F481939

General Info

Members Datasets Scaffolds Average Seq Length
813 305 813 271

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10194072|Ga0207699_101940722
Length 330
Sequence MRSMTMNRFLAAFLLFAIPCLAADELDGLWKAKKKFGPDARGTLIVQRSGNAYTADMVGRILPITATNGELTFSLPGREGTFHAKGCAEYGTKVVGGVTPGKGGTTHEGWPIFNTVQDAVDKTGANATVIFVPPPFAADAIMEAADAEIDLIVCITEGIPTLDMVRAWEFLQTRRSRLIGPNCPGIISPGKCKIGIMPASIHKEGNIGIVSRSGTLTYEAVHQTTFVDALDLFNRDPETEAVIMIGEIGGTAEETAAEFIKTHMKKPVVSFIAGQTAPPGRRMGHAGAIISGGKGTAAEKIKALEAAGIKVAKSPAAIGETLAAAIGVHA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.92
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_200623 2162886011 Bacteria 1109
2 JGI24752J21851_1000626 3300001976 Bacteria 4723
3 JGI24737J22298_10010409 3300001990 Bacteria 3071
4 JGI24743J22301_10001628 3300001991 Bacteria 3180
5 JGI24749J21850_1001307 3300002076 Bacteria 3529
6 JGI24034J26672_10000790 3300002239 Bacteria 4095
7 JGI24751J29686_10001033 3300002459 Bacteria 6068
8 Ga0065712_10082087 3300005290 Bacteria 2943
9 Ga0065715_10118715 3300005293 Bacteria 2308
10 Ga0070658_10207850 3300005327 Bacteria 1653
11 Ga0070676_10014694 3300005328 Bacteria 4306
12 Ga0070683_100001214 3300005329 Bacteria 19583
13 Ga0070683_100005374 3300005329 Bacteria 10682
14 Ga0070683_100010141 3300005329 Bacteria 8087
15 Ga0070683_100059328 3300005329 Bacteria 3555
16 Ga0070690_100006108 3300005330 Bacteria 6818
17 Ga0070670_100025125 3300005331 Bacteria 5125
18 Ga0070670_100044971 3300005331 Bacteria 3795
19 Ga0068869_100001306 3300005334 Bacteria 14747
20 Ga0068869_100005208 3300005334 Bacteria 8162
21 Ga0070666_10006701 3300005335 Bacteria 7089
22 Ga0070666_10078904 3300005335 Bacteria 2248
23 Ga0070666_10423122 3300005335 Bacteria 959
24 Ga0070680_100039817 3300005336 Bacteria 3803
25 Ga0068868_100000161 3300005338 Bacteria 43698
26 Ga0068868_100017936 3300005338 Bacteria 5281
27 Ga0068868_100038382 3300005338 Bacteria 3717
28 Ga0070687_100001381 3300005343 Bacteria 8507
29 Ga0070661_100009497 3300005344 Bacteria 6738
30 Ga0070661_100012417 3300005344 Bacteria 5959
31 Ga0070661_100017342 3300005344 Bacteria 5108
32 Ga0070669_100003106 3300005353 Bacteria 11954
33 Ga0070675_100021770 3300005354 Bacteria 5121
34 Ga0070671_100028590 3300005355 Bacteria 4592
35 Ga0070671_100047488 3300005355 Bacteria 3570
36 Ga0070671_100590431 3300005355 Bacteria 959
37 Ga0070674_100007866 3300005356 Bacteria 6307
38 Ga0070673_100017012 3300005364 Bacteria 5159
39 Ga0070673_100032826 3300005364 Bacteria 3913
40 Ga0070688_100045066 3300005365 Bacteria 2723
41 Ga0070688_100173717 3300005365 Bacteria 1489
42 Ga0070659_100016747 3300005366 Bacteria 5506
43 Ga0070667_100000343 3300005367 Bacteria 52085
44 Ga0070709_10000566 3300005434 Bacteria 21596
45 Ga0070709_10007162 3300005434 Bacteria 6108
46 Ga0070709_10087946 3300005434 Bacteria 2042
47 Ga0070709_10095846 3300005434 Bacteria 1966
48 Ga0070714_100000188 3300005435 Bacteria 49788
49 Ga0070714_100044012 3300005435 Bacteria 3778
50 Ga0070714_100072720 3300005435 Bacteria 2977
51 Ga0070714_100114255 3300005435 Bacteria 2395
52 Ga0070714_100125324 3300005435 Bacteria 2289
53 Ga0070714_100519825 3300005435 Bacteria 1137
54 Ga0070713_100000319 3300005436 Bacteria 31472
55 Ga0070713_100001167 3300005436 Bacteria 16777
56 Ga0070713_100005973 3300005436 Bacteria 8375
57 Ga0070713_100006607 3300005436 Bacteria 8061
58 Ga0070713_100018741 3300005436 Bacteria 5265
59 Ga0070713_100034370 3300005436 Bacteria 4071
60 Ga0070713_100382370 3300005436 Bacteria 1312
61 Ga0070710_10011986 3300005437 Bacteria 4296
62 Ga0070710_10040214 3300005437 Bacteria 2577
63 Ga0070711_100001058 3300005439 Bacteria 14682
64 Ga0070711_100361214 3300005439 Bacteria 1170
65 Ga0070708_100000759 3300005445 Bacteria 24331
66 Ga0070708_100007253 3300005445 Bacteria 8862
67 Ga0070708_100025721 3300005445 Bacteria 5034
68 Ga0070708_100090042 3300005445 Bacteria 2792
69 Ga0070708_100155620 3300005445 Bacteria 2128
70 Ga0070663_100100919 3300005455 Bacteria 2153
71 Ga0070662_100019973 3300005457 Bacteria 4559
72 Ga0070681_10021100 3300005458 Bacteria 6526
73 Ga0068867_100121912 3300005459 Bacteria 2016
74 Ga0070685_10001186 3300005466 Bacteria 13935
75 Ga0070706_100000665 3300005467 Bacteria 39170
76 Ga0070706_100002304 3300005467 Bacteria 19295
77 Ga0070706_100023869 3300005467 Bacteria 5631
78 Ga0070706_100320686 3300005467 Bacteria 1445
79 Ga0070707_100000449 3300005468 Bacteria 40855
80 Ga0070707_100005258 3300005468 Bacteria 12115
81 Ga0070707_100096983 3300005468 Bacteria 2855
82 Ga0070698_100000007 3300005471 Bacteria 123996
83 Ga0070698_100001842 3300005471 Bacteria 23634
84 Ga0070698_100188887 3300005471 Bacteria 1998
85 Ga0070699_100009157 3300005518 Bacteria 8585
86 Ga0070699_100013744 3300005518 Bacteria 6964
87 Ga0070699_100106454 3300005518 Bacteria 2460
88 Ga0070679_100013019 3300005530 Bacteria 7966
89 Ga0070679_100085217 3300005530 Bacteria 3147
90 Ga0070679_100494216 3300005530 Bacteria 1168
91 Ga0070684_100000175 3300005535 Bacteria 44153
92 Ga0070684_100000965 3300005535 Bacteria 20493
93 Ga0070697_100001330 3300005536 Bacteria 18676
94 Ga0070697_100002365 3300005536 Bacteria 14506
95 Ga0070697_100007175 3300005536 Bacteria 8664
96 Ga0070697_100037719 3300005536 Bacteria 3903
97 Ga0068853_100000389 3300005539 Bacteria 30055
98 Ga0068853_100004157 3300005539 Bacteria 11157
99 Ga0070672_100001289 3300005543 Bacteria 15424
100 Ga0070686_100013418 3300005544 Bacteria 4692
101 Ga0070693_100104615 3300005547 Bacteria 1730
102 Ga0070693_100157013 3300005547 Bacteria 1446
103 Ga0070704_100226175 3300005549 Bacteria 1524
104 Ga0068855_100001498 3300005563 Bacteria 29248
105 Ga0068855_100002300 3300005563 Bacteria 23617
106 Ga0068855_100008944 3300005563 Bacteria 12108
107 Ga0068855_100025034 3300005563 Bacteria 7143
108 Ga0068855_100028592 3300005563 Bacteria 6670
109 Ga0068855_100029001 3300005563 Bacteria 6620
110 Ga0068855_100044544 3300005563 Bacteria 5250
111 Ga0068855_100209777 3300005563 Bacteria 2189
112 Ga0070664_100051825 3300005564 Bacteria 3475
113 Ga0070664_100066482 3300005564 Bacteria 3079
114 Ga0070664_100280186 3300005564 Bacteria 1503
115 Ga0068857_100000481 3300005577 Bacteria 28495
116 Ga0068857_100017006 3300005577 Bacteria 6371
117 Ga0068857_100025522 3300005577 Bacteria 5203
118 Ga0068854_100015244 3300005578 Bacteria 5088
119 Ga0068854_100290684 3300005578 Bacteria 1319
120 Ga0068856_100000273 3300005614 Bacteria 56215
121 Ga0068856_100000671 3300005614 Bacteria 37132
122 Ga0068856_100002276 3300005614 Bacteria 19807
123 Ga0068856_100008342 3300005614 Bacteria 10093
124 Ga0068856_100023355 3300005614 Bacteria 6012
125 Ga0068856_100137652 3300005614 Bacteria 2448
126 Ga0068856_100457535 3300005614 Bacteria 1297
127 Ga0068852_100000028 3300005616 Bacteria 113383
128 Ga0068852_100000191 3300005616 Bacteria 41609
129 Ga0068852_100008182 3300005616 Bacteria 7683
130 Ga0068852_100016117 3300005616 Bacteria 5817
131 Ga0068852_100140566 3300005616 Bacteria 2234
132 Ga0068852_100355223 3300005616 Bacteria 1432
133 Ga0068859_100002618 3300005617 Bacteria 18306
134 Ga0068859_100079897 3300005617 Bacteria 3311
135 Ga0068859_100095740 3300005617 Bacteria 3021
136 Ga0068864_100004314 3300005618 Bacteria 11692
137 Ga0068864_100007640 3300005618 Bacteria 8905
138 Ga0068866_10012028 3300005718 Bacteria 3763
139 Ga0068861_100070644 3300005719 Bacteria 2704
140 Ga0068851_10010774 3300005834 Bacteria 4273
141 Ga0068851_10032692 3300005834 Bacteria 2589
142 Ga0068851_10044734 3300005834 Bacteria 2236
143 Ga0068851_10083770 3300005834 Bacteria 1669
144 Ga0068870_10000651 3300005840 Bacteria 13238
145 Ga0068863_100000933 3300005841 Bacteria 29366
146 Ga0068863_100047570 3300005841 Bacteria 4068
147 Ga0068863_100154203 3300005841 Bacteria 2199
148 Ga0068858_100001871 3300005842 Bacteria 21477
149 Ga0068858_100002860 3300005842 Bacteria 17358
150 Ga0068858_100012399 3300005842 Bacteria 8038
151 Ga0068858_100158081 3300005842 Bacteria 2133
152 Ga0068860_100000608 3300005843 Bacteria 42634
153 Ga0068860_100105013 3300005843 Bacteria 2697
154 Ga0068860_100243484 3300005843 Bacteria 1749
155 Ga0068860_100327868 3300005843 Bacteria 1503
156 Ga0068862_100014301 3300005844 Bacteria 6583
157 Ga0081540_1084386 3300005983 Bacteria 1418
158 Ga0070717_10000586 3300006028 Bacteria 23231
159 Ga0070717_10002337 3300006028 Bacteria 13350
160 Ga0070717_10004883 3300006028 Bacteria 9757
161 Ga0070717_10005765 3300006028 Bacteria 9069
162 Ga0070717_10013549 3300006028 Bacteria 6253
163 Ga0070717_10040541 3300006028 Bacteria 3793
164 Ga0070717_10135074 3300006028 Bacteria 2123
165 Ga0070717_10220677 3300006028 Bacteria 1666
166 Ga0070717_10260243 3300006028 Bacteria 1535
167 Ga0070717_10317991 3300006028 Bacteria 1386
168 Ga0070717_10404848 3300006028 Bacteria 1226
169 Ga0070715_10021658 3300006163 Bacteria 2496
170 Ga0070715_10025595 3300006163 Bacteria 2340
171 Ga0070716_100014849 3300006173 Bacteria 3995
172 Ga0070716_100020099 3300006173 Bacteria 3501
173 Ga0070716_100034442 3300006173 Bacteria 2777
174 Ga0070716_100073589 3300006173 Bacteria 2016
175 Ga0070716_100110727 3300006173 Bacteria 1701
176 Ga0070712_100001025 3300006175 Bacteria 16857
177 Ga0070712_100014266 3300006175 Bacteria 5101
178 Ga0070712_100026939 3300006175 Bacteria 3834
179 Ga0070712_100028712 3300006175 Bacteria 3723
180 Ga0070712_100042976 3300006175 Bacteria 3109
181 Ga0070712_100333899 3300006175 Bacteria 1236
182 Ga0070712_100433903 3300006175 Bacteria 1091
183 Ga0097621_100000561 3300006237 Bacteria 26093
184 Ga0097621_100012142 3300006237 Bacteria 6374
185 Ga0097621_100027526 3300006237 Bacteria 4472
186 Ga0097621_100061653 3300006237 Bacteria 3076
187 Ga0097621_100385173 3300006237 Bacteria 1253
188 Ga0068871_100000647 3300006358 Bacteria 23964
189 Ga0068871_100201790 3300006358 Bacteria 1717
190 Ga0075428_100104384 3300006844 Bacteria 3090
191 Ga0075430_100027811 3300006846 Bacteria 4803
192 Ga0075430_100137326 3300006846 Bacteria 2036
193 Ga0075431_100036989 3300006847 Bacteria 5028
194 Ga0075431_100039845 3300006847 Bacteria 4840
195 Ga0075431_100322653 3300006847 Bacteria 1557
196 Ga0075434_100136166 3300006871 Bacteria 2475
197 Ga0075429_100539160 3300006880 Bacteria 1022
198 Ga0068865_100022464 3300006881 Bacteria 4115
199 Ga0075436_100000510 3300006914 Bacteria 25141
200 Ga0075436_100130776 3300006914 Bacteria 1760
201 Ga0075436_100346981 3300006914 Bacteria 1069
202 Ga0097620_100002618 3300006931 Bacteria 18306
203 Ga0097620_100079898 3300006931 Bacteria 3311
204 Ga0097620_100095747 3300006931 Bacteria 3021
205 Ga0099794_10000543 3300007265 Bacteria 12666
206 Ga0105240_10000735 3300009093 Bacteria 59884
207 Ga0105240_10000796 3300009093 Bacteria 57123
208 Ga0105240_10001270 3300009093 Bacteria 43667
209 Ga0105240_10005354 3300009093 Bacteria 19142
210 Ga0105240_10012404 3300009093 Bacteria 11765
211 Ga0105240_10018325 3300009093 Bacteria 9408
212 Ga0105240_10042131 3300009093 Bacteria 5821
213 Ga0105240_10043745 3300009093 Bacteria 5694
214 Ga0105240_10057253 3300009093 Bacteria 4871
215 Ga0105240_10117957 3300009093 Bacteria 3199
216 Ga0105240_10309065 3300009093 Bacteria 1806
217 Ga0105240_10309654 3300009093 Bacteria 1804
218 Ga0105245_10000204 3300009098 Bacteria 56632
219 Ga0105245_10027085 3300009098 Bacteria 5049
220 Ga0105245_10272084 3300009098 Bacteria 1652
221 Ga0105245_10350598 3300009098 Bacteria 1462
222 Ga0105247_10005566 3300009101 Bacteria 7916
223 Ga0105247_10009145 3300009101 Bacteria 6030
224 Ga0105247_10063114 3300009101 Bacteria 2299
225 Ga0105247_10199155 3300009101 Bacteria 1345
226 Ga0114129_10176610 3300009147 Bacteria 2909
227 Ga0105243_10256244 3300009148 Bacteria 1565
228 Ga0105241_10000162 3300009174 Bacteria 48662
229 Ga0105241_10000233 3300009174 Bacteria 41954
230 Ga0105241_10000311 3300009174 Bacteria 36665
231 Ga0105241_10002253 3300009174 Bacteria 14494
232 Ga0105241_10007254 3300009174 Bacteria 8160
233 Ga0105241_10023715 3300009174 Bacteria 4551
234 Ga0105241_10076855 3300009174 Bacteria 2605
235 Ga0105241_10192007 3300009174 Bacteria 1700
236 Ga0105242_10034156 3300009176 Bacteria 4077
237 Ga0105242_10047800 3300009176 Bacteria 3475
238 Ga0105248_10001505 3300009177 Bacteria 25928
239 Ga0105248_10043192 3300009177 Bacteria 5054
240 Ga0105248_10069389 3300009177 Bacteria 3957
241 Ga0105248_10083959 3300009177 Bacteria 3583
242 Ga0105237_10014468 3300009545 Bacteria 8248
243 Ga0105237_10024585 3300009545 Bacteria 6159
244 Ga0105237_10086762 3300009545 Bacteria 3120
245 Ga0105237_10147100 3300009545 Bacteria 2351
246 Ga0105237_10529851 3300009545 Bacteria 1185
247 Ga0105238_10000252 3300009551 Bacteria 59882
248 Ga0105238_10000373 3300009551 Bacteria 48142
249 Ga0105238_10005396 3300009551 Bacteria 12635
250 Ga0105238_10015341 3300009551 Bacteria 7759
251 Ga0105238_10017675 3300009551 Bacteria 7249
252 Ga0105238_10117302 3300009551 Bacteria 2642
253 Ga0105238_10190466 3300009551 Bacteria 2027
254 Ga0105238_10370892 3300009551 Bacteria 1422
255 Ga0105239_10000774 3300010375 Bacteria 45307
256 Ga0105239_10003276 3300010375 Bacteria 19965
257 Ga0105239_10004218 3300010375 Bacteria 17268
258 Ga0105239_10026022 3300010375 Bacteria 6442
259 Ga0105239_10055427 3300010375 Bacteria 4348
260 Ga0105239_10115544 3300010375 Bacteria 2977
261 Ga0105239_10337868 3300010375 Bacteria 1699
262 Ga0105246_10002780 3300011119 Bacteria 10594
263 Ga0157373_10005148 3300013100 Bacteria 9832
264 Ga0157373_10007159 3300013100 Bacteria 8321
265 Ga0157373_10238948 3300013100 Bacteria 1284
266 Ga0157373_10289812 3300013100 Bacteria 1161
267 Ga0157371_10022024 3300013102 Bacteria 4676
268 Ga0157371_10271187 3300013102 Bacteria 1225
269 Ga0157370_10000003 3300013104 Bacteria 367417
270 Ga0157369_10000767 3300013105 Bacteria 41495
271 Ga0157369_10011205 3300013105 Bacteria 10191
272 Ga0157369_10013700 3300013105 Bacteria 9167
273 Ga0157369_10016768 3300013105 Bacteria 8233
274 Ga0157369_10076109 3300013105 Bacteria 3597
275 Ga0157369_10086085 3300013105 Bacteria 3357
276 Ga0157369_10108439 3300013105 Bacteria 2953
277 Ga0157369_10137555 3300013105 Bacteria 2585
278 Ga0157369_10236047 3300013105 Bacteria 1911
279 Ga0157369_10380005 3300013105 Bacteria 1466
280 Ga0157374_10001833 3300013296 Bacteria 17893
281 Ga0157374_10019314 3300013296 Bacteria 6030
282 Ga0157374_10026827 3300013296 Bacteria 5188
283 Ga0157374_10027731 3300013296 Bacteria 5113
284 Ga0157374_10027888 3300013296 Bacteria 5098
285 Ga0157374_10053114 3300013296 Bacteria 3777
286 Ga0157374_10069959 3300013296 Bacteria 3306
287 Ga0157374_10075742 3300013296 Bacteria 3180
288 Ga0157374_10083424 3300013296 Bacteria 3036
289 Ga0157374_10098749 3300013296 Bacteria 2796
290 Ga0157374_10178394 3300013296 Bacteria 2074
291 Ga0157374_10185380 3300013296 Bacteria 2034
292 Ga0157378_10000427 3300013297 Bacteria 41173
293 Ga0157378_10001228 3300013297 Bacteria 23172
294 Ga0157378_10116931 3300013297 Bacteria 2453
295 Ga0157378_10168535 3300013297 Bacteria 2052
296 Ga0157378_10198443 3300013297 Bacteria 1897
297 Ga0163162_10015395 3300013306 Bacteria 7472
298 Ga0163162_10019591 3300013306 Bacteria 6641
299 Ga0163162_10042969 3300013306 Bacteria 4524
300 Ga0157372_10000489 3300013307 Bacteria 43671
301 Ga0157372_10002530 3300013307 Bacteria 19830
302 Ga0157372_10005787 3300013307 Bacteria 13169
303 Ga0157372_10016367 3300013307 Bacteria 7956
304 Ga0157372_10018449 3300013307 Bacteria 7500
305 Ga0157372_10021867 3300013307 Bacteria 6913
306 Ga0157372_10030681 3300013307 Bacteria 5882
307 Ga0157372_10033266 3300013307 Bacteria 5660
308 Ga0157372_10045594 3300013307 Bacteria 4865
309 Ga0157372_10063239 3300013307 Bacteria 4149
310 Ga0157372_10083559 3300013307 Bacteria 3617
311 Ga0157372_10109569 3300013307 Bacteria 3162
312 Ga0157372_10598166 3300013307 Bacteria 1286
313 Ga0157375_10180667 3300013308 Bacteria 2261
314 Ga0163163_10000356 3300014325 Bacteria 44127
315 Ga0163163_10015546 3300014325 Bacteria 7038
316 Ga0163163_10411721 3300014325 Bacteria 1411
317 Ga0182008_10002765 3300014497 Bacteria 10876
318 Ga0157377_10003673 3300014745 Bacteria 6960
319 Ga0157379_10000116 3300014968 Bacteria 55439
320 Ga0157379_10001161 3300014968 Bacteria 21462
321 Ga0157379_10117665 3300014968 Bacteria 2391
322 Ga0157376_10001779 3300014969 Bacteria 14335
323 Ga0157376_10025462 3300014969 Bacteria 4660
324 Ga0157376_10072125 3300014969 Bacteria 2937
325 Ga0157376_10086495 3300014969 Bacteria 2703
326 Ga0157376_10341203 3300014969 Bacteria 1431
327 Ga0157376_10395324 3300014969 Bacteria 1335
328 Ga0157376_10396492 3300014969 Bacteria 1333
329 Ga0163161_10001800 3300017792 Bacteria 15648
330 Ga0163161_10039515 3300017792 Bacteria 3388
331 Ga0213872_10097784 3300021361 Bacteria 1310
332 Ga0213875_10000318 3300021388 Bacteria 45734
333 Ga0224570_101846 3300022730 Bacteria 1489
334 Ga0224572_1000995 3300024225 Bacteria 3910
335 Ga0228598_1000192 3300024227 Bacteria 11121
336 Ga0228598_1007044 3300024227 Bacteria 2306
337 Ga0228598_1035688 3300024227 Bacteria 980
338 Ga0207656_10008959 3300025321 Bacteria 3707
339 Ga0207656_10017570 3300025321 Bacteria 2804
340 Ga0207656_10131912 3300025321 Bacteria 1171
341 Ga0207692_10003860 3300025898 Bacteria 5886
342 Ga0207692_10005757 3300025898 Bacteria 4986
343 Ga0207692_10009222 3300025898 Bacteria 4113
344 Ga0207642_10113057 3300025899 Bacteria 1386
345 Ga0207710_10002111 3300025900 Bacteria 9395
346 Ga0207688_10011720 3300025901 Bacteria 4769
347 Ga0207680_10003486 3300025903 Bacteria 7409
348 Ga0207680_10036670 3300025903 Bacteria 2825
349 Ga0207647_10001383 3300025904 Bacteria 18638
350 Ga0207647_10011830 3300025904 Bacteria 6099
351 Ga0207647_10161479 3300025904 Bacteria 1307
352 Ga0207685_10007635 3300025905 Bacteria 3026
353 Ga0207685_10019615 3300025905 Bacteria 2232
354 Ga0207699_10001295 3300025906 Bacteria 11891
355 Ga0207699_10005473 3300025906 Bacteria 6081
356 Ga0207699_10065337 3300025906 Bacteria 2205
357 Ga0207699_10077669 3300025906 Bacteria 2049
358 Ga0207699_10194072 3300025906 Bacteria 1372
359 Ga0207645_10000998 3300025907 Bacteria 23374
360 Ga0207645_10025211 3300025907 Bacteria 3849
361 Ga0207643_10000240 3300025908 Bacteria 38064
362 Ga0207705_10035217 3300025909 Bacteria 3581
363 Ga0207705_10070132 3300025909 Bacteria 2539
364 Ga0207684_10000283 3300025910 Bacteria 73904
365 Ga0207684_10000414 3300025910 Bacteria 57184
366 Ga0207684_10022136 3300025910 Bacteria 5428
367 Ga0207684_10235082 3300025910 Bacteria 1581
368 Ga0207654_10000074 3300025911 Bacteria 66092
369 Ga0207654_10000138 3300025911 Bacteria 46993
370 Ga0207654_10000199 3300025911 Bacteria 37066
371 Ga0207654_10052928 3300025911 Bacteria 2341
372 Ga0207654_10075649 3300025911 Bacteria 2013
373 Ga0207654_10140016 3300025911 Bacteria 1542
374 Ga0207707_10056074 3300025912 Bacteria 3427
375 Ga0207695_10000119 3300025913 Bacteria 235221
376 Ga0207695_10000598 3300025913 Bacteria 72240
377 Ga0207695_10001003 3300025913 Bacteria 49974
378 Ga0207695_10001155 3300025913 Bacteria 45756
379 Ga0207695_10007106 3300025913 Bacteria 14343
380 Ga0207695_10011787 3300025913 Bacteria 10552
381 Ga0207695_10029888 3300025913 Bacteria 6010
382 Ga0207695_10035407 3300025913 Bacteria 5413
383 Ga0207695_10038357 3300025913 Bacteria 5159
384 Ga0207695_10046245 3300025913 Bacteria 4614
385 Ga0207671_10000047 3300025914 Bacteria 196307
386 Ga0207671_10000238 3300025914 Bacteria 82806
387 Ga0207671_10319364 3300025914 Bacteria 1229
388 Ga0207693_10000054 3300025915 Bacteria 96633
389 Ga0207693_10000446 3300025915 Bacteria 37811
390 Ga0207693_10028475 3300025915 Bacteria 4414
391 Ga0207693_10040240 3300025915 Bacteria 3682
392 Ga0207693_10041737 3300025915 Bacteria 3611
393 Ga0207693_10115188 3300025915 Bacteria 2110
394 Ga0207693_10146351 3300025915 Bacteria 1858
395 Ga0207693_10231850 3300025915 Bacteria 1450
396 Ga0207693_10258439 3300025915 Bacteria 1366
397 Ga0207663_10003834 3300025916 Bacteria 7423
398 Ga0207663_10164691 3300025916 Bacteria 1569
399 Ga0207660_10041118 3300025917 Bacteria 3239
400 Ga0207660_10113785 3300025917 Bacteria 2040
401 Ga0207662_10003083 3300025918 Bacteria 8507
402 Ga0207657_10000662 3300025919 Bacteria 36691
403 Ga0207649_10001853 3300025920 Bacteria 12081
404 Ga0207649_10005019 3300025920 Bacteria 7156
405 Ga0207649_10007573 3300025920 Bacteria 5902
406 Ga0207649_10061578 3300025920 Bacteria 2363
407 Ga0207652_10010342 3300025921 Bacteria 7515
408 Ga0207652_10458649 3300025921 Bacteria 1149
409 Ga0207646_10000433 3300025922 Bacteria 55881
410 Ga0207646_10001325 3300025922 Bacteria 30725
411 Ga0207694_10000089 3300025924 Bacteria 103520
412 Ga0207694_10000198 3300025924 Bacteria 60251
413 Ga0207694_10001686 3300025924 Bacteria 18506
414 Ga0207694_10024425 3300025924 Bacteria 4591
415 Ga0207694_10085417 3300025924 Bacteria 2484
416 Ga0207650_10000227 3300025925 Bacteria 63337
417 Ga0207650_10003537 3300025925 Bacteria 10718
418 Ga0207650_10036901 3300025925 Bacteria 3558
419 Ga0207659_10010402 3300025926 Bacteria 5847
420 Ga0207687_10001108 3300025927 Bacteria 18304
421 Ga0207687_10100885 3300025927 Bacteria 2124
422 Ga0207700_10000252 3300025928 Bacteria 32074
423 Ga0207700_10000595 3300025928 Bacteria 21091
424 Ga0207700_10002236 3300025928 Bacteria 11113
425 Ga0207700_10004990 3300025928 Bacteria 7889
426 Ga0207700_10112658 3300025928 Bacteria 2192
427 Ga0207700_10127933 3300025928 Bacteria 2069
428 Ga0207700_10312090 3300025928 Bacteria 1360
429 Ga0207700_10327516 3300025928 Bacteria 1329
430 Ga0207664_10000370 3300025929 Bacteria 32851
431 Ga0207664_10034020 3300025929 Bacteria 3922
432 Ga0207664_10048391 3300025929 Bacteria 3343
433 Ga0207664_10089474 3300025929 Bacteria 2521
434 Ga0207664_10363143 3300025929 Bacteria 1283
435 Ga0207664_10495941 3300025929 Bacteria 1093
436 Ga0207644_10018965 3300025931 Bacteria 4663
437 Ga0207706_10000417 3300025933 Bacteria 45607
438 Ga0207686_10033518 3300025934 Bacteria 3067
439 Ga0207709_10269114 3300025935 Bacteria 1253
440 Ga0207670_10048769 3300025936 Bacteria 2828
441 Ga0207670_10168836 3300025936 Bacteria 1639
442 Ga0207704_10135592 3300025938 Bacteria 1713
443 Ga0207665_10003611 3300025939 Bacteria 10333
444 Ga0207665_10004041 3300025939 Bacteria 9790
445 Ga0207665_10009355 3300025939 Bacteria 6432
446 Ga0207665_10030851 3300025939 Bacteria 3545
447 Ga0207665_10047410 3300025939 Bacteria 2881
448 Ga0207665_10141023 3300025939 Bacteria 1718
449 Ga0207691_10000567 3300025940 Bacteria 37008
450 Ga0207711_10021999 3300025941 Bacteria 5328
451 Ga0207711_10048431 3300025941 Bacteria 3636
452 Ga0207711_10050096 3300025941 Bacteria 3575
453 Ga0207711_10446308 3300025941 Bacteria 1204
454 Ga0207689_10001207 3300025942 Bacteria 24845
455 Ga0207689_10001404 3300025942 Bacteria 22986
456 Ga0207689_10003086 3300025942 Bacteria 15333
457 Ga0207689_10018555 3300025942 Bacteria 5868
458 Ga0207661_10000111 3300025944 Bacteria 51639
459 Ga0207661_10002956 3300025944 Bacteria 11756
460 Ga0207661_10036751 3300025944 Bacteria 3826
461 Ga0207661_10040830 3300025944 Bacteria 3650
462 Ga0207661_10213502 3300025944 Bacteria 1702
463 Ga0207661_10391758 3300025944 Bacteria 1259
464 Ga0207679_10000198 3300025945 Bacteria 48302
465 Ga0207679_10037214 3300025945 Bacteria 3457
466 Ga0207679_10107727 3300025945 Bacteria 2193
467 Ga0207667_10001777 3300025949 Bacteria 27129
468 Ga0207667_10005872 3300025949 Bacteria 14951
469 Ga0207667_10005917 3300025949 Bacteria 14896
470 Ga0207667_10006597 3300025949 Bacteria 14030
471 Ga0207667_10215369 3300025949 Bacteria 1968
472 Ga0207651_10013389 3300025960 Bacteria 4692
473 Ga0207651_10239640 3300025960 Bacteria 1477
474 Ga0207668_10045392 3300025972 Bacteria 2996
475 Ga0207640_10018632 3300025981 Bacteria 4083
476 Ga0207640_10358697 3300025981 Bacteria 1174
477 Ga0207658_10000076 3300025986 Bacteria 108585
478 Ga0207658_10024923 3300025986 Bacteria 4185
479 Ga0207677_10000266 3300026023 Bacteria 39403
480 Ga0207677_10005105 3300026023 Bacteria 7100
481 Ga0207677_10007468 3300026023 Bacteria 6051
482 Ga0207677_10086733 3300026023 Bacteria 2264
483 Ga0207677_10148269 3300026023 Bacteria 1806
484 Ga0207703_10003789 3300026035 Bacteria 12567
485 Ga0207703_10007757 3300026035 Bacteria 8495
486 Ga0207703_10019811 3300026035 Bacteria 5258
487 Ga0207703_10114546 3300026035 Bacteria 2306
488 Ga0207639_10000103 3300026041 Bacteria 70103
489 Ga0207639_10038742 3300026041 Bacteria 3547
490 Ga0207639_10497813 3300026041 Bacteria 1113
491 Ga0207678_10000406 3300026067 Bacteria 39002
492 Ga0207702_10000476 3300026078 Bacteria 45021
493 Ga0207702_10000796 3300026078 Bacteria 33448
494 Ga0207702_10001203 3300026078 Bacteria 26280
495 Ga0207702_10057989 3300026078 Bacteria 3293
496 Ga0207702_10111601 3300026078 Bacteria 2432
497 Ga0207702_10177979 3300026078 Bacteria 1956
498 Ga0207702_10365566 3300026078 Bacteria 1384
499 Ga0207702_10457678 3300026078 Bacteria 1239
500 Ga0207641_10000052 3300026088 Bacteria 173672
501 Ga0207641_10001520 3300026088 Bacteria 22714
502 Ga0207641_10136507 3300026088 Bacteria 2208
503 Ga0207641_10154788 3300026088 Bacteria 2079
504 Ga0207648_10000537 3300026089 Bacteria 42285
505 Ga0207648_10022570 3300026089 Bacteria 5650
506 Ga0207648_10096969 3300026089 Bacteria 2581
507 Ga0207676_10000510 3300026095 Bacteria 32695
508 Ga0207676_10001275 3300026095 Bacteria 18737
509 Ga0207674_10000803 3300026116 Bacteria 40828
510 Ga0207674_10001096 3300026116 Bacteria 35173
511 Ga0207674_10010198 3300026116 Bacteria 10671
512 Ga0207674_10345745 3300026116 Bacteria 1438
513 Ga0207675_100038371 3300026118 Bacteria 4470
514 Ga0207683_10016077 3300026121 Bacteria 6368
515 Ga0207683_10030280 3300026121 Bacteria 4689
516 Ga0207698_10000384 3300026142 Bacteria 25551
517 Ga0207698_10001437 3300026142 Bacteria 13838
518 Ga0207698_10012340 3300026142 Bacteria 5588
519 Ga0207698_10127457 3300026142 Bacteria 2168
520 Ga0207698_10581939 3300026142 Bacteria 1101
521 Ga0209588_1000300 3300027671 Bacteria 12976
522 Ga0265354_1000701 3300028016 Bacteria 5553
523 Ga0268266_10002099 3300028379 Bacteria 22042
524 Ga0268266_10492987 3300028379 Bacteria 1169
525 Ga0268265_10053545 3300028380 Bacteria 3058
526 Ga0268265_10630798 3300028380 Bacteria 1028
527 Ga0268264_10000622 3300028381 Bacteria 42137
528 Ga0268264_10015512 3300028381 Bacteria 6246
529 Ga0265318_10022341 3300028577 Bacteria 2531
530 Ga0265336_10040130 3300028666 Bacteria 1434
531 Ga0265338_10002471 3300028800 Bacteria 27614
532 Ga0265338_10024192 3300028800 Bacteria 6214
533 Ga0265338_10030309 3300028800 Bacteria 5333
534 Ga0265338_10057232 3300028800 Bacteria 3450
535 Ga0265338_10062708 3300028800 Bacteria 3247
536 Ga0265338_10130257 3300028800 Bacteria 1988
537 Ga0265338_10145411 3300028800 Bacteria 1850
538 Ga0265338_10428329 3300028800 Bacteria 939
539 Ga0265762_1000488 3300030760 Bacteria 6889
540 Ga0265770_1000602 3300030878 Bacteria 4976
541 Ga0265770_1002322 3300030878 Bacteria 2589
542 Ga0265770_1012904 3300030878 Bacteria 1243
543 Ga0265765_1001244 3300030879 Bacteria 2315
544 Ga0265765_1012374 3300030879 Bacteria 966
545 Ga0265760_10000004 3300031090 Bacteria 149429
546 Ga0265760_10003176 3300031090 Bacteria 4807
547 Ga0265760_10003551 3300031090 Bacteria 4523
548 Ga0265760_10018254 3300031090 Bacteria 2018
549 Ga0265760_10054174 3300031090 Bacteria 1211
550 Ga0265330_10016502 3300031235 Bacteria 3405
551 Ga0265330_10051726 3300031235 Bacteria 1800
552 Ga0265330_10071971 3300031235 Bacteria 1496
553 Ga0265330_10106875 3300031235 Bacteria 1196
554 Ga0265328_10013480 3300031239 Bacteria 3234
555 Ga0265320_10014282 3300031240 Bacteria 4527
556 Ga0265325_10001002 3300031241 Bacteria 20321
557 Ga0265325_10011355 3300031241 Bacteria 5118
558 Ga0265325_10063396 3300031241 Bacteria 1870
559 Ga0265325_10095057 3300031241 Bacteria 1465
560 Ga0265329_10026170 3300031242 Bacteria 1925
561 Ga0265340_10013477 3300031247 Bacteria 4293
562 Ga0265340_10077823 3300031247 Bacteria 1564
563 Ga0265339_10000026 3300031249 Bacteria 165764
564 Ga0265339_10006499 3300031249 Bacteria 7662
565 Ga0265339_10020456 3300031249 Bacteria 3866
566 Ga0265339_10049454 3300031249 Bacteria 2302
567 Ga0265331_10055339 3300031250 Bacteria 1887
568 Ga0265331_10161555 3300031250 Bacteria 1015
569 Ga0265316_10007137 3300031344 Bacteria 10562
570 Ga0265316_10023164 3300031344 Bacteria 5221
571 Ga0265316_10042856 3300031344 Bacteria 3613
572 Ga0265316_10056146 3300031344 Bacteria 3078
573 Ga0265316_10068614 3300031344 Bacteria 2738
574 Ga0265316_10077223 3300031344 Bacteria 2557
575 Ga0265316_10144565 3300031344 Bacteria 1784
576 Ga0265316_10238546 3300031344 Bacteria 1337
577 Ga0265313_10004027 3300031595 Bacteria 11483
578 Ga0265313_10017181 3300031595 Bacteria 4122
579 Ga0265314_10000027 3300031711 Bacteria 278331
580 Ga0265314_10001129 3300031711 Bacteria 30906
581 Ga0265342_10001088 3300031712 Bacteria 26276
582 Ga0265342_10003716 3300031712 Bacteria 12371
583 Ga0265342_10010070 3300031712 Bacteria 6593
584 Ga0265342_10014725 3300031712 Bacteria 5181
585 Ga0265342_10116157 3300031712 Bacteria 1510
586 Ga0265342_10122531 3300031712 Bacteria 1463
587 Ga0265342_10247958 3300031712 Bacteria 951
588 Ga0307410_10026419 3300031852 Bacteria 3655
589 Ga0307410_10055566 3300031852 Bacteria 2688
590 Ga0307406_10109943 3300031901 Bacteria 1896
591 Ga0307406_10196916 3300031901 Bacteria 1480
592 Ga0307412_10038414 3300031911 Bacteria 3083
593 Ga0307409_100003218 3300031995 Bacteria 8794
594 Ga0307409_100190214 3300031995 Bacteria 1826
595 Ga0307416_100156518 3300032002 Bacteria 2099
596 Ga0307414_10036710 3300032004 Bacteria 3275
597 Ga0307415_100093447 3300032126 Bacteria 2184
598 Ga0316212_1006505 3300033547 Bacteria 1692
599 Ga0373926_0006926 3300035083 Bacteria 3768
600 Ga0373934_0000404 3300035086 Bacteria 15111
601 Ga0373944_0036806 3300035089 Bacteria 1497
602 Ga0373923_0003069 3300035111 Bacteria 5287
603 Ga0373923_0049425 3300035111 Bacteria 1759
604 Ga0373936_0002785 3300035113 Bacteria 6517
605 Ga0373936_0003142 3300035113 Bacteria 6181
606 Ga0373945_0001964 3300035116 Bacteria 6379
607 Ga0373954_0000224 3300035118 Bacteria 20728
608 Ga0373956_0001105 3300035119 Bacteria 11121
609 Ga0373957_0032284 3300035120 Bacteria 1927
610 Ga0373957_0039100 3300035120 Bacteria 1778
611 Ga0373960_0002247 3300035121 Bacteria 4346
612 Ga0373943_0001585 3300035170 Bacteria 10297
613 Ga0373943_0014755 3300035170 Bacteria 3543
614 Ga0373943_0076764 3300035170 Bacteria 1705
615 Ga0373943_0194782 3300035170 Bacteria 1119
616 Ga0373946_0011405 3300035171 Bacteria 3316
617 Ga0373955_0000521 3300035172 Bacteria 16367
618 Ga0373955_0023790 3300035172 Bacteria 3125
619 Ga0373955_0040947 3300035172 Bacteria 2481
620 Ga0373924_0008466 3300035410 Bacteria 3741
621 Ga0373924_0063975 3300035410 Bacteria 1543
622 Ga0373931_0014910 3300035691 Bacteria 3808
623 Ga0373931_0062918 3300035691 Bacteria 2004
624 Ga0373935_0010715 3300035692 Bacteria 5506
625 Ga0373935_0010969 3300035692 Bacteria 5442
626 Ga0373935_0020173 3300035692 Bacteria 4069
627 Ga0373935_0095867 3300035692 Bacteria 1949
628 Ga0373927_0000705 3300035695 Bacteria 25605
629 Ga0373927_0016272 3300035695 Bacteria 4908
630 Ga0373927_0099070 3300035695 Bacteria 1895
631 Ga0373927_0103647 3300035695 Bacteria 1851
632 Ga0373927_0159178 3300035695 Bacteria 1479
633 Ga0373927_0377675 3300035695 Bacteria 934
634 Ga0373933_0001196 3300035724 Bacteria 15359
635 Ga0373947_0000098 3300035725 Bacteria 44133
636 Ga0373947_0001211 3300035725 Bacteria 15877
637 Ga0373947_0007307 3300035725 Bacteria 6397
638 Ga0373947_0207103 3300035725 Bacteria 1285
639 Ga0373937_0006834 3300036401 Bacteria 9844
640 Ga0373937_0022927 3300036401 Bacteria 5614
641 Ga0373937_0076583 3300036401 Bacteria 3089
642 Ga0373937_0118008 3300036401 Bacteria 2471
643 Ga0373937_0245157 3300036401 Bacteria 1689
644 Ga0373937_0371883 3300036401 Bacteria 1355
645 Ga0373937_0520630 3300036401 Bacteria 1130
646 Ga0373937_0710474 3300036401 Bacteria 952
647 Ga0373925_0002146 3300037068 Bacteria 16118
648 Ga0373925_0002505 3300037068 Bacteria 14678
649 Ga0373925_0008716 3300037068 Bacteria 7388
650 Ga0373925_0015235 3300037068 Bacteria 5559
651 Ga0373925_0070341 3300037068 Bacteria 2645
652 Ga0373925_0155499 3300037068 Bacteria 1798
653 Ga0395905_0019672 3300037471 Bacteria 6399
654 Ga0395905_0047114 3300037471 Bacteria 4042
655 Ga0395905_0069760 3300037471 Bacteria 3292
656 Ga0395905_0090202 3300037471 Bacteria 2873
657 Ga0395905_0381212 3300037471 Bacteria 1304
658 Ga0436364_0595239 3300037853 Bacteria 105667
659 Ga0436360_0017782 3300039438 Bacteria 5268
660 Ga0436361_0063152 3300039447 Bacteria 16055
661 Ga0436361_0684605 3300039447 Bacteria 16884
662 Ga0436363_0563853 3300039450 Bacteria 3393
663 Ga0451577_0371796 3300042876 Bacteria 1297
664 Ga0451577_0394681 3300042876 Bacteria 1256
665 Ga0466963_0061959 3300044694 Bacteria 2502
666 Ga0451576_0192585 3300045051 Bacteria 2130
667 Ga0466967_0026088 3300045976 Bacteria 4833
668 Ga0466967_0062269 3300045976 Bacteria 3311
669 Ga0495592_0004618 3300046454 Bacteria 10086
670 Ga0495629_0029703 3300046459 Bacteria 3876
671 Ga0495651_0001722 3300046462 Bacteria 16879
672 Ga0495651_0006546 3300046462 Bacteria 8896
673 Ga0495651_0057396 3300046462 Bacteria 2989
674 Ga0495653_0025724 3300046463 Bacteria 4722
675 Ga0495653_0120492 3300046463 Bacteria 1871
676 Ga0495653_0184859 3300046463 Bacteria 1427
677 Ga0495580_0000007 3300046472 Bacteria 103420
678 Ga0495580_0000616 3300046472 Bacteria 30136
679 Ga0495580_0001673 3300046472 Bacteria 19470
680 Ga0495580_0005636 3300046472 Bacteria 10300
681 Ga0495580_0005942 3300046472 Bacteria 10013
682 Ga0495580_0054936 3300046472 Bacteria 2808
683 Ga0495580_0077068 3300046472 Bacteria 2325
684 Ga0495582_0000596 3300046473 Bacteria 19949
685 Ga0495582_0028246 3300046473 Bacteria 3078
686 Ga0495664_0280043 3300046477 Bacteria 1008
687 Ga0495608_0017454 3300046511 Bacteria 4964
688 Ga0495608_0024797 3300046511 Bacteria 4098
689 Ga0495628_0000986 3300046516 Bacteria 26034
690 Ga0495628_0012015 3300046516 Bacteria 7304
691 Ga0495628_0194153 3300046516 Bacteria 1532
692 Ga0495628_0372698 3300046516 Bacteria 1047
693 Ga0495630_0004524 3300046517 Bacteria 9743
694 Ga0495630_0019124 3300046517 Bacteria 5034
695 Ga0495630_0049307 3300046517 Bacteria 3152
696 Ga0495630_0066967 3300046517 Bacteria 2700
697 Ga0495630_0137018 3300046517 Bacteria 1860
698 Ga0495630_0215039 3300046517 Bacteria 1467
699 Ga0495652_0005269 3300046529 Bacteria 12200
700 Ga0495652_0178033 3300046529 Bacteria 1635
701 Ga0495665_0009559 3300046531 Bacteria 5253
702 Ga0495640_0160338 3300046533 Bacteria 1442
703 Ga0495640_0229867 3300046533 Bacteria 1167
704 Ga0495586_0062141 3300046535 Bacteria 2033
705 Ga0495586_0110116 3300046535 Bacteria 1532
706 Ga0495587_0002546 3300046536 Bacteria 12190
707 Ga0495587_0004017 3300046536 Bacteria 9749
708 Ga0495645_0004522 3300046543 Bacteria 9493
709 Ga0495667_0008035 3300046559 Bacteria 7158
710 Ga0495667_0011423 3300046559 Bacteria 6009
711 Ga0495667_0019669 3300046559 Bacteria 4555
712 Ga0495634_0040225 3300046642 Bacteria 3181
713 Ga0495634_0304811 3300046642 Bacteria 962
714 Ga0495625_0096041 3300046660 Bacteria 2042
715 Ga0495635_0054021 3300046663 Bacteria 2767
716 Ga0495657_0124534 3300046675 Bacteria 1620
717 Ga0495599_0015185 3300046678 Bacteria 4776
718 Ga0495599_0298485 3300046678 Bacteria 973
719 Ga0495623_0004319 3300046679 Bacteria 9354
720 Ga0495623_0026906 3300046679 Bacteria 3701
721 Ga0495623_0063746 3300046679 Bacteria 2307
722 Ga0495646_0182180 3300046680 Bacteria 1152
723 Ga0495600_0001209 3300046809 Bacteria 14159
724 Ga0495600_0114690 3300046809 Bacteria 1754
725 Ga0495581_0044528 3300047315 Bacteria 2566
726 Ga0495604_0000910 3300047317 Bacteria 24583
727 Ga0495604_0001439 3300047317 Bacteria 19540
728 Ga0495604_0096793 3300047317 Bacteria 2177
729 Ga0495674_0005521 3300047319 Bacteria 12132
730 Ga0495674_0010450 3300047319 Bacteria 8788
731 Ga0495674_0011051 3300047319 Bacteria 8525
732 Ga0495674_0028291 3300047319 Bacteria 5114
733 Ga0495674_0108374 3300047319 Bacteria 2357
734 Ga0495674_0125797 3300047319 Bacteria 2163
735 Ga0495680_0004430 3300047322 Bacteria 13421
736 Ga0495680_0005530 3300047322 Bacteria 11861
737 Ga0495680_0013756 3300047322 Bacteria 7042
738 Ga0495675_0000586 3300047444 Bacteria 23418
739 Ga0495675_0066528 3300047444 Bacteria 2278
740 Ga0495684_0000891 3300047471 Bacteria 24204
741 Ga0495684_0002088 3300047471 Bacteria 16070
742 Ga0495684_0042674 3300047471 Bacteria 3473
743 Ga0495602_0021671 3300048088 Bacteria 6316
744 Ga0495602_0054057 3300048088 Bacteria 3549
745 Ga0495602_0055423 3300048088 Bacteria 3491
746 Ga0495602_0135472 3300048088 Bacteria 1957
747 Ga0495602_0210783 3300048088 Bacteria 1475
748 Ga0495602_0321004 3300048088 Bacteria 1127
749 Ga0496100_0010694 3300048903 Bacteria 5204
750 Ga0496100_0028214 3300048903 Bacteria 3461
751 Ga0496100_0136980 3300048903 Bacteria 1731
752 Ga0496101_0054727 3300048904 Bacteria 2881
753 Ga0496101_0085054 3300048904 Bacteria 2343
754 Ga0496102_0023540 3300048905 Bacteria 5472
755 Ga0496102_0041679 3300048905 Bacteria 4159
756 Ga0496102_0122189 3300048905 Bacteria 2433
757 Ga0496103_0004099 3300048906 Bacteria 8856
758 Ga0496104_0002935 3300048907 Bacteria 14692
759 Ga0496104_0022237 3300048907 Bacteria 5823
760 Ga0496104_0027472 3300048907 Bacteria 5266
761 Ga0496104_0088978 3300048907 Bacteria 2950
762 Ga0496104_0530688 3300048907 Bacteria 1088
763 Ga0496105_0025158 3300048908 Bacteria 4843
764 Ga0496105_0150797 3300048908 Bacteria 1911
765 Ga0496106_0056476 3300048909 Bacteria 2967
766 Ga0496107_0020293 3300048910 Bacteria 4692
767 Ga0496107_0051391 3300048910 Bacteria 2973
768 Ga0496107_0301290 3300048910 Bacteria 1193
769 Ga0496108_0001842 3300048911 Bacteria 16943
770 Ga0496108_0160302 3300048911 Bacteria 1944
771 Ga0496109_0000178 3300048912 Bacteria 63365
772 Ga0496110_0001986 3300048913 Bacteria 15204
773 Ga0496110_0399971 3300048913 Bacteria 1252
774 Ga0496111_0005461 3300048914 Bacteria 8148
775 Ga0496112_0000068 3300048915 Bacteria 68390
776 Ga0496112_0010744 3300048915 Bacteria 8325
777 Ga0496112_0022198 3300048915 Bacteria 6049
778 Ga0496112_0024389 3300048915 Bacteria 5790
779 Ga0496112_0040934 3300048915 Bacteria 4532
780 Ga0496112_0292122 3300048915 Bacteria 1576
781 Ga0496112_0719641 3300048915 Bacteria 925
782 Ga0496113_0003902 3300048916 Bacteria 9036
783 Ga0496114_0037963 3300048917 Bacteria 3984
784 Ga0496114_0215583 3300048917 Bacteria 1684
785 Ga0496114_0327437 3300048917 Bacteria 1354
786 Ga0496115_0007191 3300048918 Bacteria 8179
787 Ga0496115_0034019 3300048918 Bacteria 4027
788 Ga0496115_0063161 3300048918 Bacteria 2987
789 Ga0496126_0001003 3300048929 Bacteria 48082
790 Ga0496126_0003062 3300048929 Bacteria 21661
791 Ga0496126_0111699 3300048929 Bacteria 2380
792 Ga0501036_0062117 3300049572 Bacteria 3164
793 Ga0501038_0163667 3300049574 Bacteria 1806
794 Ga0501039_0022894 3300049575 Bacteria 4793
795 Ga0501048_0123646 3300049582 Bacteria 1829
796 Ga0501071_0290700 3300049587 Bacteria 1238
797 Ga0501075_0072217 3300049591 Bacteria 2609
798 Ga0501079_0090591 3300049741 Bacteria 2369
799 Ga0501081_0021619 3300049743 Bacteria 4294
800 Ga0501045_0325196 3300049824 Bacteria 1144
801 nmdc:mga05p37_168803_c1 3300050507 Bacteria 2669
802 nmdc:mga09592_69077_c1 3300050508 Bacteria 2997
803 nmdc:mga0qj67_2331_c1 3300050509 Bacteria 13498
804 nmdc:mga06r32_111777_c1 3300050510 Bacteria 2689
805 nmdc:mga0n895_910_c1 3300050512 Bacteria 21318
806 nmdc:mga0rr50_143436_c1 3300050513 Bacteria 1923
807 nmdc:mga0rr50_2425_c2 3300050513 Bacteria 8267
808 nmdc:mga0rr50_68603_c1 3300050513 Bacteria 2697
809 nmdc:mga08x19_1302_c1 3300050514 Bacteria 15495
810 nmdc:mga08x19_151853_c1 3300050514 Bacteria 1569
811 Ga0495601_0146043 3300053077 Bacteria 1544
812 Ga0495619_0052150 3300053085 Bacteria 2704
813 Ga0530510_0074219 3300061734 Bacteria 2469

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10000318 Ga0213875_100003189 259
2 3300037853 Ga0436364_0595239 Ga0436364_0595239_8150_9025 259
3 3300031090 Ga0265760_10000004 Ga0265760_1000000493 264
4 3300006028 Ga0070717_10002337 Ga0070717_100023377 265
5 3300005549 Ga0070704_100226175 Ga0070704_1002261752 266
6 3300028380 Ga0268265_10630798 Ga0268265_106307981 266
7 3300005547 Ga0070693_100104615 Ga0070693_1001046153 267
8 3300006163 Ga0070715_10025595 Ga0070715_100255951 267
9 3300006237 Ga0097621_100385173 Ga0097621_1003851732 267
10 3300009093 Ga0105240_10309065 Ga0105240_103090652 267
11 3300013297 Ga0157378_10168535 Ga0157378_101685352 267
12 3300025915 Ga0207693_10040240 Ga0207693_100402402 267
13 3300025939 Ga0207665_10141023 Ga0207665_101410233 267
14 3300028016 Ga0265354_1000701 Ga0265354_10007016 267
15 3300030878 Ga0265770_1000602 Ga0265770_10006026 267
16 3300030878 Ga0265770_1002322 Ga0265770_10023223 267
17 3300030879 Ga0265765_1001244 Ga0265765_10012442 267
18 3300030879 Ga0265765_1012374 Ga0265765_10123741 267
19 3300031090 Ga0265760_10003176 Ga0265760_100031765 267
20 3300031090 Ga0265760_10003551 Ga0265760_100035512 267
21 3300035086 Ga0373934_0000404 Ga0373934_0000404_11902_12771 267
22 3300035118 Ga0373954_0000224 Ga0373954_0000224_7565_8434 267
23 3300035119 Ga0373956_0001105 Ga0373956_0001105_8385_9254 267
24 3300035120 Ga0373957_0039100 Ga0373957_0039100_510_1379 267
25 3300035172 Ga0373955_0000521 Ga0373955_0000521_5973_6842 267
26 3300035724 Ga0373933_0001196 Ga0373933_0001196_6846_7715 267
27 3300036401 Ga0373937_0076583 Ga0373937_0076583_2125_2994 267
28 3300046462 Ga0495651_0057396 Ga0495651_0057396_1920_2789 267
29 3300046463 Ga0495653_0120492 Ga0495653_0120492_178_1047 267
30 3300046517 Ga0495630_0019124 Ga0495630_0019124_751_1620 267
31 3300046533 Ga0495640_0229867 Ga0495640_0229867_135_1004 267
32 3300046535 Ga0495586_0062141 Ga0495586_0062141_923_1792 267
33 3300046536 Ga0495587_0002546 Ga0495587_0002546_9281_10150 267
34 3300046679 Ga0495623_0004319 Ga0495623_0004319_1701_2570 267
35 3300047317 Ga0495604_0000910 Ga0495604_0000910_13644_14513 267
36 3300047471 Ga0495684_0042674 Ga0495684_0042674_2509_3378 267
37 3300048088 Ga0495602_0055423 Ga0495602_0055423_2547_3416 267
38 3300048915 Ga0496112_0040934 Ga0496112_0040934_1111_1980 267
39 3300049824 Ga0501045_0325196 Ga0501045_0325196_159_1028 267
40 3300050513 nmdc:mga0rr50_143436_c1 nmdc:mga0rr50_143436_c1_187_1059 267
41 3300005327 Ga0070658_10207850 Ga0070658_102078502 268
42 3300005329 Ga0070683_100001214 Ga0070683_1000012143 268
43 3300005329 Ga0070683_100010141 Ga0070683_1000101416 268
44 3300005329 Ga0070683_100059328 Ga0070683_1000593284 268
45 3300005331 Ga0070670_100025125 Ga0070670_1000251253 268
46 3300005334 Ga0068869_100001306 Ga0068869_1000013065 268
47 3300005335 Ga0070666_10006701 Ga0070666_100067014 268
48 3300005335 Ga0070666_10078904 Ga0070666_100789042 268
49 3300005338 Ga0068868_100000161 Ga0068868_10000016117 268
50 3300005338 Ga0068868_100017936 Ga0068868_1000179363 268
51 3300005344 Ga0070661_100012417 Ga0070661_1000124176 268
52 3300005344 Ga0070661_100017342 Ga0070661_1000173422 268
53 3300005355 Ga0070671_100028590 Ga0070671_1000285903 268
54 3300005355 Ga0070671_100047488 Ga0070671_1000474882 268
55 3300005364 Ga0070673_100032826 Ga0070673_1000328262 268
56 3300005367 Ga0070667_100000343 Ga0070667_10000034326 268
57 3300005436 Ga0070713_100005973 Ga0070713_1000059733 268
58 3300005535 Ga0070684_100000175 Ga0070684_10000017521 268
59 3300005539 Ga0068853_100000389 Ga0068853_10000038926 268
60 3300005563 Ga0068855_100001498 Ga0068855_10000149818 268
61 3300005563 Ga0068855_100002300 Ga0068855_10000230020 268
62 3300005563 Ga0068855_100028592 Ga0068855_1000285922 268
63 3300005563 Ga0068855_100044544 Ga0068855_1000445443 268
64 3300005564 Ga0070664_100051825 Ga0070664_1000518253 268
65 3300005564 Ga0070664_100066482 Ga0070664_1000664822 268
66 3300005577 Ga0068857_100000481 Ga0068857_10000048114 268
67 3300005578 Ga0068854_100290684 Ga0068854_1002906842 268
68 3300005614 Ga0068856_100000671 Ga0068856_10000067116 268
69 3300005614 Ga0068856_100002276 Ga0068856_10000227614 268
70 3300005616 Ga0068852_100000028 Ga0068852_10000002885 268
71 3300005616 Ga0068852_100000191 Ga0068852_1000001912 268
72 3300005616 Ga0068852_100016117 Ga0068852_1000161172 268
73 3300005616 Ga0068852_100140566 Ga0068852_1001405662 268
74 3300005617 Ga0068859_100095740 Ga0068859_1000957401 268
75 3300005618 Ga0068864_100004314 Ga0068864_1000043148 268
76 3300005834 Ga0068851_10010774 Ga0068851_100107743 268
77 3300005834 Ga0068851_10032692 Ga0068851_100326923 268
78 3300005834 Ga0068851_10044734 Ga0068851_100447342 268
79 3300005834 Ga0068851_10083770 Ga0068851_100837702 268
80 3300005841 Ga0068863_100000933 Ga0068863_10000093312 268
81 3300005842 Ga0068858_100001871 Ga0068858_10000187119 268
82 3300005842 Ga0068858_100012399 Ga0068858_1000123993 268
83 3300005843 Ga0068860_100000608 Ga0068860_10000060821 268
84 3300006173 Ga0070716_100034442 Ga0070716_1000344422 268
85 3300006175 Ga0070712_100333899 Ga0070712_1003338991 268
86 3300006237 Ga0097621_100000561 Ga0097621_10000056116 268
87 3300006237 Ga0097621_100012142 Ga0097621_1000121424 268
88 3300006358 Ga0068871_100000647 Ga0068871_10000064710 268
89 3300006844 Ga0075428_100104384 Ga0075428_1001043843 268
90 3300006846 Ga0075430_100027811 Ga0075430_1000278116 268
91 3300006847 Ga0075431_100039845 Ga0075431_1000398453 268
92 3300006847 Ga0075431_100322653 Ga0075431_1003226531 268
93 3300006880 Ga0075429_100539160 Ga0075429_1005391601 268
94 3300006931 Ga0097620_100095747 Ga0097620_1000957471 268
95 3300007265 Ga0099794_10000543 Ga0099794_100005435 268
96 3300009093 Ga0105240_10000735 Ga0105240_1000073520 268
97 3300009093 Ga0105240_10000796 Ga0105240_1000079617 268
98 3300009093 Ga0105240_10001270 Ga0105240_100012704 268
99 3300009093 Ga0105240_10005354 Ga0105240_100053547 268
100 3300009093 Ga0105240_10018325 Ga0105240_100183255 268
101 3300009093 Ga0105240_10043745 Ga0105240_100437452 268
102 3300009093 Ga0105240_10057253 Ga0105240_100572533 268
103 3300009098 Ga0105245_10000204 Ga0105245_1000020418 268
104 3300009098 Ga0105245_10027085 Ga0105245_100270852 268
105 3300009101 Ga0105247_10009145 Ga0105247_100091451 268
106 3300009147 Ga0114129_10176610 Ga0114129_101766104 268
107 3300009174 Ga0105241_10000162 Ga0105241_1000016233 268
108 3300009174 Ga0105241_10000233 Ga0105241_1000023328 268
109 3300009174 Ga0105241_10076855 Ga0105241_100768552 268
110 3300009177 Ga0105248_10001505 Ga0105248_1000150514 268
111 3300009177 Ga0105248_10069389 Ga0105248_100693892 268
112 3300009545 Ga0105237_10014468 Ga0105237_100144681 268
113 3300009545 Ga0105237_10529851 Ga0105237_105298512 268
114 3300009551 Ga0105238_10000252 Ga0105238_1000025220 268
115 3300009551 Ga0105238_10000373 Ga0105238_1000037319 268
116 3300009551 Ga0105238_10005396 Ga0105238_100053967 268
117 3300009551 Ga0105238_10015341 Ga0105238_100153413 268
118 3300009551 Ga0105238_10117302 Ga0105238_101173022 268
119 3300010375 Ga0105239_10000774 Ga0105239_1000077428 268
120 3300010375 Ga0105239_10003276 Ga0105239_1000327616 268
121 3300010375 Ga0105239_10055427 Ga0105239_100554272 268
122 3300010375 Ga0105239_10115544 Ga0105239_101155444 268
123 3300010375 Ga0105239_10337868 Ga0105239_103378682 268
124 3300013100 Ga0157373_10289812 Ga0157373_102898122 268
125 3300013104 Ga0157370_10000003 Ga0157370_1000000363 268
126 3300013105 Ga0157369_10000767 Ga0157369_100007672 268
127 3300013105 Ga0157369_10011205 Ga0157369_1001120510 268
128 3300013105 Ga0157369_10016768 Ga0157369_100167685 268
129 3300013105 Ga0157369_10076109 Ga0157369_100761092 268
130 3300013296 Ga0157374_10001833 Ga0157374_1000183313 268
131 3300013296 Ga0157374_10019314 Ga0157374_100193141 268
132 3300013296 Ga0157374_10027731 Ga0157374_100277314 268
133 3300013296 Ga0157374_10075742 Ga0157374_100757422 268
134 3300013296 Ga0157374_10098749 Ga0157374_100987491 268
135 3300013297 Ga0157378_10000427 Ga0157378_1000042724 268
136 3300013297 Ga0157378_10198443 Ga0157378_101984432 268
137 3300013306 Ga0163162_10042969 Ga0163162_100429695 268
138 3300013307 Ga0157372_10000489 Ga0157372_1000048934 268
139 3300013307 Ga0157372_10002530 Ga0157372_1000253015 268
140 3300013307 Ga0157372_10005787 Ga0157372_100057876 268
141 3300013307 Ga0157372_10033266 Ga0157372_100332661 268
142 3300013307 Ga0157372_10109569 Ga0157372_101095692 268
143 3300013307 Ga0157372_10598166 Ga0157372_105981661 268
144 3300013308 Ga0157375_10180667 Ga0157375_101806672 268
145 3300014325 Ga0163163_10000356 Ga0163163_1000035624 268
146 3300014968 Ga0157379_10001161 Ga0157379_1000116116 268
147 3300014969 Ga0157376_10001779 Ga0157376_100017797 268
148 3300014969 Ga0157376_10395324 Ga0157376_103953242 268
149 3300017792 Ga0163161_10039515 Ga0163161_100395152 268
150 3300024227 Ga0228598_1007044 Ga0228598_10070444 268
151 3300025321 Ga0207656_10008959 Ga0207656_100089591 268
152 3300025321 Ga0207656_10017570 Ga0207656_100175702 268
153 3300025321 Ga0207656_10131912 Ga0207656_101319121 268
154 3300025900 Ga0207710_10002111 Ga0207710_100021117 268
155 3300025903 Ga0207680_10036670 Ga0207680_100366701 268
156 3300025907 Ga0207645_10025211 Ga0207645_100252112 268
157 3300025911 Ga0207654_10000138 Ga0207654_1000013835 268
158 3300025911 Ga0207654_10000199 Ga0207654_1000019917 268
159 3300025911 Ga0207654_10075649 Ga0207654_100756493 268
160 3300025913 Ga0207695_10000119 Ga0207695_10000119108 268
161 3300025913 Ga0207695_10000598 Ga0207695_1000059836 268
162 3300025913 Ga0207695_10001003 Ga0207695_100010035 268
163 3300025913 Ga0207695_10001155 Ga0207695_1000115519 268
164 3300025913 Ga0207695_10011787 Ga0207695_100117877 268
165 3300025913 Ga0207695_10029888 Ga0207695_100298884 268
166 3300025913 Ga0207695_10035407 Ga0207695_100354072 268
167 3300025913 Ga0207695_10038357 Ga0207695_100383575 268
168 3300025914 Ga0207671_10000047 Ga0207671_1000004761 268
169 3300025914 Ga0207671_10000238 Ga0207671_1000023829 268
170 3300025920 Ga0207649_10001853 Ga0207649_100018538 268
171 3300025920 Ga0207649_10007573 Ga0207649_100075732 268
172 3300025920 Ga0207649_10061578 Ga0207649_100615782 268
173 3300025924 Ga0207694_10000089 Ga0207694_1000008965 268
174 3300025924 Ga0207694_10000198 Ga0207694_1000019839 268
175 3300025924 Ga0207694_10001686 Ga0207694_100016864 268
176 3300025925 Ga0207650_10003537 Ga0207650_100035377 268
177 3300025927 Ga0207687_10001108 Ga0207687_1000110810 268
178 3300025927 Ga0207687_10100885 Ga0207687_101008852 268
179 3300025928 Ga0207700_10002236 Ga0207700_100022364 268
180 3300025931 Ga0207644_10018965 Ga0207644_100189655 268
181 3300025941 Ga0207711_10021999 Ga0207711_100219992 268
182 3300025941 Ga0207711_10048431 Ga0207711_100484314 268
183 3300025942 Ga0207689_10003086 Ga0207689_100030866 268
184 3300025942 Ga0207689_10018555 Ga0207689_100185554 268
185 3300025944 Ga0207661_10000111 Ga0207661_1000011136 268
186 3300025944 Ga0207661_10036751 Ga0207661_100367512 268
187 3300025944 Ga0207661_10040830 Ga0207661_100408302 268
188 3300025944 Ga0207661_10213502 Ga0207661_102135022 268
189 3300025945 Ga0207679_10037214 Ga0207679_100372142 268
190 3300025945 Ga0207679_10107727 Ga0207679_101077272 268
191 3300025949 Ga0207667_10001777 Ga0207667_100017775 268
192 3300025949 Ga0207667_10005872 Ga0207667_100058726 268
193 3300025949 Ga0207667_10006597 Ga0207667_100065976 268
194 3300025960 Ga0207651_10239640 Ga0207651_102396402 268
195 3300025981 Ga0207640_10358697 Ga0207640_103586972 268
196 3300025986 Ga0207658_10000076 Ga0207658_1000007658 268
197 3300026023 Ga0207677_10000266 Ga0207677_1000026632 268
198 3300026035 Ga0207703_10003789 Ga0207703_100037897 268
199 3300026035 Ga0207703_10114546 Ga0207703_101145462 268
200 3300026041 Ga0207639_10000103 Ga0207639_1000010362 268
201 3300026041 Ga0207639_10038742 Ga0207639_100387422 268
202 3300026041 Ga0207639_10497813 Ga0207639_104978131 268
203 3300026078 Ga0207702_10000476 Ga0207702_1000047629 268
204 3300026078 Ga0207702_10001203 Ga0207702_1000120320 268
205 3300026078 Ga0207702_10177979 Ga0207702_101779792 268
206 3300026078 Ga0207702_10457678 Ga0207702_104576782 268
207 3300026088 Ga0207641_10001520 Ga0207641_1000152013 268
208 3300026089 Ga0207648_10096969 Ga0207648_100969692 268
209 3300026095 Ga0207676_10000510 Ga0207676_100005107 268
210 3300026116 Ga0207674_10001096 Ga0207674_1000109612 268
211 3300026116 Ga0207674_10345745 Ga0207674_103457452 268
212 3300026121 Ga0207683_10016077 Ga0207683_100160773 268
213 3300026142 Ga0207698_10000384 Ga0207698_1000038412 268
214 3300026142 Ga0207698_10001437 Ga0207698_100014378 268
215 3300026142 Ga0207698_10012340 Ga0207698_100123406 268
216 3300026142 Ga0207698_10127457 Ga0207698_101274571 268
217 3300027671 Ga0209588_1000300 Ga0209588_10003005 268
218 3300028381 Ga0268264_10000622 Ga0268264_1000062221 268
219 3300028800 Ga0265338_10062708 Ga0265338_100627082 268
220 3300031090 Ga0265760_10018254 Ga0265760_100182543 268
221 3300031235 Ga0265330_10016502 Ga0265330_100165022 268
222 3300031249 Ga0265339_10006499 Ga0265339_100064996 268
223 3300031344 Ga0265316_10023164 Ga0265316_100231646 268
224 3300031712 Ga0265342_10010070 Ga0265342_100100708 268
225 3300031852 Ga0307410_10055566 Ga0307410_100555662 268
226 3300031901 Ga0307406_10196916 Ga0307406_101969161 268
227 3300031995 Ga0307409_100190214 Ga0307409_1001902142 268
228 3300036401 Ga0373937_0371883 Ga0373937_0371883_261_1133 268
229 3300037471 Ga0395905_0019672 Ga0395905_0019672_1219_2109 268
230 3300037471 Ga0395905_0047114 Ga0395905_0047114_2576_3466 268
231 3300037471 Ga0395905_0069760 Ga0395905_0069760_1627_2517 268
232 3300046454 Ga0495592_0004618 Ga0495592_0004618_2913_3785 268
233 3300046462 Ga0495651_0001722 Ga0495651_0001722_4027_4899 268
234 3300046462 Ga0495651_0006546 Ga0495651_0006546_2811_3683 268
235 3300046463 Ga0495653_0025724 Ga0495653_0025724_2529_3401 268
236 3300046463 Ga0495653_0184859 Ga0495653_0184859_227_1099 268
237 3300046477 Ga0495664_0280043 Ga0495664_0280043_81_953 268
238 3300046511 Ga0495608_0017454 Ga0495608_0017454_774_1646 268
239 3300046511 Ga0495608_0024797 Ga0495608_0024797_2537_3409 268
240 3300046516 Ga0495628_0000986 Ga0495628_0000986_18960_19832 268
241 3300046516 Ga0495628_0012015 Ga0495628_0012015_4265_5137 268
242 3300046517 Ga0495630_0004524 Ga0495630_0004524_414_1286 268
243 3300046517 Ga0495630_0049307 Ga0495630_0049307_1910_2782 268
244 3300046517 Ga0495630_0215039 Ga0495630_0215039_551_1423 268
245 3300046529 Ga0495652_0005269 Ga0495652_0005269_328_1200 268
246 3300046529 Ga0495652_0178033 Ga0495652_0178033_253_1125 268
247 3300046536 Ga0495587_0004017 Ga0495587_0004017_5303_6175 268
248 3300046543 Ga0495645_0004522 Ga0495645_0004522_5042_5914 268
249 3300046559 Ga0495667_0008035 Ga0495667_0008035_5103_5975 268
250 3300046559 Ga0495667_0011423 Ga0495667_0011423_3839_4711 268
251 3300046559 Ga0495667_0019669 Ga0495667_0019669_754_1626 268
252 3300046663 Ga0495635_0054021 Ga0495635_0054021_1283_2155 268
253 3300046675 Ga0495657_0124534 Ga0495657_0124534_671_1543 268
254 3300046678 Ga0495599_0015185 Ga0495599_0015185_3098_3970 268
255 3300046678 Ga0495599_0298485 Ga0495599_0298485_25_897 268
256 3300046679 Ga0495623_0063746 Ga0495623_0063746_788_1660 268
257 3300046680 Ga0495646_0182180 Ga0495646_0182180_59_931 268
258 3300046809 Ga0495600_0001209 Ga0495600_0001209_9734_10606 268
259 3300046809 Ga0495600_0114690 Ga0495600_0114690_170_1042 268
260 3300047317 Ga0495604_0001439 Ga0495604_0001439_3607_4479 268
261 3300047317 Ga0495604_0096793 Ga0495604_0096793_180_1052 268
262 3300047319 Ga0495674_0005521 Ga0495674_0005521_2666_3538 268
263 3300047322 Ga0495680_0004430 Ga0495680_0004430_3421_4293 268
264 3300047322 Ga0495680_0005530 Ga0495680_0005530_7143_8015 268
265 3300047444 Ga0495675_0000586 Ga0495675_0000586_18949_19821 268
266 3300047471 Ga0495684_0000891 Ga0495684_0000891_13015_13887 268
267 3300047471 Ga0495684_0002088 Ga0495684_0002088_11614_12486 268
268 3300048088 Ga0495602_0021671 Ga0495602_0021671_3885_4757 268
269 3300048088 Ga0495602_0210783 Ga0495602_0210783_264_1136 268
270 3300048929 Ga0496126_0001003 Ga0496126_0001003_41218_42090 268
271 3300048929 Ga0496126_0111699 Ga0496126_0111699_222_1094 268
272 3300049572 Ga0501036_0062117 Ga0501036_0062117_1343_2215 268
273 3300049574 Ga0501038_0163667 Ga0501038_0163667_26_898 268
274 3300049575 Ga0501039_0022894 Ga0501039_0022894_1559_2431 268
275 3300049582 Ga0501048_0123646 Ga0501048_0123646_299_1171 268
276 3300049587 Ga0501071_0290700 Ga0501071_0290700_40_912 268
277 3300049591 Ga0501075_0072217 Ga0501075_0072217_1366_2238 268
278 3300049741 Ga0501079_0090591 Ga0501079_0090591_213_1085 268
279 3300049743 Ga0501081_0021619 Ga0501081_0021619_504_1376 268
280 3300050507 nmdc:mga05p37_168803_c1 nmdc:mga05p37_168803_c1_167_1039 268
281 3300050508 nmdc:mga09592_69077_c1 nmdc:mga09592_69077_c1_1032_1904 268
282 3300050509 nmdc:mga0qj67_2331_c1 nmdc:mga0qj67_2331_c1_3352_4224 268
283 3300050510 nmdc:mga06r32_111777_c1 nmdc:mga06r32_111777_c1_1331_2203 268
284 3300053077 Ga0495601_0146043 Ga0495601_0146043_290_1162 268
285 3300061734 Ga0530510_0074219 Ga0530510_0074219_1444_2316 268
286 3300001976 JGI24752J21851_1000626 JGI24752J21851_10006262 269
287 3300001990 JGI24737J22298_10010409 JGI24737J22298_100104095 269
288 3300001991 JGI24743J22301_10001628 JGI24743J22301_100016281 269
289 3300002076 JGI24749J21850_1001307 JGI24749J21850_10013072 269
290 3300002239 JGI24034J26672_10000790 JGI24034J26672_100007902 269
291 3300002459 JGI24751J29686_10001033 JGI24751J29686_100010337 269
292 3300005328 Ga0070676_10014694 Ga0070676_100146941 269
293 3300005329 Ga0070683_100005374 Ga0070683_1000053743 269
294 3300005330 Ga0070690_100006108 Ga0070690_1000061088 269
295 3300005331 Ga0070670_100044971 Ga0070670_1000449713 269
296 3300005334 Ga0068869_100005208 Ga0068869_1000052083 269
297 3300005335 Ga0070666_10423122 Ga0070666_104231221 269
298 3300005336 Ga0070680_100039817 Ga0070680_1000398173 269
299 3300005338 Ga0068868_100038382 Ga0068868_1000383822 269
300 3300005343 Ga0070687_100001381 Ga0070687_1000013817 269
301 3300005344 Ga0070661_100009497 Ga0070661_1000094972 269
302 3300005353 Ga0070669_100003106 Ga0070669_1000031062 269
303 3300005354 Ga0070675_100021770 Ga0070675_1000217702 269
304 3300005355 Ga0070671_100590431 Ga0070671_1005904311 269
305 3300005356 Ga0070674_100007866 Ga0070674_1000078663 269
306 3300005364 Ga0070673_100017012 Ga0070673_1000170127 269
307 3300005365 Ga0070688_100045066 Ga0070688_1000450662 269
308 3300005365 Ga0070688_100173717 Ga0070688_1001737172 269
309 3300005366 Ga0070659_100016747 Ga0070659_1000167477 269
310 3300005434 Ga0070709_10000566 Ga0070709_1000056613 269
311 3300005434 Ga0070709_10007162 Ga0070709_100071624 269
312 3300005434 Ga0070709_10087946 Ga0070709_100879464 269
313 3300005434 Ga0070709_10095846 Ga0070709_100958462 269
314 3300005435 Ga0070714_100000188 Ga0070714_10000018832 269
315 3300005435 Ga0070714_100044012 Ga0070714_1000440125 269
316 3300005435 Ga0070714_100072720 Ga0070714_1000727204 269
317 3300005435 Ga0070714_100114255 Ga0070714_1001142552 269
318 3300005435 Ga0070714_100125324 Ga0070714_1001253244 269
319 3300005435 Ga0070714_100519825 Ga0070714_1005198251 269
320 3300005436 Ga0070713_100000319 Ga0070713_1000003197 269
321 3300005436 Ga0070713_100001167 Ga0070713_10000116717 269
322 3300005436 Ga0070713_100006607 Ga0070713_1000066075 269
323 3300005436 Ga0070713_100018741 Ga0070713_1000187418 269
324 3300005436 Ga0070713_100034370 Ga0070713_1000343704 269
325 3300005436 Ga0070713_100382370 Ga0070713_1003823702 269
326 3300005437 Ga0070710_10011986 Ga0070710_100119865 269
327 3300005437 Ga0070710_10040214 Ga0070710_100402142 269
328 3300005439 Ga0070711_100001058 Ga0070711_10000105812 269
329 3300005439 Ga0070711_100361214 Ga0070711_1003612141 269
330 3300005445 Ga0070708_100000759 Ga0070708_1000007598 269
331 3300005445 Ga0070708_100007253 Ga0070708_1000072537 269
332 3300005445 Ga0070708_100025721 Ga0070708_1000257212 269
333 3300005445 Ga0070708_100090042 Ga0070708_1000900422 269
334 3300005445 Ga0070708_100155620 Ga0070708_1001556202 269
335 3300005455 Ga0070663_100100919 Ga0070663_1001009192 269
336 3300005457 Ga0070662_100019973 Ga0070662_1000199731 269
337 3300005458 Ga0070681_10021100 Ga0070681_100211008 269
338 3300005459 Ga0068867_100121912 Ga0068867_1001219122 269
339 3300005466 Ga0070685_10001186 Ga0070685_100011862 269
340 3300005467 Ga0070706_100000665 Ga0070706_1000006658 269
341 3300005467 Ga0070706_100002304 Ga0070706_1000023046 269
342 3300005467 Ga0070706_100023869 Ga0070706_1000238695 269
343 3300005467 Ga0070706_100320686 Ga0070706_1003206862 269
344 3300005468 Ga0070707_100000449 Ga0070707_10000044922 269
345 3300005468 Ga0070707_100005258 Ga0070707_10000525810 269
346 3300005468 Ga0070707_100096983 Ga0070707_1000969832 269
347 3300005471 Ga0070698_100000007 Ga0070698_10000000724 269
348 3300005471 Ga0070698_100001842 Ga0070698_10000184218 269
349 3300005471 Ga0070698_100188887 Ga0070698_1001888872 269
350 3300005518 Ga0070699_100009157 Ga0070699_1000091575 269
351 3300005518 Ga0070699_100013744 Ga0070699_1000137445 269
352 3300005518 Ga0070699_100106454 Ga0070699_1001064542 269
353 3300005530 Ga0070679_100013019 Ga0070679_1000130192 269
354 3300005530 Ga0070679_100085217 Ga0070679_1000852174 269
355 3300005530 Ga0070679_100494216 Ga0070679_1004942161 269
356 3300005535 Ga0070684_100000965 Ga0070684_10000096518 269
357 3300005536 Ga0070697_100001330 Ga0070697_10000133013 269
358 3300005536 Ga0070697_100002365 Ga0070697_1000023657 269
359 3300005536 Ga0070697_100007175 Ga0070697_1000071755 269
360 3300005536 Ga0070697_100037719 Ga0070697_1000377193 269
361 3300005539 Ga0068853_100004157 Ga0068853_10000415710 269
362 3300005543 Ga0070672_100001289 Ga0070672_1000012892 269
363 3300005544 Ga0070686_100013418 Ga0070686_1000134183 269
364 3300005547 Ga0070693_100157013 Ga0070693_1001570132 269
365 3300005563 Ga0068855_100008944 Ga0068855_1000089449 269
366 3300005563 Ga0068855_100025034 Ga0068855_1000250347 269
367 3300005563 Ga0068855_100029001 Ga0068855_1000290013 269
368 3300005563 Ga0068855_100209777 Ga0068855_1002097773 269
369 3300005564 Ga0070664_100280186 Ga0070664_1002801862 269
370 3300005577 Ga0068857_100017006 Ga0068857_1000170064 269
371 3300005577 Ga0068857_100025522 Ga0068857_1000255223 269
372 3300005578 Ga0068854_100015244 Ga0068854_1000152443 269
373 3300005614 Ga0068856_100000273 Ga0068856_10000027363 269
374 3300005614 Ga0068856_100008342 Ga0068856_1000083424 269
375 3300005614 Ga0068856_100023355 Ga0068856_1000233552 269
376 3300005614 Ga0068856_100137652 Ga0068856_1001376522 269
377 3300005614 Ga0068856_100457535 Ga0068856_1004575351 269
378 3300005616 Ga0068852_100008182 Ga0068852_1000081826 269
379 3300005616 Ga0068852_100355223 Ga0068852_1003552231 269
380 3300005617 Ga0068859_100002618 Ga0068859_1000026182 269
381 3300005617 Ga0068859_100079897 Ga0068859_1000798973 269
382 3300005618 Ga0068864_100007640 Ga0068864_1000076408 269
383 3300005718 Ga0068866_10012028 Ga0068866_100120282 269
384 3300005719 Ga0068861_100070644 Ga0068861_1000706445 269
385 3300005840 Ga0068870_10000651 Ga0068870_1000065115 269
386 3300005841 Ga0068863_100047570 Ga0068863_1000475703 269
387 3300005841 Ga0068863_100154203 Ga0068863_1001542032 269
388 3300005842 Ga0068858_100002860 Ga0068858_10000286014 269
389 3300005842 Ga0068858_100158081 Ga0068858_1001580812 269
390 3300005843 Ga0068860_100105013 Ga0068860_1001050131 269
391 3300005843 Ga0068860_100243484 Ga0068860_1002434842 269
392 3300005843 Ga0068860_100327868 Ga0068860_1003278681 269
393 3300005844 Ga0068862_100014301 Ga0068862_1000143015 269
394 3300005983 Ga0081540_1084386 Ga0081540_10843861 269
395 3300006028 Ga0070717_10000586 Ga0070717_1000058612 269
396 3300006028 Ga0070717_10004883 Ga0070717_1000488311 269
397 3300006028 Ga0070717_10005765 Ga0070717_100057657 269
398 3300006028 Ga0070717_10013549 Ga0070717_100135498 269
399 3300006028 Ga0070717_10040541 Ga0070717_100405415 269
400 3300006028 Ga0070717_10135074 Ga0070717_101350742 269
401 3300006028 Ga0070717_10220677 Ga0070717_102206772 269
402 3300006028 Ga0070717_10260243 Ga0070717_102602432 269
403 3300006028 Ga0070717_10317991 Ga0070717_103179912 269
404 3300006028 Ga0070717_10404848 Ga0070717_104048482 269
405 3300006163 Ga0070715_10021658 Ga0070715_100216582 269
406 3300006173 Ga0070716_100014849 Ga0070716_1000148494 269
407 3300006173 Ga0070716_100020099 Ga0070716_1000200993 269
408 3300006173 Ga0070716_100073589 Ga0070716_1000735892 269
409 3300006173 Ga0070716_100110727 Ga0070716_1001107272 269
410 3300006175 Ga0070712_100001025 Ga0070712_1000010259 269
411 3300006175 Ga0070712_100014266 Ga0070712_1000142666 269
412 3300006175 Ga0070712_100026939 Ga0070712_1000269391 269
413 3300006175 Ga0070712_100028712 Ga0070712_1000287123 269
414 3300006175 Ga0070712_100042976 Ga0070712_1000429762 269
415 3300006175 Ga0070712_100433903 Ga0070712_1004339032 269
416 3300006237 Ga0097621_100027526 Ga0097621_1000275262 269
417 3300006237 Ga0097621_100061653 Ga0097621_1000616531 269
418 3300006358 Ga0068871_100201790 Ga0068871_1002017902 269
419 3300006871 Ga0075434_100136166 Ga0075434_1001361662 269
420 3300006881 Ga0068865_100022464 Ga0068865_1000224645 269
421 3300006914 Ga0075436_100000510 Ga0075436_1000005106 269
422 3300006914 Ga0075436_100130776 Ga0075436_1001307761 269
423 3300006914 Ga0075436_100346981 Ga0075436_1003469812 269
424 3300006931 Ga0097620_100002618 Ga0097620_10000261818 269
425 3300006931 Ga0097620_100079898 Ga0097620_1000798983 269
426 3300009093 Ga0105240_10012404 Ga0105240_100124045 269
427 3300009093 Ga0105240_10042131 Ga0105240_100421315 269
428 3300009093 Ga0105240_10117957 Ga0105240_101179574 269
429 3300009093 Ga0105240_10309654 Ga0105240_103096542 269
430 3300009098 Ga0105245_10272084 Ga0105245_102720842 269
431 3300009098 Ga0105245_10350598 Ga0105245_103505982 269
432 3300009101 Ga0105247_10005566 Ga0105247_100055663 269
433 3300009101 Ga0105247_10063114 Ga0105247_100631142 269
434 3300009101 Ga0105247_10199155 Ga0105247_101991552 269
435 3300009148 Ga0105243_10256244 Ga0105243_102562442 269
436 3300009174 Ga0105241_10000311 Ga0105241_1000031112 269
437 3300009174 Ga0105241_10002253 Ga0105241_100022537 269
438 3300009174 Ga0105241_10007254 Ga0105241_100072548 269
439 3300009174 Ga0105241_10023715 Ga0105241_100237155 269
440 3300009174 Ga0105241_10192007 Ga0105241_101920072 269
441 3300009176 Ga0105242_10034156 Ga0105242_100341561 269
442 3300009176 Ga0105242_10047800 Ga0105242_100478002 269
443 3300009177 Ga0105248_10043192 Ga0105248_100431923 269
444 3300009177 Ga0105248_10083959 Ga0105248_100839592 269
445 3300009545 Ga0105237_10024585 Ga0105237_100245853 269
446 3300009545 Ga0105237_10086762 Ga0105237_100867623 269
447 3300009545 Ga0105237_10147100 Ga0105237_101471002 269
448 3300009551 Ga0105238_10017675 Ga0105238_100176757 269
449 3300009551 Ga0105238_10190466 Ga0105238_101904663 269
450 3300009551 Ga0105238_10370892 Ga0105238_103708921 269
451 3300010375 Ga0105239_10004218 Ga0105239_100042182 269
452 3300010375 Ga0105239_10026022 Ga0105239_100260222 269
453 3300011119 Ga0105246_10002780 Ga0105246_100027803 269
454 3300013100 Ga0157373_10005148 Ga0157373_100051489 269
455 3300013100 Ga0157373_10007159 Ga0157373_100071598 269
456 3300013100 Ga0157373_10238948 Ga0157373_102389481 269
457 3300013102 Ga0157371_10022024 Ga0157371_100220245 269
458 3300013102 Ga0157371_10271187 Ga0157371_102711872 269
459 3300013105 Ga0157369_10013700 Ga0157369_100137008 269
460 3300013105 Ga0157369_10086085 Ga0157369_100860851 269
461 3300013105 Ga0157369_10108439 Ga0157369_101084392 269
462 3300013105 Ga0157369_10137555 Ga0157369_101375552 269
463 3300013105 Ga0157369_10236047 Ga0157369_102360472 269
464 3300013105 Ga0157369_10380005 Ga0157369_103800052 269
465 3300013296 Ga0157374_10026827 Ga0157374_100268276 269
466 3300013296 Ga0157374_10027888 Ga0157374_100278883 269
467 3300013296 Ga0157374_10053114 Ga0157374_100531142 269
468 3300013296 Ga0157374_10069959 Ga0157374_100699594 269
469 3300013296 Ga0157374_10083424 Ga0157374_100834242 269
470 3300013296 Ga0157374_10178394 Ga0157374_101783943 269
471 3300013296 Ga0157374_10185380 Ga0157374_101853802 269
472 3300013297 Ga0157378_10001228 Ga0157378_1000122819 269
473 3300013297 Ga0157378_10116931 Ga0157378_101169315 269
474 3300013306 Ga0163162_10015395 Ga0163162_100153957 269
475 3300013306 Ga0163162_10019591 Ga0163162_100195916 269
476 3300013307 Ga0157372_10016367 Ga0157372_100163673 269
477 3300013307 Ga0157372_10018449 Ga0157372_100184497 269
478 3300013307 Ga0157372_10021867 Ga0157372_100218672 269
479 3300013307 Ga0157372_10030681 Ga0157372_100306814 269
480 3300013307 Ga0157372_10045594 Ga0157372_100455942 269
481 3300013307 Ga0157372_10063239 Ga0157372_100632391 269
482 3300013307 Ga0157372_10083559 Ga0157372_100835592 269
483 3300014325 Ga0163163_10015546 Ga0163163_100155463 269
484 3300014325 Ga0163163_10411721 Ga0163163_104117212 269
485 3300014497 Ga0182008_10002765 Ga0182008_100027655 269
486 3300014745 Ga0157377_10003673 Ga0157377_100036733 269
487 3300014968 Ga0157379_10000116 Ga0157379_1000011610 269
488 3300014968 Ga0157379_10117665 Ga0157379_101176653 269
489 3300014969 Ga0157376_10025462 Ga0157376_100254623 269
490 3300014969 Ga0157376_10072125 Ga0157376_100721253 269
491 3300014969 Ga0157376_10086495 Ga0157376_100864954 269
492 3300014969 Ga0157376_10341203 Ga0157376_103412032 269
493 3300014969 Ga0157376_10396492 Ga0157376_103964922 269
494 3300017792 Ga0163161_10001800 Ga0163161_1000180016 269
495 3300021361 Ga0213872_10097784 Ga0213872_100977842 269
496 3300022730 Ga0224570_101846 Ga0224570_1018462 269
497 3300024225 Ga0224572_1000995 Ga0224572_10009955 269
498 3300024227 Ga0228598_1000192 Ga0228598_10001925 269
499 3300024227 Ga0228598_1035688 Ga0228598_10356881 269
500 3300025898 Ga0207692_10003860 Ga0207692_100038603 269
501 3300025898 Ga0207692_10005757 Ga0207692_100057573 269
502 3300025898 Ga0207692_10009222 Ga0207692_100092224 269
503 3300025899 Ga0207642_10113057 Ga0207642_101130572 269
504 3300025901 Ga0207688_10011720 Ga0207688_100117202 269
505 3300025903 Ga0207680_10003486 Ga0207680_100034867 269
506 3300025904 Ga0207647_10001383 Ga0207647_100013834 269
507 3300025904 Ga0207647_10011830 Ga0207647_100118303 269
508 3300025904 Ga0207647_10161479 Ga0207647_101614791 269
509 3300025905 Ga0207685_10007635 Ga0207685_100076351 269
510 3300025905 Ga0207685_10019615 Ga0207685_100196152 269
511 3300025906 Ga0207699_10001295 Ga0207699_100012954 269
512 3300025906 Ga0207699_10005473 Ga0207699_100054734 269
513 3300025906 Ga0207699_10065337 Ga0207699_100653375 269
514 3300025906 Ga0207699_10077669 Ga0207699_100776692 269
515 3300025906 Ga0207699_10194072 Ga0207699_101940722 269
516 3300025907 Ga0207645_10000998 Ga0207645_100009983 269
517 3300025908 Ga0207643_10000240 Ga0207643_1000024038 269
518 3300025909 Ga0207705_10035217 Ga0207705_100352174 269
519 3300025909 Ga0207705_10070132 Ga0207705_100701322 269
520 3300025910 Ga0207684_10000283 Ga0207684_1000028361 269
521 3300025910 Ga0207684_10000414 Ga0207684_1000041453 269
522 3300025910 Ga0207684_10022136 Ga0207684_100221365 269
523 3300025910 Ga0207684_10235082 Ga0207684_102350822 269
524 3300025911 Ga0207654_10000074 Ga0207654_1000007433 269
525 3300025911 Ga0207654_10052928 Ga0207654_100529282 269
526 3300025911 Ga0207654_10140016 Ga0207654_101400162 269
527 3300025912 Ga0207707_10056074 Ga0207707_100560744 269
528 3300025913 Ga0207695_10007106 Ga0207695_1000710613 269
529 3300025913 Ga0207695_10046245 Ga0207695_100462453 269
530 3300025914 Ga0207671_10319364 Ga0207671_103193641 269
531 3300025915 Ga0207693_10000054 Ga0207693_1000005417 269
532 3300025915 Ga0207693_10000446 Ga0207693_100004468 269
533 3300025915 Ga0207693_10028475 Ga0207693_100284755 269
534 3300025915 Ga0207693_10041737 Ga0207693_100417372 269
535 3300025915 Ga0207693_10115188 Ga0207693_101151882 269
536 3300025915 Ga0207693_10146351 Ga0207693_101463512 269
537 3300025915 Ga0207693_10231850 Ga0207693_102318502 269
538 3300025915 Ga0207693_10258439 Ga0207693_102584392 269
539 3300025916 Ga0207663_10003834 Ga0207663_100038342 269
540 3300025916 Ga0207663_10164691 Ga0207663_101646911 269
541 3300025917 Ga0207660_10041118 Ga0207660_100411183 269
542 3300025917 Ga0207660_10113785 Ga0207660_101137852 269
543 3300025918 Ga0207662_10003083 Ga0207662_100030837 269
544 3300025919 Ga0207657_10000662 Ga0207657_100006622 269
545 3300025920 Ga0207649_10005019 Ga0207649_100050192 269
546 3300025921 Ga0207652_10010342 Ga0207652_100103424 269
547 3300025921 Ga0207652_10458649 Ga0207652_104586492 269
548 3300025922 Ga0207646_10000433 Ga0207646_1000043323 269
549 3300025922 Ga0207646_10001325 Ga0207646_1000132528 269
550 3300025924 Ga0207694_10024425 Ga0207694_100244255 269
551 3300025924 Ga0207694_10085417 Ga0207694_100854172 269
552 3300025925 Ga0207650_10000227 Ga0207650_1000022766 269
553 3300025925 Ga0207650_10036901 Ga0207650_100369015 269
554 3300025926 Ga0207659_10010402 Ga0207659_100104026 269
555 3300025928 Ga0207700_10000252 Ga0207700_1000025220 269
556 3300025928 Ga0207700_10000595 Ga0207700_100005955 269
557 3300025928 Ga0207700_10004990 Ga0207700_100049906 269
558 3300025928 Ga0207700_10112658 Ga0207700_101126583 269
559 3300025928 Ga0207700_10127933 Ga0207700_101279333 269
560 3300025928 Ga0207700_10312090 Ga0207700_103120902 269
561 3300025928 Ga0207700_10327516 Ga0207700_103275161 269
562 3300025929 Ga0207664_10000370 Ga0207664_1000037026 269
563 3300025929 Ga0207664_10034020 Ga0207664_100340205 269
564 3300025929 Ga0207664_10048391 Ga0207664_100483915 269
565 3300025929 Ga0207664_10089474 Ga0207664_100894742 269
566 3300025929 Ga0207664_10363143 Ga0207664_103631432 269
567 3300025929 Ga0207664_10495941 Ga0207664_104959411 269
568 3300025933 Ga0207706_10000417 Ga0207706_100004173 269
569 3300025934 Ga0207686_10033518 Ga0207686_100335184 269
570 3300025935 Ga0207709_10269114 Ga0207709_102691141 269
571 3300025936 Ga0207670_10048769 Ga0207670_100487694 269
572 3300025936 Ga0207670_10168836 Ga0207670_101688362 269
573 3300025938 Ga0207704_10135592 Ga0207704_101355922 269
574 3300025939 Ga0207665_10003611 Ga0207665_1000361110 269
575 3300025939 Ga0207665_10004041 Ga0207665_100040412 269
576 3300025939 Ga0207665_10009355 Ga0207665_100093555 269
577 3300025939 Ga0207665_10030851 Ga0207665_100308513 269
578 3300025939 Ga0207665_10047410 Ga0207665_100474102 269
579 3300025940 Ga0207691_10000567 Ga0207691_1000056738 269
580 3300025941 Ga0207711_10050096 Ga0207711_100500963 269
581 3300025941 Ga0207711_10446308 Ga0207711_104463082 269
582 3300025942 Ga0207689_10001207 Ga0207689_1000120719 269
583 3300025942 Ga0207689_10001404 Ga0207689_100014043 269
584 3300025944 Ga0207661_10002956 Ga0207661_1000295611 269
585 3300025944 Ga0207661_10391758 Ga0207661_103917582 269
586 3300025945 Ga0207679_10000198 Ga0207679_100001983 269
587 3300025949 Ga0207667_10005917 Ga0207667_1000591713 269
588 3300025949 Ga0207667_10215369 Ga0207667_102153693 269
589 3300025960 Ga0207651_10013389 Ga0207651_100133896 269
590 3300025972 Ga0207668_10045392 Ga0207668_100453924 269
591 3300025981 Ga0207640_10018632 Ga0207640_100186326 269
592 3300025986 Ga0207658_10024923 Ga0207658_100249236 269
593 3300026023 Ga0207677_10005105 Ga0207677_100051052 269
594 3300026023 Ga0207677_10007468 Ga0207677_100074685 269
595 3300026023 Ga0207677_10086733 Ga0207677_100867332 269
596 3300026023 Ga0207677_10148269 Ga0207677_101482692 269
597 3300026035 Ga0207703_10007757 Ga0207703_100077577 269
598 3300026035 Ga0207703_10019811 Ga0207703_100198117 269
599 3300026067 Ga0207678_10000406 Ga0207678_100004063 269
600 3300026078 Ga0207702_10000796 Ga0207702_1000079618 269
601 3300026078 Ga0207702_10057989 Ga0207702_100579894 269
602 3300026078 Ga0207702_10111601 Ga0207702_101116013 269
603 3300026078 Ga0207702_10365566 Ga0207702_103655662 269
604 3300026088 Ga0207641_10000052 Ga0207641_1000005283 269
605 3300026088 Ga0207641_10136507 Ga0207641_101365072 269
606 3300026088 Ga0207641_10154788 Ga0207641_101547882 269
607 3300026089 Ga0207648_10000537 Ga0207648_100005373 269
608 3300026089 Ga0207648_10022570 Ga0207648_100225707 269
609 3300026095 Ga0207676_10001275 Ga0207676_100012753 269
610 3300026116 Ga0207674_10000803 Ga0207674_1000080343 269
611 3300026116 Ga0207674_10010198 Ga0207674_100101989 269
612 3300026118 Ga0207675_100038371 Ga0207675_1000383715 269
613 3300026121 Ga0207683_10030280 Ga0207683_100302802 269
614 3300026142 Ga0207698_10581939 Ga0207698_105819391 269
615 3300028379 Ga0268266_10002099 Ga0268266_1000209919 269
616 3300028379 Ga0268266_10492987 Ga0268266_104929871 269
617 3300028380 Ga0268265_10053545 Ga0268265_100535452 269
618 3300028381 Ga0268264_10015512 Ga0268264_100155123 269
619 3300028577 Ga0265318_10022341 Ga0265318_100223413 269
620 3300028666 Ga0265336_10040130 Ga0265336_100401302 269
621 3300028800 Ga0265338_10002471 Ga0265338_1000247117 269
622 3300028800 Ga0265338_10024192 Ga0265338_100241925 269
623 3300028800 Ga0265338_10030309 Ga0265338_100303093 269
624 3300028800 Ga0265338_10057232 Ga0265338_100572322 269
625 3300028800 Ga0265338_10130257 Ga0265338_101302572 269
626 3300028800 Ga0265338_10145411 Ga0265338_101454112 269
627 3300028800 Ga0265338_10428329 Ga0265338_104283291 269
628 3300030760 Ga0265762_1000488 Ga0265762_10004882 269
629 3300030878 Ga0265770_1012904 Ga0265770_10129041 269
630 3300031090 Ga0265760_10054174 Ga0265760_100541742 269
631 3300031235 Ga0265330_10051726 Ga0265330_100517261 269
632 3300031235 Ga0265330_10071971 Ga0265330_100719712 269
633 3300031235 Ga0265330_10106875 Ga0265330_101068752 269
634 3300031239 Ga0265328_10013480 Ga0265328_100134802 269
635 3300031240 Ga0265320_10014282 Ga0265320_100142822 269
636 3300031241 Ga0265325_10001002 Ga0265325_1000100217 269
637 3300031241 Ga0265325_10011355 Ga0265325_100113553 269
638 3300031241 Ga0265325_10063396 Ga0265325_100633962 269
639 3300031241 Ga0265325_10095057 Ga0265325_100950571 269
640 3300031242 Ga0265329_10026170 Ga0265329_100261702 269
641 3300031247 Ga0265340_10013477 Ga0265340_100134773 269
642 3300031247 Ga0265340_10077823 Ga0265340_100778233 269
643 3300031249 Ga0265339_10000026 Ga0265339_1000002690 269
644 3300031249 Ga0265339_10020456 Ga0265339_100204564 269
645 3300031249 Ga0265339_10049454 Ga0265339_100494542 269
646 3300031250 Ga0265331_10055339 Ga0265331_100553392 269
647 3300031250 Ga0265331_10161555 Ga0265331_101615551 269
648 3300031344 Ga0265316_10007137 Ga0265316_100071374 269
649 3300031344 Ga0265316_10042856 Ga0265316_100428563 269
650 3300031344 Ga0265316_10056146 Ga0265316_100561462 269
651 3300031344 Ga0265316_10068614 Ga0265316_100686141 269
652 3300031344 Ga0265316_10077223 Ga0265316_100772232 269
653 3300031344 Ga0265316_10144565 Ga0265316_101445651 269
654 3300031344 Ga0265316_10238546 Ga0265316_102385462 269
655 3300031595 Ga0265313_10004027 Ga0265313_100040274 269
656 3300031595 Ga0265313_10017181 Ga0265313_100171814 269
657 3300031711 Ga0265314_10000027 Ga0265314_10000027205 269
658 3300031711 Ga0265314_10001129 Ga0265314_1000112920 269
659 3300031712 Ga0265342_10001088 Ga0265342_1000108810 269
660 3300031712 Ga0265342_10003716 Ga0265342_100037168 269
661 3300031712 Ga0265342_10014725 Ga0265342_100147253 269
662 3300031712 Ga0265342_10116157 Ga0265342_101161572 269
663 3300031712 Ga0265342_10122531 Ga0265342_101225312 269
664 3300031712 Ga0265342_10247958 Ga0265342_102479581 269
665 3300031852 Ga0307410_10026419 Ga0307410_100264194 269
666 3300031901 Ga0307406_10109943 Ga0307406_101099433 269
667 3300031911 Ga0307412_10038414 Ga0307412_100384142 269
668 3300031995 Ga0307409_100003218 Ga0307409_1000032185 269
669 3300032002 Ga0307416_100156518 Ga0307416_1001565181 269
670 3300032004 Ga0307414_10036710 Ga0307414_100367105 269
671 3300032126 Ga0307415_100093447 Ga0307415_1000934472 269
672 3300033547 Ga0316212_1006505 Ga0316212_10065052 269
673 3300035083 Ga0373926_0006926 Ga0373926_0006926_109_993 269
674 3300035089 Ga0373944_0036806 Ga0373944_0036806_485_1363 269
675 3300035111 Ga0373923_0003069 Ga0373923_0003069_2814_3692 269
676 3300035111 Ga0373923_0049425 Ga0373923_0049425_43_927 269
677 3300035113 Ga0373936_0002785 Ga0373936_0002785_686_1570 269
678 3300035113 Ga0373936_0003142 Ga0373936_0003142_5079_5957 269
679 3300035116 Ga0373945_0001964 Ga0373945_0001964_318_1196 269
680 3300035120 Ga0373957_0032284 Ga0373957_0032284_53_931 269
681 3300035121 Ga0373960_0002247 Ga0373960_0002247_1884_2768 269
682 3300035170 Ga0373943_0001585 Ga0373943_0001585_163_1041 269
683 3300035170 Ga0373943_0014755 Ga0373943_0014755_582_1466 269
684 3300035170 Ga0373943_0076764 Ga0373943_0076764_42_920 269
685 3300035170 Ga0373943_0194782 Ga0373943_0194782_208_1086 269
686 3300035171 Ga0373946_0011405 Ga0373946_0011405_439_1317 269
687 3300035172 Ga0373955_0023790 Ga0373955_0023790_2092_2970 269
688 3300035172 Ga0373955_0040947 Ga0373955_0040947_284_1162 269
689 3300035410 Ga0373924_0008466 Ga0373924_0008466_1124_2002 269
690 3300035410 Ga0373924_0063975 Ga0373924_0063975_156_1034 269
691 3300035691 Ga0373931_0014910 Ga0373931_0014910_1511_2389 269
692 3300035691 Ga0373931_0062918 Ga0373931_0062918_219_1103 269
693 3300035692 Ga0373935_0010715 Ga0373935_0010715_4289_5167 269
694 3300035692 Ga0373935_0010969 Ga0373935_0010969_1368_2252 269
695 3300035692 Ga0373935_0020173 Ga0373935_0020173_2940_3818 269
696 3300035692 Ga0373935_0095867 Ga0373935_0095867_839_1720 269
697 3300035695 Ga0373927_0000705 Ga0373927_0000705_19883_20761 269
698 3300035695 Ga0373927_0016272 Ga0373927_0016272_3254_4165 269
699 3300035695 Ga0373927_0099070 Ga0373927_0099070_102_986 269
700 3300035695 Ga0373927_0103647 Ga0373927_0103647_136_1020 269
701 3300035695 Ga0373927_0159178 Ga0373927_0159178_229_1158 269
702 3300035695 Ga0373927_0377675 Ga0373927_0377675_16_900 269
703 3300035725 Ga0373947_0000098 Ga0373947_0000098_5286_6164 269
704 3300035725 Ga0373947_0001211 Ga0373947_0001211_5259_6143 269
705 3300035725 Ga0373947_0007307 Ga0373947_0007307_4882_5760 269
706 3300035725 Ga0373947_0207103 Ga0373947_0207103_358_1242 269
707 3300036401 Ga0373937_0006834 Ga0373937_0006834_5681_6556 269
708 3300036401 Ga0373937_0022927 Ga0373937_0022927_1930_2808 269
709 3300036401 Ga0373937_0118008 Ga0373937_0118008_762_1640 269
710 3300036401 Ga0373937_0245157 Ga0373937_0245157_183_1061 269
711 3300036401 Ga0373937_0520630 Ga0373937_0520630_154_1032 269
712 3300036401 Ga0373937_0710474 Ga0373937_0710474_16_900 269
713 3300037068 Ga0373925_0002146 Ga0373925_0002146_1480_2358 269
714 3300037068 Ga0373925_0002505 Ga0373925_0002505_9334_10218 269
715 3300037068 Ga0373925_0008716 Ga0373925_0008716_2819_3697 269
716 3300037068 Ga0373925_0015235 Ga0373925_0015235_3934_4818 269
717 3300037068 Ga0373925_0070341 Ga0373925_0070341_1539_2423 269
718 3300037068 Ga0373925_0155499 Ga0373925_0155499_463_1341 269
719 3300037471 Ga0395905_0090202 Ga0395905_0090202_1650_2540 269
720 3300037471 Ga0395905_0381212 Ga0395905_0381212_355_1245 269
721 3300039438 Ga0436360_0017782 Ga0436360_0017782_2197_3072 269
722 3300039447 Ga0436361_0063152 Ga0436361_0063152_120_995 269
723 3300039447 Ga0436361_0684605 Ga0436361_0684605_14842_15717 269
724 3300039450 Ga0436363_0563853 Ga0436363_0563853_612_1490 269
725 3300042876 Ga0451577_0371796 Ga0451577_0371796_400_1287 269
726 3300042876 Ga0451577_0394681 Ga0451577_0394681_46_921 269
727 3300044694 Ga0466963_0061959 Ga0466963_0061959_1446_2321 269
728 3300045051 Ga0451576_0192585 Ga0451576_0192585_520_1398 269
729 3300045976 Ga0466967_0026088 Ga0466967_0026088_3599_4474 269
730 3300045976 Ga0466967_0062269 Ga0466967_0062269_302_1186 269
731 3300046459 Ga0495629_0029703 Ga0495629_0029703_1825_2700 269
732 3300046472 Ga0495580_0000007 Ga0495580_0000007_71527_72405 269
733 3300046472 Ga0495580_0000616 Ga0495580_0000616_24620_25531 269
734 3300046472 Ga0495580_0001673 Ga0495580_0001673_8204_9088 269
735 3300046472 Ga0495580_0005636 Ga0495580_0005636_3587_4474 269
736 3300046472 Ga0495580_0005942 Ga0495580_0005942_738_1622 269
737 3300046472 Ga0495580_0054936 Ga0495580_0054936_501_1388 269
738 3300046472 Ga0495580_0077068 Ga0495580_0077068_552_1439 269
739 3300046473 Ga0495582_0000596 Ga0495582_0000596_7357_8241 269
740 3300046473 Ga0495582_0028246 Ga0495582_0028246_655_1533 269
741 3300046516 Ga0495628_0194153 Ga0495628_0194153_582_1460 269
742 3300046516 Ga0495628_0372698 Ga0495628_0372698_82_960 269
743 3300046517 Ga0495630_0066967 Ga0495630_0066967_1057_1935 269
744 3300046517 Ga0495630_0137018 Ga0495630_0137018_687_1571 269
745 3300046531 Ga0495665_0009559 Ga0495665_0009559_121_1005 269
746 3300046533 Ga0495640_0160338 Ga0495640_0160338_41_919 269
747 3300046535 Ga0495586_0110116 Ga0495586_0110116_231_1115 269
748 3300046642 Ga0495634_0040225 Ga0495634_0040225_993_1868 269
749 3300046642 Ga0495634_0304811 Ga0495634_0304811_61_939 269
750 3300046660 Ga0495625_0096041 Ga0495625_0096041_1075_1950 269
751 3300046679 Ga0495623_0026906 Ga0495623_0026906_432_1307 269
752 3300047315 Ga0495581_0044528 Ga0495581_0044528_1408_2292 269
753 3300047319 Ga0495674_0010450 Ga0495674_0010450_7646_8524 269
754 3300047319 Ga0495674_0011051 Ga0495674_0011051_54_929 269
755 3300047319 Ga0495674_0028291 Ga0495674_0028291_3971_4849 269
756 3300047319 Ga0495674_0108374 Ga0495674_0108374_706_1584 269
757 3300047319 Ga0495674_0125797 Ga0495674_0125797_521_1405 269
758 3300047322 Ga0495680_0013756 Ga0495680_0013756_1758_2636 269
759 3300047444 Ga0495675_0066528 Ga0495675_0066528_662_1537 269
760 3300048088 Ga0495602_0054057 Ga0495602_0054057_1765_2649 269
761 3300048088 Ga0495602_0135472 Ga0495602_0135472_672_1556 269
762 3300048088 Ga0495602_0321004 Ga0495602_0321004_215_1090 269
763 3300048903 Ga0496100_0010694 Ga0496100_0010694_2855_3733 269
764 3300048903 Ga0496100_0028214 Ga0496100_0028214_43_921 269
765 3300048903 Ga0496100_0136980 Ga0496100_0136980_196_1074 269
766 3300048904 Ga0496101_0054727 Ga0496101_0054727_343_1227 269
767 3300048904 Ga0496101_0085054 Ga0496101_0085054_1316_2194 269
768 3300048905 Ga0496102_0023540 Ga0496102_0023540_2990_3868 269
769 3300048905 Ga0496102_0041679 Ga0496102_0041679_2706_3590 269
770 3300048905 Ga0496102_0122189 Ga0496102_0122189_246_1121 269
771 3300048906 Ga0496103_0004099 Ga0496103_0004099_5585_6463 269
772 3300048907 Ga0496104_0002935 Ga0496104_0002935_11728_12606 269
773 3300048907 Ga0496104_0022237 Ga0496104_0022237_4725_5600 269
774 3300048907 Ga0496104_0027472 Ga0496104_0027472_1248_2123 269
775 3300048907 Ga0496104_0088978 Ga0496104_0088978_1977_2861 269
776 3300048907 Ga0496104_0530688 Ga0496104_0530688_65_949 269
777 3300048908 Ga0496105_0025158 Ga0496105_0025158_2259_3137 269
778 3300048908 Ga0496105_0150797 Ga0496105_0150797_34_909 269
779 3300048909 Ga0496106_0056476 Ga0496106_0056476_1538_2416 269
780 3300048910 Ga0496107_0020293 Ga0496107_0020293_17_892 269
781 3300048910 Ga0496107_0051391 Ga0496107_0051391_1007_1885 269
782 3300048910 Ga0496107_0301290 Ga0496107_0301290_43_921 269
783 3300048911 Ga0496108_0001842 Ga0496108_0001842_14349_15233 269
784 3300048911 Ga0496108_0160302 Ga0496108_0160302_392_1270 269
785 3300048912 Ga0496109_0000178 Ga0496109_0000178_59242_60126 269
786 3300048913 Ga0496110_0001986 Ga0496110_0001986_6363_7247 269
787 3300048913 Ga0496110_0399971 Ga0496110_0399971_194_1069 269
788 3300048914 Ga0496111_0005461 Ga0496111_0005461_541_1425 269
789 3300048915 Ga0496112_0000068 Ga0496112_0000068_64250_65134 269
790 3300048915 Ga0496112_0010744 Ga0496112_0010744_4321_5199 269
791 3300048915 Ga0496112_0022198 Ga0496112_0022198_603_1481 269
792 3300048915 Ga0496112_0024389 Ga0496112_0024389_2166_3044 269
793 3300048915 Ga0496112_0292122 Ga0496112_0292122_45_923 269
794 3300048915 Ga0496112_0719641 Ga0496112_0719641_23_898 269
795 3300048916 Ga0496113_0003902 Ga0496113_0003902_5200_6084 269
796 3300048917 Ga0496114_0037963 Ga0496114_0037963_2132_3007 269
797 3300048917 Ga0496114_0215583 Ga0496114_0215583_635_1513 269
798 3300048917 Ga0496114_0327437 Ga0496114_0327437_347_1234 269
799 3300048918 Ga0496115_0007191 Ga0496115_0007191_4318_5196 269
800 3300048918 Ga0496115_0034019 Ga0496115_0034019_1360_2238 269
801 3300048918 Ga0496115_0063161 Ga0496115_0063161_1270_2145 269
802 3300048929 Ga0496126_0003062 Ga0496126_0003062_5972_6847 269
803 3300050512 nmdc:mga0n895_910_c1 nmdc:mga0n895_910_c1_2033_2917 269
804 3300050513 nmdc:mga0rr50_2425_c2 nmdc:mga0rr50_2425_c2_695_1579 269
805 3300050513 nmdc:mga0rr50_68603_c1 nmdc:mga0rr50_68603_c1_154_1038 269
806 3300050514 nmdc:mga08x19_1302_c1 nmdc:mga08x19_1302_c1_6406_7290 269
807 3300050514 nmdc:mga08x19_151853_c1 nmdc:mga08x19_151853_c1_546_1430 269
808 3300053085 Ga0495619_0052150 Ga0495619_0052150_1663_2541 269
809 2162886011 MRS1b_contig_200623 MRS1b_0843.00000690 270
810 3300005290 Ga0065712_10082087 Ga0065712_100820872 270
811 3300005293 Ga0065715_10118715 Ga0065715_101187152 270
812 3300006846 Ga0075430_100137326 Ga0075430_1001373262 270
813 3300006847 Ga0075431_100036989 Ga0075431_1000369893 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02629

CoA_binding

CoA binding domain

73

158

0.97

PF00549

Ligase_CoA

CoA-ligase

221

310

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mss-assembly1.cif.gz_A human e105qa gtp-specific succinyl-coa synthetase complexed with succinate, magnesium ion and coa 0.8988 2 269
2nua-assembly1.cif.gz_A c123av mutant of e. coli succinyl-coa synthetase 0.8922 5 266
7mss-assembly1.cif.gz_A human e105qa gtp-specific succinyl-coa synthetase complexed with succinate, magnesium ion and coa 0.8895 2 269
6mgg-assembly1.cif.gz_A succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa 0.8874 2 270
3ufx-assembly1.cif.gz_A thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ 0.8867 5 268
ID Description Score Start End Superfamily
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 5 124 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 5 124 3.40.50.720
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9433 5 124 3.40.50.720
af_P9WGC7_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9413 1 121 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 5 124 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2C9VZS3-F1-model_v4 CoA-binding domain-containing protein 0.9963 5 105 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361
AF-A0A382W6R5-F1-model_v4 CoA-binding domain-containing protein 0.995 12 105 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A7R9UUU5-F1-model_v4 CoA-binding domain-containing protein 0.9946 5 101 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361
AF-A0A2D4K3L3-F1-model_v4 CoA-binding domain-containing protein 0.9919 5 107 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361
AF-A0A182S948-F1-model_v4 CoA-binding domain-containing protein 0.9918 5 106 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361

Feature Viewer

pLDDT pTM Quality
83.69 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map