||
| 829 | JGI25165J46597_1000010 | |||
| 830 | JGI25153J46596_10006448 | |||
| 831 | Ga0055537_1000460 | |||
| 832 | Ga0055524_1000155 | |||
| 833 | Ga0055536_1003969 | |||
| 834 | Ga0055536_1006424 | |||
| 835 | Ga0055536_1015396 | |||
| 836 | Ga0055534_1019585 | |||
| 837 | Ga0055530_10000115 | |||
| 838 | Ga0055530_10001208 | |||
| 839 | Ga0055530_10008781 | |||
| 840 | Ga0055531_10000792 | |||
| 841 | Ga0055531_10002671 | |||
| 842 | Ga0055531_10006063 | |||
| 843 | Ga0055531_10006683 | |||
| 844 | Ga0065165_1007583 | |||
| 845 | Ga0065165_1018077 | |||
| 846 | Ga0065165_1041615 | |||
| 847 | Ga0065704_10074901 | |||
| 848 | Ga0065707_10081882 | |||
| 849 | Ga0070658_10000003 | |||
| 850 | Ga0070658_10021495 | |||
| 851 | Ga0070658_10030316 | |||
| 852 | Ga0070658_10033779 | |||
| 853 | Ga0070658_10054034 | |||
| 854 | Ga0070658_10166424 | |||
| 855 | Ga0070683_100559908 | |||
| 856 | Ga0070670_100000030 | |||
| 857 | Ga0070670_100746266 | |||
| 858 | Ga0070670_101154386 | |||
| 859 | Ga0070680_100025459 | |||
| 860 | Ga0070680_100034426 | |||
| 861 | Ga0070680_100104058 | |||
| 862 | Ga0070680_100837885 | |||
| 863 | Ga0070682_100579292 | |||
| 864 | Ga0068868_100565982 | |||
| 865 | Ga0070660_100057997 | |||
| 866 | Ga0070660_100059329 | |||
| 867 | Ga0070660_100088967 | |||
| 868 | Ga0070660_100107890 | |||
| 869 | Ga0070660_100397916 | |||
| 870 | Ga0070660_100408703 | |||
| 871 | Ga0070661_100139342 | |||
| 872 | Ga0070661_100267307 | |||
| 873 | Ga0070661_100585399 | |||
| 874 | Ga0070692_10000142 | |||
| 875 | Ga0070692_10159865 | |||
| 876 | Ga0070668_100000011 | |||
| 877 | Ga0070671_100003480 | |||
| 878 | Ga0070671_100093078 | |||
| 879 | Ga0070671_100671018 | |||
| 880 | Ga0070673_100015570 | |||
| 881 | Ga0070673_100828271 | |||
| 882 | Ga0070659_100003069 | |||
| 883 | Ga0070659_100021627 | |||
| 884 | Ga0070659_100090402 | |||
| 885 | Ga0070659_100157669 | |||
| 886 | Ga0070659_100202257 | |||
| 887 | Ga0070667_100000161 | |||
| 888 | Ga0070667_100383351 | |||
| 889 | Ga0070714_100263657 | |||
| 890 | Ga0070714_100556978 | |||
| 891 | Ga0070708_100141656 | |||
| 892 | Ga0070663_100003059 | |||
| 893 | Ga0070663_100044176 | |||
| 894 | Ga0070663_100050017 | |||
| 895 | Ga0070662_100016573 | |||
| 896 | Ga0070662_100065006 | |||
| 897 | Ga0070662_100121909 | |||
| 898 | Ga0070681_10029494 | |||
| 899 | Ga0070681_10072402 | |||
| 900 | Ga0070681_10105457 | |||
| 901 | Ga0070681_10172151 | |||
| 902 | Ga0070706_100028793 | |||
| 903 | Ga0070679_100077764 | |||
| 904 | Ga0070679_100095520 | |||
| 905 | Ga0070679_100173758 | |||
| 906 | Ga0070679_100191645 | |||
| 907 | Ga0070679_100332936 | |||
| 908 | Ga0070679_100340828 | |||
| 909 | Ga0070679_100650877 | |||
| 910 | Ga0070679_100651978 | |||
| 911 | Ga0070684_100329502 | |||
| 912 | Ga0068853_100012834 | |||
| 913 | Ga0068853_100054892 | |||
| 914 | Ga0068853_100067073 | |||
| 915 | Ga0068853_100072366 | |||
| 916 | Ga0068853_100220247 | |||
| 917 | Ga0068853_100247300 | |||
| 918 | Ga0068853_100642700 | |||
| 919 | Ga0068853_101379521 | |||
| 920 | Ga0070695_100075268 | |||
| 921 | Ga0070696_100021044 | |||
| 922 | Ga0070696_100461594 | |||
| 923 | Ga0070693_100148555 | |||
| 924 | Ga0070693_100198996 | |||
| 925 | Ga0070665_100044221 | |||
| 926 | Ga0070665_100291629 | |||
| 927 | Ga0070665_100359322 | |||
| 928 | Ga0070704_100316459 | |||
| 929 | Ga0068855_100048687 | |||
| 930 | Ga0068855_100051070 | |||
| 931 | Ga0068855_100129913 | |||
| 932 | Ga0068855_100189877 | |||
| 933 | Ga0068855_100289358 | |||
| 934 | Ga0068855_100302634 | |||
| 935 | Ga0068855_100315793 | |||
| 936 | Ga0068855_100454337 | |||
| 937 | Ga0068855_100619267 | |||
| 938 | Ga0070664_100107856 | |||
| 939 | Ga0070664_100183721 | |||
| 940 | Ga0070664_100853026 | |||
| 941 | Ga0070664_101305074 | |||
| 942 | Ga0068857_100041693 | |||
| 943 | Ga0068857_100094218 | |||
| 944 | Ga0068857_100142446 | |||
| 945 | Ga0068857_100276997 | |||
| 946 | Ga0068854_100000559 | |||
| 947 | Ga0068854_100026578 | |||
| 948 | Ga0068854_100039382 | |||
| 949 | Ga0068854_100055677 | |||
| 950 | Ga0068854_100417427 | |||
| 951 | Ga0068854_100527255 | |||
| 952 | Ga0068854_100764096 | |||
| 953 | Ga0068856_100027149 | |||
| 954 | Ga0068856_100052866 | |||
| 955 | Ga0068856_100072762 | |||
| 956 | Ga0068856_100115596 | |||
| 957 | Ga0068856_100427271 | |||
| 958 | Ga0068856_101210619 | |||
| 959 | Ga0068852_100032215 | |||
| 960 | Ga0068852_100047102 | |||
| 961 | Ga0068852_100048090 | |||
| 962 | Ga0068852_100058186 | |||
| 963 | Ga0068852_100073666 | |||
| 964 | Ga0068852_100814070 | |||
| 965 | Ga0068852_100922176 | |||
| 966 | Ga0068852_101108464 | |||
| 967 | Ga0068859_100032942 | |||
| 968 | Ga0068859_100213296 | |||
| 969 | Ga0068859_100481698 | |||
| 970 | Ga0068864_100000041 | |||
| 971 | Ga0068864_100018954 | |||
| 972 | Ga0068861_100772769 | |||
| 973 | Ga0068851_10021086 | |||
| 974 | Ga0068851_10022086 | |||
| 975 | Ga0068863_100000035 | |||
| 976 | Ga0068863_100000186 | |||
| 977 | Ga0068863_100593238 | |||
| 978 | Ga0068858_100000102 | |||
| 979 | Ga0068858_100001966 | |||
| 980 | Ga0068858_100309087 | |||
| 981 | Ga0068858_100575641 | |||
| 982 | Ga0068862_100000042 | |||
| 983 | Ga0068862_100312956 | |||
| 984 | Ga0081455_10000405 | |||
| 985 | Ga0075368_10116970 | |||
| 986 | Ga0075369_10165462 | |||
| 987 | Ga0097621_100285331 | |||
| 988 | Ga0068871_100005363 | |||
| 989 | Ga0068871_100682245 | |||
| 990 | Ga0075428_100050761 | |||
| 991 | Ga0075428_101653890 | |||
| 992 | Ga0075429_100424676 | |||
| 993 | Ga0097620_100032942 | |||
| 994 | Ga0097620_100213276 | |||
| 995 | Ga0097620_100481677 | |||
| 996 | Ga0105240_10008649 | |||
| 997 | Ga0105240_10022129 | |||
| 998 | Ga0105240_10186565 | |||
| 999 | Ga0105240_10699040 | |||
| 1000 | Ga0105240_10929977 | |||
| 1001 | Ga0111539_10016465 | |||
| 1002 | Ga0105245_10001046 | |||
| 1003 | Ga0105247_10038819 | |||
| 1004 | Ga0105247_10109991 | |||
| 1005 | Ga0114129_10170049 | |||
| 1006 | Ga0105243_10028129 | |||
| 1007 | Ga0105241_10194511 | |||
| 1008 | Ga0105241_10832781 | |||
| 1009 | Ga0105248_10000045 | |||
| 1010 | Ga0105248_10003638 | |||
| 1011 | Ga0105248_10028673 | |||
| 1012 | Ga0105248_10032137 | |||
| 1013 | Ga0105248_10392213 | |||
| 1014 | Ga0105237_10104546 | |||
| 1015 | Ga0105237_10181775 | |||
| 1016 | Ga0105237_10216772 | |||
| 1017 | Ga0105237_11559915 | |||
| 1018 | Ga0105238_10035938 | |||
| 1019 | Ga0105238_10036999 | |||
| 1020 | Ga0105238_10067960 | |||
| 1021 | Ga0105238_10092085 | |||
| 1022 | Ga0105238_10390045 | |||
| 1023 | Ga0105238_10402836 | |||
| 1024 | Ga0105238_10707038 | |||
| 1025 | Ga0105249_10000055 | |||
| 1026 | Ga0105249_10014831 | |||
| 1027 | Ga0105239_10089892 | |||
| 1028 | Ga0105239_12106981 | |||
| 1029 | Ga0157373_10016847 | |||
| 1030 | Ga0157373_10040258 | |||
| 1031 | Ga0157373_10075053 | |||
| 1032 | Ga0157373_10242676 | |||
| 1033 | Ga0157373_10551089 | |||
| 1034 | Ga0157371_10155848 | |||
| 1035 | Ga0157371_10172510 | |||
| 1036 | Ga0157371_10306500 | |||
| 1037 | Ga0157370_10036353 | |||
| 1038 | Ga0157370_10125312 | |||
| 1039 | Ga0157370_10131295 | |||
| 1040 | Ga0157370_10172340 | |||
| 1041 | Ga0157370_10724662 | |||
| 1042 | Ga0157369_10002615 | |||
| 1043 | Ga0157369_10070306 | |||
| 1044 | Ga0157369_10121654 | |||
| 1045 | Ga0157369_10322135 | |||
| 1046 | Ga0157374_10155077 | |||
| 1047 | Ga0157378_10037607 | |||
| 1048 | Ga0157378_10048347 | |||
| 1049 | Ga0163162_10009164 | |||
| 1050 | Ga0163162_10009790 | |||
| 1051 | Ga0163162_10010728 | |||
| 1052 | Ga0163162_10639562 | |||
| 1053 | Ga0157372_10002970 | |||
| 1054 | Ga0157372_10319859 | |||
| 1055 | Ga0157372_10655508 | |||
| 1056 | Ga0157372_10935612 | |||
| 1057 | Ga0157372_11340683 | |||
| 1058 | Ga0157372_11871339 | |||
| 1059 | Ga0157375_12321886 | |||
| 1060 | Ga0163163_10248751 | |||
| 1061 | Ga0163163_10257193 | |||
| 1062 | Ga0163163_10450992 | |||
| 1063 | Ga0157380_10007873 | |||
| 1064 | Ga0182008_10505366 | |||
| 1065 | Ga0157379_10021517 | |||
| 1066 | Ga0206356_11202361 | |||
| 1067 | Ga0206354_10168296 | |||
| 1068 | Ga0206353_12012794 | |||
| 1069 | Ga0213875_10005097 | |||
| 1070 | Ga0209437_111975 | |||
| 1071 | Ga0207425_1007250 | |||
| 1072 | Ga0209646_1015807 | |||
| 1073 | Ga0209233_1000044 | |||
| 1074 | Ga0209565_1000011 | |||
| 1075 | Ga0209455_1000772 | |||
| 1076 | Ga0209455_1025746 | |||
| 1077 | Ga0209673_1002122 | |||
| 1078 | Ga0209675_1000104 | |||
| 1079 | Ga0209675_1013492 | |||
| 1080 | Ga0209676_1000807 | |||
| 1081 | Ga0209676_1001060 | |||
| 1082 | Ga0209676_1001199 | |||
| 1083 | Ga0209676_1044912 | |||
| 1084 | Ga0209025_1006362 | |||
| 1085 | Ga0209758_1008891 | |||
| 1086 | Ga0209050_1000071 | |||
| 1087 | Ga0209050_1000286 | |||
| 1088 | Ga0209050_1002140 | |||
| 1089 | Ga0209050_1004981 | |||
| 1090 | Ga0209050_1072435 | |||
| 1091 | Ga0209256_1000016 | |||
| 1092 | Ga0209257_1000027 | |||
| 1093 | Ga0209257_1000245 | |||
| 1094 | Ga0209257_1000321 | |||
| 1095 | Ga0209257_1001354 | |||
| 1096 | Ga0209257_1001434 | |||
| 1097 | Ga0209257_1014820 | |||
| 1098 | Ga0207656_10025320 | |||
| 1099 | Ga0207656_10039366 | |||
| 1100 | Ga0207656_10066705 | |||
| 1101 | Ga0207710_10135767 | |||
| 1102 | Ga0207680_10719372 | |||
| 1103 | Ga0207647_10007714 | |||
| 1104 | Ga0207647_10024741 | |||
| 1105 | Ga0207647_10028509 | |||
| 1106 | Ga0207705_10002705 | |||
| 1107 | Ga0207705_10009941 | |||
| 1108 | Ga0207705_10026902 | |||
| 1109 | Ga0207705_10033221 | |||
| 1110 | Ga0207705_10106802 | |||
| 1111 | Ga0207705_10427571 | |||
| 1112 | Ga0207684_10421321 | |||
| 1113 | Ga0207654_10517952 | |||
| 1114 | Ga0207654_10792998 | |||
| 1115 | Ga0207707_10044083 | |||
| 1116 | Ga0207707_10149531 | |||
| 1117 | Ga0207707_10191173 | |||
| 1118 | Ga0207695_10026017 | |||
| 1119 | Ga0207695_10199135 | |||
| 1120 | Ga0207695_10660640 | |||
| 1121 | Ga0207695_11185612 | |||
| 1122 | Ga0207671_10024252 | |||
| 1123 | Ga0207671_10081045 | |||
| 1124 | Ga0207671_10088723 | |||
| 1125 | Ga0207660_10000024 | |||
| 1126 | Ga0207660_10060824 | |||
| 1127 | Ga0207660_10225842 | |||
| 1128 | Ga0207660_10447300 | |||
| 1129 | Ga0207660_10490502 | |||
| 1130 | Ga0207660_10731325 | |||
| 1131 | Ga0207657_10007988 | |||
| 1132 | Ga0207657_10010415 | |||
| 1133 | Ga0207657_10046672 | |||
| 1134 | Ga0207657_10053077 | |||
| 1135 | Ga0207657_10103276 | |||
| 1136 | Ga0207657_10109325 | |||
| 1137 | Ga0207657_10112964 | |||
| 1138 | Ga0207657_10583406 | |||
| 1139 | Ga0207657_11032159 | |||
| 1140 | Ga0207649_10059417 | |||
| 1141 | Ga0207649_10089449 | |||
| 1142 | Ga0207649_10095289 | |||
| 1143 | Ga0207649_10597774 | |||
| 1144 | Ga0207652_10073532 | |||
| 1145 | Ga0207652_10092414 | |||
| 1146 | Ga0207652_10148018 | |||
| 1147 | Ga0207652_10159255 | |||
| 1148 | Ga0207652_10293774 | |||
| 1149 | Ga0207652_10410785 | |||
| 1150 | Ga0207652_10480000 | |||
| 1151 | Ga0207652_11018435 | |||
| 1152 | Ga0207681_10190284 | |||
| 1153 | Ga0207694_10020412 | |||
| 1154 | Ga0207694_10029168 | |||
| 1155 | Ga0207694_10062555 | |||
| 1156 | Ga0207694_11336831 | |||
| 1157 | Ga0207650_10000111 | |||
| 1158 | Ga0207650_10018464 | |||
| 1159 | Ga0207687_10000562 | |||
| 1160 | Ga0207664_10066774 | |||
| 1161 | Ga0207664_10500508 | |||
| 1162 | Ga0207644_10000032 | |||
| 1163 | Ga0207644_10051599 | |||
| 1164 | Ga0207644_10102939 | |||
| 1165 | Ga0207644_10374951 | |||
| 1166 | Ga0207644_10521877 | |||
| 1167 | Ga0207644_11753146 | |||
| 1168 | Ga0207690_10018054 | |||
| 1169 | Ga0207690_10063579 | |||
| 1170 | Ga0207690_10078402 | |||
| 1171 | Ga0207690_10147247 | |||
| 1172 | Ga0207690_10182553 | |||
| 1173 | Ga0207690_10675176 | |||
| 1174 | Ga0207706_10004718 | |||
| 1175 | Ga0207706_10015487 | |||
| 1176 | Ga0207706_10067824 | |||
| 1177 | Ga0207691_10068308 | |||
| 1178 | Ga0207711_10000027 | |||
| 1179 | Ga0207711_10002908 | |||
| 1180 | Ga0207711_10012212 | |||
| 1181 | Ga0207711_10468112 | |||
| 1182 | Ga0207661_10732046 | |||
| 1183 | Ga0207679_10033400 | |||
| 1184 | Ga0207679_10228292 | |||
| 1185 | Ga0207679_11018164 | |||
| 1186 | Ga0207667_10025172 | |||
| 1187 | Ga0207667_10041234 | |||
| 1188 | Ga0207667_10053956 | |||
| 1189 | Ga0207667_10070885 | |||
| 1190 | Ga0207667_10357924 | |||
| 1191 | Ga0207667_10497892 | |||
| 1192 | Ga0207651_10171341 | |||
| 1193 | Ga0207712_10000813 | |||
| 1194 | Ga0207712_10033349 | |||
| 1195 | Ga0207668_10000034 | |||
| 1196 | Ga0207640_10000202 | |||
| 1197 | Ga0207640_10026210 | |||
| 1198 | Ga0207640_10111478 | |||
| 1199 | Ga0207640_10156959 | |||
| 1200 | Ga0207640_10879216 | |||
| 1201 | Ga0207658_10000839 | |||
| 1202 | Ga0207703_10000190 | |||
| 1203 | Ga0207703_10034927 | |||
| 1204 | Ga0207703_10282134 | |||
| 1205 | Ga0207639_10002119 | |||
| 1206 | Ga0207639_10004994 | |||
| 1207 | Ga0207639_10087630 | |||
| 1208 | Ga0207639_10094791 | |||
| 1209 | Ga0207639_10110813 | |||
| 1210 | Ga0207639_10559991 | |||
| 1211 | Ga0207639_10659466 | |||
| 1212 | Ga0207639_10846312 | |||
| 1213 | Ga0207678_10000455 | |||
| 1214 | Ga0207678_10002000 | |||
| 1215 | Ga0207678_10046585 | |||
| 1216 | Ga0207678_10092769 | |||
| 1217 | Ga0207702_10018713 | |||
| 1218 | Ga0207702_10052142 | |||
| 1219 | Ga0207702_10066422 | |||
| 1220 | Ga0207702_11621557 | |||
| 1221 | Ga0207641_10000031 | |||
| 1222 | Ga0207641_10000041 | |||
| 1223 | Ga0207641_10686291 | |||
| 1224 | Ga0207648_10357096 | |||
| 1225 | Ga0207676_10000039 | |||
| 1226 | Ga0207676_10000072 | |||
| 1227 | Ga0207674_10003053 | |||
| 1228 | Ga0207674_10005772 | |||
| 1229 | Ga0207674_10006642 | |||
| 1230 | Ga0207674_10236171 | |||
| 1231 | Ga0207683_11160850 | |||
| 1232 | Ga0207698_10025863 | |||
| 1233 | Ga0207698_10041296 | |||
| 1234 | Ga0268266_10056076 | |||
| 1235 | Ga0268266_10064839 | |||
| 1236 | Ga0268265_10000061 | |||
| 1237 | Ga0268265_10146257 | |||
| 1238 | Ga0268264_10000785 | |||
| 1239 | Ga0307517_10075608 | |||
| 1240 | Ga0307515_10325087 | |||
| 1241 | Ga0307512_10435641 | |||
| 1242 | Ga0314311_1234836 | |||
| 1243 | Ga0307513_10206273 | |||
| 1244 | Ga0307408_100058897 | |||
| 1245 | Ga0307508_10000011 | |||
| 1246 | Ga0307405_10101755 | |||
| 1247 | Ga0307405_10109097 | |||
| 1248 | Ga0307405_11004197 | |||
| 1249 | Ga0307413_10460217 | |||
| 1250 | Ga0307406_10025518 | |||
| 1251 | Ga0307406_10135661 | |||
| 1252 | Ga0307406_10189804 | |||
| 1253 | Ga0307406_10214331 | |||
| 1254 | Ga0307407_10113528 | |||
| 1255 | Ga0307412_10001328 | |||
| 1256 | Ga0307412_10002668 | |||
| 1257 | Ga0307412_10005336 | |||
| 1258 | Ga0307412_10026022 | |||
| 1259 | Ga0307412_10042785 | |||
| 1260 | Ga0307412_10095174 | |||
| 1261 | Ga0307412_11342480 | |||
| 1262 | Ga0307409_100021228 | |||
| 1263 | Ga0307409_100277372 | |||
| 1264 | Ga0307416_100032603 | |||
| 1265 | Ga0307416_100273430 | |||
| 1266 | Ga0307416_100339873 | |||
| 1267 | Ga0307414_10001684 | |||
| 1268 | Ga0307414_10001894 | |||
| 1269 | Ga0307414_10002573 | |||
| 1270 | Ga0307414_10009988 | |||
| 1271 | Ga0307414_10046896 | |||
| 1272 | Ga0307414_10115705 | |||
| 1273 | Ga0307414_10133282 | |||
| 1274 | Ga0307414_10159311 | |||
| 1275 | Ga0307414_10365512 | |||
| 1276 | Ga0307414_10393190 | |||
| 1277 | Ga0307414_11189774 | |||
| 1278 | Ga0307415_100044257 | |||
| 1279 | Ga0316583_10008044 | |||
| 1280 | Ga0307510_10066895 | |||
| 1281 | Ga0373954_0103957 | |||
| 1282 | Ga0373956_0348221 | |||
| 1283 | Ga0373955_0007600 | |||
| 1284 | Ga0373961_0391148 | |||
| 1285 | Ga0316574_0203301 | |||
| 1286 | Ga0373935_0578125 | |||
| 1287 | Ga0373933_0013243 | |||
| 1288 | Ga0373937_0047729 | |||
| 1289 | Ga0373937_0102021 | |||
| 1290 | Ga0316582_0000490 | |||
| 1291 | Ga0316582_0578966 | |||
| 1292 | Ga0316584_0167688 | |||
| 1293 | Ga0316584_0337297 | |||
| 1294 | Ga0395899_0002299 | |||
| 1295 | Ga0395899_0019311 | |||
| 1296 | Ga0395899_0037173 | |||
| 1297 | Ga0395899_0063584 | |||
| 1298 | Ga0395899_0174455 | |||
| 1299 | Ga0395899_0213365 | |||
| 1300 | Ga0395899_0256610 | |||
| 1301 | Ga0395900_0002548 | |||
| 1302 | Ga0395900_0044846 | |||
| 1303 | Ga0395900_0066250 | |||
| 1304 | Ga0395900_0096980 | |||
| 1305 | Ga0395900_0131864 | |||
| 1306 | Ga0395900_0192374 | |||
| 1307 | Ga0395900_0211241 | |||
| 1308 | Ga0395900_0245869 | |||
| 1309 | Ga0395900_0316383 | |||
| 1310 | Ga0395900_0333416 | |||
| 1311 | Ga0395900_0667608 | |||
| 1312 | Ga0395900_1286347 | |||
| 1313 | Ga0395898_0025707 | |||
| 1314 | Ga0395898_0093802 | |||
| 1315 | Ga0395898_0164557 | |||
| 1316 | Ga0395898_0233521 | |||
| 1317 | Ga0395898_0235873 | |||
| 1318 | Ga0395898_0652849 | |||
| 1319 | Ga0395905_0000409 | |||
| 1320 | Ga0395905_0007919 | |||
| 1321 | Ga0395905_0029823 | |||
| 1322 | Ga0395905_0031015 | |||
| 1323 | Ga0395905_0053376 | |||
| 1324 | Ga0395905_0057214 | |||
| 1325 | Ga0395905_0193828 | |||
| 1326 | Ga0395905_0287733 | |||
| 1327 | Ga0395905_0294247 | |||
| 1328 | Ga0395905_0310813 | |||
| 1329 | Ga0395905_0396107 | |||
| 1330 | Ga0395905_0670827 | |||
| 1331 | Ga0395905_0836201 | |||
| 1332 | Ga0436364_1172297 | |||
| 1333 | Ga0395901_0010738 | |||
| 1334 | Ga0395901_0011872 | |||
| 1335 | Ga0395901_0173259 | |||
| 1336 | Ga0395901_0271979 | |||
| 1337 | Ga0395901_0300704 | |||
| 1338 | Ga0395901_0440581 | |||
| 1339 | Ga0395901_0468286 | |||
| 1340 | Ga0395901_0521168 | |||
| 1341 | Ga0395901_1006920 | |||
| 1342 | Ga0436365_1054374 | |||
| 1343 | Ga0436365_1325832 | |||
| 1344 | Ga0439436_0003483 | |||
| 1345 | Ga0439436_0055151 | |||
| 1346 | Ga0439439_0006576 | |||
| 1347 | Ga0439447_019635 | |||
| 1348 | Ga0439461_0000178 | |||
| 1349 | Ga0439461_0014873 | |||
| 1350 | Ga0439466_0130849 | |||
| 1351 | Ga0439465_0009623 | |||
| 1352 | Ga0439465_0030423 | |||
| 1353 | Ga0451800_1680169 | |||
| 1354 | Ga0451802_0494763 | |||
| 1355 | Ga0451837_0848718 | |||
| 1356 | Ga0451841_0580323 | |||
| 1357 | Ga0439431_0000015 | |||
| 1358 | Ga0439431_0004975 | |||
| 1359 | Ga0439442_001570 | |||
| 1360 | Ga0439442_008630 | |||
| 1361 | Ga0439445_0003451 | |||
| 1362 | Ga0439445_0003697 | |||
| 1363 | Ga0439432_006574 | |||
| 1364 | Ga0439432_013379 | |||
| 1365 | Ga0439452_028811 | |||
| 1366 | Ga0439457_033383 | |||
| 1367 | Ga0439462_0010019 | |||
| 1368 | Ga0439462_0010888 | |||
| 1369 | Ga0450919_012947 | |||
| 1370 | Ga0450920_035414 | |||
| 1371 | Ga0450923_066810 | |||
| 1372 | Ga0450894_030654 | |||
| 1373 | Ga0450905_000807 | |||
| 1374 | Ga0450889_000518 | |||
| 1375 | Ga0450910_047813 | |||
| 1376 | Ga0439446_0006326 | |||
| 1377 | Ga0450908_028476 | |||
| 1378 | Ga0450909_005358 | |||
| 1379 | Ga0439434_0002354 | |||
| 1380 | Ga0439434_0005342 | |||
| 1381 | Ga0466969_0253822 | |||
| 1382 | Ga0466972_0054673 | |||
| 1383 | Ga0466972_0054969 | |||
| 1384 | Ga0466972_0096323 | |||
| 1385 | Ga0466965_0202783 | |||
| 1386 | Ga0466965_0684844 | |||
| 1387 | Ga0466966_0047420 | |||
| 1388 | Ga0466966_0490891 | |||
| 1389 | Ga0466966_0538916 | |||
| 1390 | Ga0466966_0910100 | |||
| 1391 | Ga0466961_0353616 | |||
| 1392 | Ga0466963_0062599 | |||
| 1393 | Ga0466963_0280400 | |||
| 1394 | Ga0466963_0461350 | |||
| 1395 | Ga0466971_0025809 | |||
| 1396 | Ga0466971_0040567 | |||
| 1397 | Ga0466971_0209539 | |||
| 1398 | Ga0466968_0239433 | |||
| 1399 | Ga0466957_0002469 | |||
| 1400 | Ga0466957_0060558 | |||
| 1401 | Ga0466960_0021758 | |||
| 1402 | Ga0466959_0296613 | |||
| 1403 | Ga0466958_0000506 | |||
| 1404 | Ga0466958_0240527 | |||
| 1405 | Ga0466958_0588751 | |||
| 1406 | Ga0466967_0021699 | |||
| 1407 | Ga0466967_0072671 | |||
| 1408 | Ga0466967_0118471 | |||
| 1409 | Ga0466967_0196153 | |||
| 1410 | Ga0466967_0359547 | |||
| 1411 | Ga0466967_0402299 | |||
| 1412 | Ga0466967_0449707 | |||
| 1413 | Ga0466967_1591370 | |||
| 1414 | Ga0466967_1844498 | |||
| 1415 | Ga0466967_2108633 | |||
| 1416 | Ga0466967_2218823 | |||
| 1417 | Ga0466967_2255187 | |||
| 1418 | Ga0495617_011727 | |||
| 1419 | Ga0495627_025915 | |||
| 1420 | Ga0495638_0000012 | |||
| 1421 | Ga0495638_0000207 | |||
| 1422 | Ga0495638_0059419 | |||
| 1423 | Ga0495650_0023973 | |||
| 1424 | Ga0495605_0174557 | |||
| 1425 | Ga0495585_0033580 | |||
| 1426 | Ga0495583_0000180 | |||
| 1427 | Ga0495583_0000643 | |||
| 1428 | Ga0495583_0004661 | |||
| 1429 | Ga0495606_0081466 | |||
| 1430 | Ga0495606_0455880 | |||
| 1431 | Ga0495610_0263897 | |||
| 1432 | Ga0495616_0000010 | |||
| 1433 | Ga0495632_0000248 | |||
| 1434 | Ga0495643_0039984 | |||
| 1435 | Ga0495643_0200499 | |||
| 1436 | Ga0495648_0000151 | |||
| 1437 | Ga0495648_0026719 | |||
| 1438 | Ga0495663_0107436 | |||
| 1439 | Ga0495652_0484320 | |||
| 1440 | Ga0495654_0059377 | |||
| 1441 | Ga0495654_0077322 | |||
| 1442 | Ga0495654_0077426 | |||
| 1443 | Ga0495654_0096319 | |||
| 1444 | Ga0495633_0009411 | |||
| 1445 | Ga0495668_0000004 | |||
| 1446 | Ga0495668_0002391 | |||
| 1447 | Ga0495668_0006873 | |||
| 1448 | Ga0495668_0040848 | |||
| 1449 | Ga0495668_0176176 | |||
| 1450 | Ga0495625_0001182 | |||
| 1451 | Ga0495625_0003111 | |||
| 1452 | Ga0495625_0068441 | |||
| 1453 | Ga0495625_0164006 | |||
| 1454 | Ga0495625_0320073 | |||
| 1455 | Ga0495623_0034060 | |||
| 1456 | Ga0495669_0002918 | |||
| 1457 | Ga0495669_0105850 | |||
| 1458 | Ga0495669_0211987 | |||
| 1459 | Ga0495670_0006307 | |||
| 1460 | Ga0495670_0090704 | |||
| 1461 | Ga0495670_0260499 | |||
| 1462 | Ga0495671_0000023 | |||
| 1463 | Ga0495671_0008914 | |||
| 1464 | Ga0495671_0220005 | |||
| 1465 | Ga0495687_121374 | |||
| 1466 | Ga0495677_0007182 | |||
| 1467 | Ga0495685_071854 | |||
| 1468 | Ga0495685_123399 | |||
| 1469 | Ga0495673_0000054 | |||
| 1470 | Ga0495686_0006227 | |||
| 1471 | Ga0495686_0007366 | |||
| 1472 | Ga0495686_0018195 | |||
| 1473 | Ga0495686_0084881 | |||
| 1474 | Ga0495686_0211929 | |||
| 1475 | Ga0495602_0064575 | |||
| 1476 | Ga0495626_0193598 | |||
| 1477 | Ga0496100_0648349 | |||
| 1478 | Ga0496101_0075810 | |||
| 1479 | Ga0496101_0179780 | |||
| 1480 | Ga0496101_0679483 | |||
| 1481 | Ga0496102_0000481 | |||
| 1482 | Ga0496103_0000347 | |||
| 1483 | Ga0496103_0141373 | |||
| 1484 | Ga0496103_0473379 | |||
| 1485 | Ga0496106_0077572 | |||
| 1486 | Ga0496107_0024108 | |||
| 1487 | Ga0496107_0385240 | |||
| 1488 | Ga0496108_0264936 | |||
| 1489 | Ga0496109_0027277 | |||
| 1490 | Ga0496109_0793114 | |||
| 1491 | Ga0496110_0078443 | |||
| 1492 | Ga0496110_1216993 | |||
| 1493 | Ga0496111_0003794 | |||
| 1494 | Ga0496111_0556205 | |||
| 1495 | Ga0496111_1301184 | |||
| 1496 | Ga0496112_0009881 | |||
| 1497 | Ga0496112_0084606 | |||
| 1498 | Ga0496112_1108622 | |||
| 1499 | Ga0496113_0008196 | |||
| 1500 | Ga0496113_0216587 | |||
| 1501 | Ga0496113_0508911 | |||
| 1502 | Ga0496115_0000534 | |||
| 1503 | Ga0496116_0002244 | |||
| 1504 | Ga0496117_0001149 | |||
| 1505 | Ga0496117_0002571 | |||
| 1506 | Ga0496117_0094080 | |||
| 1507 | Ga0496118_0000493 | |||
| 1508 | Ga0496118_0001071 | |||
| 1509 | Ga0496119_0017078 | |||
| 1510 | Ga0496119_0150677 | |||
| 1511 | Ga0496120_0023307 | |||
| 1512 | Ga0496121_0046213 | |||
| 1513 | Ga0496121_0338970 | |||
| 1514 | Ga0496122_0126510 | |||
| 1515 | Ga0496122_0329098 | |||
| 1516 | Ga0496122_0330217 | |||
| 1517 | Ga0496123_0065252 | |||
| 1518 | Ga0496123_0077610 | |||
| 1519 | Ga0496124_0000889 | |||
| 1520 | Ga0496124_0000996 | |||
| 1521 | Ga0496124_0073812 | |||
| 1522 | Ga0496124_0325858 | |||
| 1523 | Ga0496125_0091212 | |||
| 1524 | Ga0496126_0140950 | |||
| 1525 | Ga0496126_0171090 | |||
| 1526 | Ga0495678_141173 | |||
| 1527 | Ga0495682_0056187 | |||
| 1528 | Ga0501031_0020490 | |||
| 1529 | Ga0501032_0167496 | |||
| 1530 | Ga0501034_0051979 | |||
| 1531 | Ga0501034_0180614 | |||
| 1532 | Ga0501034_0255901 | |||
| 1533 | Ga0501034_1698074 | |||
| 1534 | Ga0501036_0021382 | |||
| 1535 | Ga0501038_0275900 | |||
| 1536 | Ga0501043_0074501 | |||
| 1537 | Ga0501046_0248288 | |||
| 1538 | Ga0501046_0567953 | |||
| 1539 | Ga0501047_0039638 | |||
| 1540 | Ga0501047_0072301 | |||
| 1541 | Ga0501048_0074744 | |||
| 1542 | Ga0501070_0076252 | |||
| 1543 | Ga0501224_000007 | |||
| 1544 | Ga0501233_000599 | |||
| 1545 | Ga0501225_0000055 | |||
| 1546 | Ga0501234_000955 | |||
| 1547 | Ga0501241_083320 | |||
| 1548 | Ga0501035_0012295 | |||
| 1549 | Ga0501035_0278680 | |||
| 1550 | Ga0501044_0203278 | |||
| 1551 | Ga0501045_0866897 | |||
| 1552 | Ga0501226_000025 | |||
| 1553 | nmdc:mga03683_34509_c1 | |||
| 1554 | nmdc:mga04h51_117222_c1 | |||
| 1555 | nmdc:mga07m45_25838_c1 | |||
| 1556 | nmdc:mga05p37_243419_c1 | |||
| 1557 | nmdc:mga09592_922564_c1 | |||
| 1558 | nmdc:mga08y16_61453_c1 | |||
| 1559 | nmdc:mga0sz30_65946_c1 | |||
| 1560 | Ga0495612_0056875 | |||
| 1561 | Ga0495619_0757630 | |||
| 1562 | Ga0500643_000293 | |||
| 1563 | Ga0500643_000904 | |||
| 1564 | Ga0500646_0385219 | |||
| 1565 | Ga0500647_0070056 | |||
| 1566 | Ga0500651_0220937 | |||
| 1567 | Ga0500566_0000285 | |||
| 1568 | Ga0500555_007751 | |||
| 1569 | Ga0500556_0008222 | |||
| 1570 | Ga0500592_000213 | |||
| 1571 | Ga0500592_031987 | |||
| 1572 | Ga0500594_0001763 | |||
| 1573 | Ga0500595_004422 | |||
| 1574 | Ga0500608_000327 | |||
| 1575 | Ga0500608_033290 | |||
| 1576 | Ga0500618_014525 | |||
| 1577 | Ga0500618_156611 | |||
| 1578 | Ga0500642_0000002 | |||
| 1579 | Ga0500655_012842 | |||
| 1580 | Ga0500658_0000662 | |||
| 1581 | Ga0500658_0033119 | |||
| 1582 | Ga0500559_0003325 | |||
| 1583 | Ga0500559_0007104 | |||
| 1584 | Ga0500559_0035376 | |||
| 1585 | Ga0500564_000959 | |||
| 1586 | Ga0500568_0004150 | |||
| 1587 | Ga0500573_0002298 | |||
| 1588 | Ga0500573_0177095 | |||
| 1589 | Ga0500573_0246625 | |||
| 1590 | Ga0500577_0173313 | |||
| 1591 | Ga0500588_0391161 | |||
| 1592 | Ga0500604_0140797 | |||
| 1593 | Ga0500622_0197561 | |||
| 1594 | Ga0500624_000011 | |||
| 1595 | Ga0500627_0000009 | |||
| 1596 | Ga0500627_0001047 | |||
| 1597 | Ga0500627_0057845 | |||
| 1598 | Ga0500627_0094683 | |||
| 1599 | Ga0500627_0241872 | |||
| 1600 | Ga0500636_0040341 | |||
| 1601 | Ga0500567_001496 | |||
| 1602 | Ga0500611_133902 | |||
| 1603 | Ga0500625_000001 | |||
| 1604 | Ga0500645_000064 | |||
| 1605 | Ga0500645_000705 | |||
| 1606 | Ga0500645_071059 | |||
| 1607 | Ga0500596_006952 | |||
| 1608 | Ga0466962_0038732 | |||
| 1609 | 2600228428 | |||
| 1610 | 2676486109 | |||
| 1611 | 2739648892 | |||
| 1612 | 2740027365 | |||
| 1613 | 2819715221 | |||
| 1614 | 2879163412 | |||
| 1615 | 2885430973 | |||
| 1616 | 2928031156 | |||
| 1617 | 2928528039 | |||
| 1618 | 2928971457 | |||
| 1619 | 2984556467 | |||
| 1620 | 2984565359 | |||
| 1621 | 2990268925 | |||
| 1622 | 2993356435 | |||
| 1623 | 2993697264 | |||
| 1624 | 8057101428 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d01-assembly1.cif.gz_K | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9751 | 3 | 154 |
| 3d01-assembly2.cif.gz_E | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9723 | 3 | 153 |
| 3d01-assembly3.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9721 | 3 | 153 |
| 3d01-assembly4.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9656 | 3 | 154 |
| 3d01-assembly1.cif.gz_I | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9634 | 3 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I058_2_156_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.977 | 3 | 153 | 3.30.1330.40 |
| 3d01E00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9633 | 3 | 153 | 3.30.1330.40 |
| af_I6YGW9_1_150_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9481 | 1 | 152 | 3.30.1330.40 |
| af_I6YGW9_1_150_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9421 | 1 | 152 | 3.30.1330.40 |
| 2otmC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.936 | 1 | 152 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3I1J2-F1-model_v4 | deleted | 0.9971 | 58 | 153 |
|
| AF-A0A4Q3AEF4-F1-model_v4 | RidA family protein | 0.9964 | 18 | 153 |
|
| AF-A0A847ZXD2-F1-model_v4 | RidA family protein | 0.9963 | 58 | 153 |
|
| AF-A0A2A4UHN9-F1-model_v4 | Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein | 0.9963 | 65 | 153 |
|
| AF-A0A6L8G997-F1-model_v4 | RidA family protein | 0.996 | 35 | 153 |
|