F481939
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 813 | 305 | 813 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300025906|Ga0207699_10194072|Ga0207699_101940722 |
| Length | 330 |
| Sequence | MRSMTMNRFLAAFLLFAIPCLAADELDGLWKAKKKFGPDARGTLIVQRSGNAYTADMVGRILPITATNGELTFSLPGREGTFHAKGCAEYGTKVVGGVTPGKGGTTHEGWPIFNTVQDAVDKTGANATVIFVPPPFAADAIMEAADAEIDLIVCITEGIPTLDMVRAWEFLQTRRSRLIGPNCPGIISPGKCKIGIMPASIHKEGNIGIVSRSGTLTYEAVHQTTFVDALDLFNRDPETEAVIMIGEIGGTAEETAAEFIKTHMKKPVVSFIAGQTAPPGRRMGHAGAIISGGKGTAAEKIKALEAAGIKVAKSPAAIGETLAAAIGVHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 114 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 115 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.65 |
| Metatranscriptomes | 1.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.92 |
| Rhizosphere | 94.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_200623 | 2162886011 | Bacteria | 1109 |
| 2 | JGI24752J21851_1000626 | 3300001976 | Bacteria | 4723 |
| 3 | JGI24737J22298_10010409 | 3300001990 | Bacteria | 3071 |
| 4 | JGI24743J22301_10001628 | 3300001991 | Bacteria | 3180 |
| 5 | JGI24749J21850_1001307 | 3300002076 | Bacteria | 3529 |
| 6 | JGI24034J26672_10000790 | 3300002239 | Bacteria | 4095 |
| 7 | JGI24751J29686_10001033 | 3300002459 | Bacteria | 6068 |
| 8 | Ga0065712_10082087 | 3300005290 | Bacteria | 2943 |
| 9 | Ga0065715_10118715 | 3300005293 | Bacteria | 2308 |
| 10 | Ga0070658_10207850 | 3300005327 | Bacteria | 1653 |
| 11 | Ga0070676_10014694 | 3300005328 | Bacteria | 4306 |
| 12 | Ga0070683_100001214 | 3300005329 | Bacteria | 19583 |
| 13 | Ga0070683_100005374 | 3300005329 | Bacteria | 10682 |
| 14 | Ga0070683_100010141 | 3300005329 | Bacteria | 8087 |
| 15 | Ga0070683_100059328 | 3300005329 | Bacteria | 3555 |
| 16 | Ga0070690_100006108 | 3300005330 | Bacteria | 6818 |
| 17 | Ga0070670_100025125 | 3300005331 | Bacteria | 5125 |
| 18 | Ga0070670_100044971 | 3300005331 | Bacteria | 3795 |
| 19 | Ga0068869_100001306 | 3300005334 | Bacteria | 14747 |
| 20 | Ga0068869_100005208 | 3300005334 | Bacteria | 8162 |
| 21 | Ga0070666_10006701 | 3300005335 | Bacteria | 7089 |
| 22 | Ga0070666_10078904 | 3300005335 | Bacteria | 2248 |
| 23 | Ga0070666_10423122 | 3300005335 | Bacteria | 959 |
| 24 | Ga0070680_100039817 | 3300005336 | Bacteria | 3803 |
| 25 | Ga0068868_100000161 | 3300005338 | Bacteria | 43698 |
| 26 | Ga0068868_100017936 | 3300005338 | Bacteria | 5281 |
| 27 | Ga0068868_100038382 | 3300005338 | Bacteria | 3717 |
| 28 | Ga0070687_100001381 | 3300005343 | Bacteria | 8507 |
| 29 | Ga0070661_100009497 | 3300005344 | Bacteria | 6738 |
| 30 | Ga0070661_100012417 | 3300005344 | Bacteria | 5959 |
| 31 | Ga0070661_100017342 | 3300005344 | Bacteria | 5108 |
| 32 | Ga0070669_100003106 | 3300005353 | Bacteria | 11954 |
| 33 | Ga0070675_100021770 | 3300005354 | Bacteria | 5121 |
| 34 | Ga0070671_100028590 | 3300005355 | Bacteria | 4592 |
| 35 | Ga0070671_100047488 | 3300005355 | Bacteria | 3570 |
| 36 | Ga0070671_100590431 | 3300005355 | Bacteria | 959 |
| 37 | Ga0070674_100007866 | 3300005356 | Bacteria | 6307 |
| 38 | Ga0070673_100017012 | 3300005364 | Bacteria | 5159 |
| 39 | Ga0070673_100032826 | 3300005364 | Bacteria | 3913 |
| 40 | Ga0070688_100045066 | 3300005365 | Bacteria | 2723 |
| 41 | Ga0070688_100173717 | 3300005365 | Bacteria | 1489 |
| 42 | Ga0070659_100016747 | 3300005366 | Bacteria | 5506 |
| 43 | Ga0070667_100000343 | 3300005367 | Bacteria | 52085 |
| 44 | Ga0070709_10000566 | 3300005434 | Bacteria | 21596 |
| 45 | Ga0070709_10007162 | 3300005434 | Bacteria | 6108 |
| 46 | Ga0070709_10087946 | 3300005434 | Bacteria | 2042 |
| 47 | Ga0070709_10095846 | 3300005434 | Bacteria | 1966 |
| 48 | Ga0070714_100000188 | 3300005435 | Bacteria | 49788 |
| 49 | Ga0070714_100044012 | 3300005435 | Bacteria | 3778 |
| 50 | Ga0070714_100072720 | 3300005435 | Bacteria | 2977 |
| 51 | Ga0070714_100114255 | 3300005435 | Bacteria | 2395 |
| 52 | Ga0070714_100125324 | 3300005435 | Bacteria | 2289 |
| 53 | Ga0070714_100519825 | 3300005435 | Bacteria | 1137 |
| 54 | Ga0070713_100000319 | 3300005436 | Bacteria | 31472 |
| 55 | Ga0070713_100001167 | 3300005436 | Bacteria | 16777 |
| 56 | Ga0070713_100005973 | 3300005436 | Bacteria | 8375 |
| 57 | Ga0070713_100006607 | 3300005436 | Bacteria | 8061 |
| 58 | Ga0070713_100018741 | 3300005436 | Bacteria | 5265 |
| 59 | Ga0070713_100034370 | 3300005436 | Bacteria | 4071 |
| 60 | Ga0070713_100382370 | 3300005436 | Bacteria | 1312 |
| 61 | Ga0070710_10011986 | 3300005437 | Bacteria | 4296 |
| 62 | Ga0070710_10040214 | 3300005437 | Bacteria | 2577 |
| 63 | Ga0070711_100001058 | 3300005439 | Bacteria | 14682 |
| 64 | Ga0070711_100361214 | 3300005439 | Bacteria | 1170 |
| 65 | Ga0070708_100000759 | 3300005445 | Bacteria | 24331 |
| 66 | Ga0070708_100007253 | 3300005445 | Bacteria | 8862 |
| 67 | Ga0070708_100025721 | 3300005445 | Bacteria | 5034 |
| 68 | Ga0070708_100090042 | 3300005445 | Bacteria | 2792 |
| 69 | Ga0070708_100155620 | 3300005445 | Bacteria | 2128 |
| 70 | Ga0070663_100100919 | 3300005455 | Bacteria | 2153 |
| 71 | Ga0070662_100019973 | 3300005457 | Bacteria | 4559 |
| 72 | Ga0070681_10021100 | 3300005458 | Bacteria | 6526 |
| 73 | Ga0068867_100121912 | 3300005459 | Bacteria | 2016 |
| 74 | Ga0070685_10001186 | 3300005466 | Bacteria | 13935 |
| 75 | Ga0070706_100000665 | 3300005467 | Bacteria | 39170 |
| 76 | Ga0070706_100002304 | 3300005467 | Bacteria | 19295 |
| 77 | Ga0070706_100023869 | 3300005467 | Bacteria | 5631 |
| 78 | Ga0070706_100320686 | 3300005467 | Bacteria | 1445 |
| 79 | Ga0070707_100000449 | 3300005468 | Bacteria | 40855 |
| 80 | Ga0070707_100005258 | 3300005468 | Bacteria | 12115 |
| 81 | Ga0070707_100096983 | 3300005468 | Bacteria | 2855 |
| 82 | Ga0070698_100000007 | 3300005471 | Bacteria | 123996 |
| 83 | Ga0070698_100001842 | 3300005471 | Bacteria | 23634 |
| 84 | Ga0070698_100188887 | 3300005471 | Bacteria | 1998 |
| 85 | Ga0070699_100009157 | 3300005518 | Bacteria | 8585 |
| 86 | Ga0070699_100013744 | 3300005518 | Bacteria | 6964 |
| 87 | Ga0070699_100106454 | 3300005518 | Bacteria | 2460 |
| 88 | Ga0070679_100013019 | 3300005530 | Bacteria | 7966 |
| 89 | Ga0070679_100085217 | 3300005530 | Bacteria | 3147 |
| 90 | Ga0070679_100494216 | 3300005530 | Bacteria | 1168 |
| 91 | Ga0070684_100000175 | 3300005535 | Bacteria | 44153 |
| 92 | Ga0070684_100000965 | 3300005535 | Bacteria | 20493 |
| 93 | Ga0070697_100001330 | 3300005536 | Bacteria | 18676 |
| 94 | Ga0070697_100002365 | 3300005536 | Bacteria | 14506 |
| 95 | Ga0070697_100007175 | 3300005536 | Bacteria | 8664 |
| 96 | Ga0070697_100037719 | 3300005536 | Bacteria | 3903 |
| 97 | Ga0068853_100000389 | 3300005539 | Bacteria | 30055 |
| 98 | Ga0068853_100004157 | 3300005539 | Bacteria | 11157 |
| 99 | Ga0070672_100001289 | 3300005543 | Bacteria | 15424 |
| 100 | Ga0070686_100013418 | 3300005544 | Bacteria | 4692 |
| 101 | Ga0070693_100104615 | 3300005547 | Bacteria | 1730 |
| 102 | Ga0070693_100157013 | 3300005547 | Bacteria | 1446 |
| 103 | Ga0070704_100226175 | 3300005549 | Bacteria | 1524 |
| 104 | Ga0068855_100001498 | 3300005563 | Bacteria | 29248 |
| 105 | Ga0068855_100002300 | 3300005563 | Bacteria | 23617 |
| 106 | Ga0068855_100008944 | 3300005563 | Bacteria | 12108 |
| 107 | Ga0068855_100025034 | 3300005563 | Bacteria | 7143 |
| 108 | Ga0068855_100028592 | 3300005563 | Bacteria | 6670 |
| 109 | Ga0068855_100029001 | 3300005563 | Bacteria | 6620 |
| 110 | Ga0068855_100044544 | 3300005563 | Bacteria | 5250 |
| 111 | Ga0068855_100209777 | 3300005563 | Bacteria | 2189 |
| 112 | Ga0070664_100051825 | 3300005564 | Bacteria | 3475 |
| 113 | Ga0070664_100066482 | 3300005564 | Bacteria | 3079 |
| 114 | Ga0070664_100280186 | 3300005564 | Bacteria | 1503 |
| 115 | Ga0068857_100000481 | 3300005577 | Bacteria | 28495 |
| 116 | Ga0068857_100017006 | 3300005577 | Bacteria | 6371 |
| 117 | Ga0068857_100025522 | 3300005577 | Bacteria | 5203 |
| 118 | Ga0068854_100015244 | 3300005578 | Bacteria | 5088 |
| 119 | Ga0068854_100290684 | 3300005578 | Bacteria | 1319 |
| 120 | Ga0068856_100000273 | 3300005614 | Bacteria | 56215 |
| 121 | Ga0068856_100000671 | 3300005614 | Bacteria | 37132 |
| 122 | Ga0068856_100002276 | 3300005614 | Bacteria | 19807 |
| 123 | Ga0068856_100008342 | 3300005614 | Bacteria | 10093 |
| 124 | Ga0068856_100023355 | 3300005614 | Bacteria | 6012 |
| 125 | Ga0068856_100137652 | 3300005614 | Bacteria | 2448 |
| 126 | Ga0068856_100457535 | 3300005614 | Bacteria | 1297 |
| 127 | Ga0068852_100000028 | 3300005616 | Bacteria | 113383 |
| 128 | Ga0068852_100000191 | 3300005616 | Bacteria | 41609 |
| 129 | Ga0068852_100008182 | 3300005616 | Bacteria | 7683 |
| 130 | Ga0068852_100016117 | 3300005616 | Bacteria | 5817 |
| 131 | Ga0068852_100140566 | 3300005616 | Bacteria | 2234 |
| 132 | Ga0068852_100355223 | 3300005616 | Bacteria | 1432 |
| 133 | Ga0068859_100002618 | 3300005617 | Bacteria | 18306 |
| 134 | Ga0068859_100079897 | 3300005617 | Bacteria | 3311 |
| 135 | Ga0068859_100095740 | 3300005617 | Bacteria | 3021 |
| 136 | Ga0068864_100004314 | 3300005618 | Bacteria | 11692 |
| 137 | Ga0068864_100007640 | 3300005618 | Bacteria | 8905 |
| 138 | Ga0068866_10012028 | 3300005718 | Bacteria | 3763 |
| 139 | Ga0068861_100070644 | 3300005719 | Bacteria | 2704 |
| 140 | Ga0068851_10010774 | 3300005834 | Bacteria | 4273 |
| 141 | Ga0068851_10032692 | 3300005834 | Bacteria | 2589 |
| 142 | Ga0068851_10044734 | 3300005834 | Bacteria | 2236 |
| 143 | Ga0068851_10083770 | 3300005834 | Bacteria | 1669 |
| 144 | Ga0068870_10000651 | 3300005840 | Bacteria | 13238 |
| 145 | Ga0068863_100000933 | 3300005841 | Bacteria | 29366 |
| 146 | Ga0068863_100047570 | 3300005841 | Bacteria | 4068 |
| 147 | Ga0068863_100154203 | 3300005841 | Bacteria | 2199 |
| 148 | Ga0068858_100001871 | 3300005842 | Bacteria | 21477 |
| 149 | Ga0068858_100002860 | 3300005842 | Bacteria | 17358 |
| 150 | Ga0068858_100012399 | 3300005842 | Bacteria | 8038 |
| 151 | Ga0068858_100158081 | 3300005842 | Bacteria | 2133 |
| 152 | Ga0068860_100000608 | 3300005843 | Bacteria | 42634 |
| 153 | Ga0068860_100105013 | 3300005843 | Bacteria | 2697 |
| 154 | Ga0068860_100243484 | 3300005843 | Bacteria | 1749 |
| 155 | Ga0068860_100327868 | 3300005843 | Bacteria | 1503 |
| 156 | Ga0068862_100014301 | 3300005844 | Bacteria | 6583 |
| 157 | Ga0081540_1084386 | 3300005983 | Bacteria | 1418 |
| 158 | Ga0070717_10000586 | 3300006028 | Bacteria | 23231 |
| 159 | Ga0070717_10002337 | 3300006028 | Bacteria | 13350 |
| 160 | Ga0070717_10004883 | 3300006028 | Bacteria | 9757 |
| 161 | Ga0070717_10005765 | 3300006028 | Bacteria | 9069 |
| 162 | Ga0070717_10013549 | 3300006028 | Bacteria | 6253 |
| 163 | Ga0070717_10040541 | 3300006028 | Bacteria | 3793 |
| 164 | Ga0070717_10135074 | 3300006028 | Bacteria | 2123 |
| 165 | Ga0070717_10220677 | 3300006028 | Bacteria | 1666 |
| 166 | Ga0070717_10260243 | 3300006028 | Bacteria | 1535 |
| 167 | Ga0070717_10317991 | 3300006028 | Bacteria | 1386 |
| 168 | Ga0070717_10404848 | 3300006028 | Bacteria | 1226 |
| 169 | Ga0070715_10021658 | 3300006163 | Bacteria | 2496 |
| 170 | Ga0070715_10025595 | 3300006163 | Bacteria | 2340 |
| 171 | Ga0070716_100014849 | 3300006173 | Bacteria | 3995 |
| 172 | Ga0070716_100020099 | 3300006173 | Bacteria | 3501 |
| 173 | Ga0070716_100034442 | 3300006173 | Bacteria | 2777 |
| 174 | Ga0070716_100073589 | 3300006173 | Bacteria | 2016 |
| 175 | Ga0070716_100110727 | 3300006173 | Bacteria | 1701 |
| 176 | Ga0070712_100001025 | 3300006175 | Bacteria | 16857 |
| 177 | Ga0070712_100014266 | 3300006175 | Bacteria | 5101 |
| 178 | Ga0070712_100026939 | 3300006175 | Bacteria | 3834 |
| 179 | Ga0070712_100028712 | 3300006175 | Bacteria | 3723 |
| 180 | Ga0070712_100042976 | 3300006175 | Bacteria | 3109 |
| 181 | Ga0070712_100333899 | 3300006175 | Bacteria | 1236 |
| 182 | Ga0070712_100433903 | 3300006175 | Bacteria | 1091 |
| 183 | Ga0097621_100000561 | 3300006237 | Bacteria | 26093 |
| 184 | Ga0097621_100012142 | 3300006237 | Bacteria | 6374 |
| 185 | Ga0097621_100027526 | 3300006237 | Bacteria | 4472 |
| 186 | Ga0097621_100061653 | 3300006237 | Bacteria | 3076 |
| 187 | Ga0097621_100385173 | 3300006237 | Bacteria | 1253 |
| 188 | Ga0068871_100000647 | 3300006358 | Bacteria | 23964 |
| 189 | Ga0068871_100201790 | 3300006358 | Bacteria | 1717 |
| 190 | Ga0075428_100104384 | 3300006844 | Bacteria | 3090 |
| 191 | Ga0075430_100027811 | 3300006846 | Bacteria | 4803 |
| 192 | Ga0075430_100137326 | 3300006846 | Bacteria | 2036 |
| 193 | Ga0075431_100036989 | 3300006847 | Bacteria | 5028 |
| 194 | Ga0075431_100039845 | 3300006847 | Bacteria | 4840 |
| 195 | Ga0075431_100322653 | 3300006847 | Bacteria | 1557 |
| 196 | Ga0075434_100136166 | 3300006871 | Bacteria | 2475 |
| 197 | Ga0075429_100539160 | 3300006880 | Bacteria | 1022 |
| 198 | Ga0068865_100022464 | 3300006881 | Bacteria | 4115 |
| 199 | Ga0075436_100000510 | 3300006914 | Bacteria | 25141 |
| 200 | Ga0075436_100130776 | 3300006914 | Bacteria | 1760 |
| 201 | Ga0075436_100346981 | 3300006914 | Bacteria | 1069 |
| 202 | Ga0097620_100002618 | 3300006931 | Bacteria | 18306 |
| 203 | Ga0097620_100079898 | 3300006931 | Bacteria | 3311 |
| 204 | Ga0097620_100095747 | 3300006931 | Bacteria | 3021 |
| 205 | Ga0099794_10000543 | 3300007265 | Bacteria | 12666 |
| 206 | Ga0105240_10000735 | 3300009093 | Bacteria | 59884 |
| 207 | Ga0105240_10000796 | 3300009093 | Bacteria | 57123 |
| 208 | Ga0105240_10001270 | 3300009093 | Bacteria | 43667 |
| 209 | Ga0105240_10005354 | 3300009093 | Bacteria | 19142 |
| 210 | Ga0105240_10012404 | 3300009093 | Bacteria | 11765 |
| 211 | Ga0105240_10018325 | 3300009093 | Bacteria | 9408 |
| 212 | Ga0105240_10042131 | 3300009093 | Bacteria | 5821 |
| 213 | Ga0105240_10043745 | 3300009093 | Bacteria | 5694 |
| 214 | Ga0105240_10057253 | 3300009093 | Bacteria | 4871 |
| 215 | Ga0105240_10117957 | 3300009093 | Bacteria | 3199 |
| 216 | Ga0105240_10309065 | 3300009093 | Bacteria | 1806 |
| 217 | Ga0105240_10309654 | 3300009093 | Bacteria | 1804 |
| 218 | Ga0105245_10000204 | 3300009098 | Bacteria | 56632 |
| 219 | Ga0105245_10027085 | 3300009098 | Bacteria | 5049 |
| 220 | Ga0105245_10272084 | 3300009098 | Bacteria | 1652 |
| 221 | Ga0105245_10350598 | 3300009098 | Bacteria | 1462 |
| 222 | Ga0105247_10005566 | 3300009101 | Bacteria | 7916 |
| 223 | Ga0105247_10009145 | 3300009101 | Bacteria | 6030 |
| 224 | Ga0105247_10063114 | 3300009101 | Bacteria | 2299 |
| 225 | Ga0105247_10199155 | 3300009101 | Bacteria | 1345 |
| 226 | Ga0114129_10176610 | 3300009147 | Bacteria | 2909 |
| 227 | Ga0105243_10256244 | 3300009148 | Bacteria | 1565 |
| 228 | Ga0105241_10000162 | 3300009174 | Bacteria | 48662 |
| 229 | Ga0105241_10000233 | 3300009174 | Bacteria | 41954 |
| 230 | Ga0105241_10000311 | 3300009174 | Bacteria | 36665 |
| 231 | Ga0105241_10002253 | 3300009174 | Bacteria | 14494 |
| 232 | Ga0105241_10007254 | 3300009174 | Bacteria | 8160 |
| 233 | Ga0105241_10023715 | 3300009174 | Bacteria | 4551 |
| 234 | Ga0105241_10076855 | 3300009174 | Bacteria | 2605 |
| 235 | Ga0105241_10192007 | 3300009174 | Bacteria | 1700 |
| 236 | Ga0105242_10034156 | 3300009176 | Bacteria | 4077 |
| 237 | Ga0105242_10047800 | 3300009176 | Bacteria | 3475 |
| 238 | Ga0105248_10001505 | 3300009177 | Bacteria | 25928 |
| 239 | Ga0105248_10043192 | 3300009177 | Bacteria | 5054 |
| 240 | Ga0105248_10069389 | 3300009177 | Bacteria | 3957 |
| 241 | Ga0105248_10083959 | 3300009177 | Bacteria | 3583 |
| 242 | Ga0105237_10014468 | 3300009545 | Bacteria | 8248 |
| 243 | Ga0105237_10024585 | 3300009545 | Bacteria | 6159 |
| 244 | Ga0105237_10086762 | 3300009545 | Bacteria | 3120 |
| 245 | Ga0105237_10147100 | 3300009545 | Bacteria | 2351 |
| 246 | Ga0105237_10529851 | 3300009545 | Bacteria | 1185 |
| 247 | Ga0105238_10000252 | 3300009551 | Bacteria | 59882 |
| 248 | Ga0105238_10000373 | 3300009551 | Bacteria | 48142 |
| 249 | Ga0105238_10005396 | 3300009551 | Bacteria | 12635 |
| 250 | Ga0105238_10015341 | 3300009551 | Bacteria | 7759 |
| 251 | Ga0105238_10017675 | 3300009551 | Bacteria | 7249 |
| 252 | Ga0105238_10117302 | 3300009551 | Bacteria | 2642 |
| 253 | Ga0105238_10190466 | 3300009551 | Bacteria | 2027 |
| 254 | Ga0105238_10370892 | 3300009551 | Bacteria | 1422 |
| 255 | Ga0105239_10000774 | 3300010375 | Bacteria | 45307 |
| 256 | Ga0105239_10003276 | 3300010375 | Bacteria | 19965 |
| 257 | Ga0105239_10004218 | 3300010375 | Bacteria | 17268 |
| 258 | Ga0105239_10026022 | 3300010375 | Bacteria | 6442 |
| 259 | Ga0105239_10055427 | 3300010375 | Bacteria | 4348 |
| 260 | Ga0105239_10115544 | 3300010375 | Bacteria | 2977 |
| 261 | Ga0105239_10337868 | 3300010375 | Bacteria | 1699 |
| 262 | Ga0105246_10002780 | 3300011119 | Bacteria | 10594 |
| 263 | Ga0157373_10005148 | 3300013100 | Bacteria | 9832 |
| 264 | Ga0157373_10007159 | 3300013100 | Bacteria | 8321 |
| 265 | Ga0157373_10238948 | 3300013100 | Bacteria | 1284 |
| 266 | Ga0157373_10289812 | 3300013100 | Bacteria | 1161 |
| 267 | Ga0157371_10022024 | 3300013102 | Bacteria | 4676 |
| 268 | Ga0157371_10271187 | 3300013102 | Bacteria | 1225 |
| 269 | Ga0157370_10000003 | 3300013104 | Bacteria | 367417 |
| 270 | Ga0157369_10000767 | 3300013105 | Bacteria | 41495 |
| 271 | Ga0157369_10011205 | 3300013105 | Bacteria | 10191 |
| 272 | Ga0157369_10013700 | 3300013105 | Bacteria | 9167 |
| 273 | Ga0157369_10016768 | 3300013105 | Bacteria | 8233 |
| 274 | Ga0157369_10076109 | 3300013105 | Bacteria | 3597 |
| 275 | Ga0157369_10086085 | 3300013105 | Bacteria | 3357 |
| 276 | Ga0157369_10108439 | 3300013105 | Bacteria | 2953 |
| 277 | Ga0157369_10137555 | 3300013105 | Bacteria | 2585 |
| 278 | Ga0157369_10236047 | 3300013105 | Bacteria | 1911 |
| 279 | Ga0157369_10380005 | 3300013105 | Bacteria | 1466 |
| 280 | Ga0157374_10001833 | 3300013296 | Bacteria | 17893 |
| 281 | Ga0157374_10019314 | 3300013296 | Bacteria | 6030 |
| 282 | Ga0157374_10026827 | 3300013296 | Bacteria | 5188 |
| 283 | Ga0157374_10027731 | 3300013296 | Bacteria | 5113 |
| 284 | Ga0157374_10027888 | 3300013296 | Bacteria | 5098 |
| 285 | Ga0157374_10053114 | 3300013296 | Bacteria | 3777 |
| 286 | Ga0157374_10069959 | 3300013296 | Bacteria | 3306 |
| 287 | Ga0157374_10075742 | 3300013296 | Bacteria | 3180 |
| 288 | Ga0157374_10083424 | 3300013296 | Bacteria | 3036 |
| 289 | Ga0157374_10098749 | 3300013296 | Bacteria | 2796 |
| 290 | Ga0157374_10178394 | 3300013296 | Bacteria | 2074 |
| 291 | Ga0157374_10185380 | 3300013296 | Bacteria | 2034 |
| 292 | Ga0157378_10000427 | 3300013297 | Bacteria | 41173 |
| 293 | Ga0157378_10001228 | 3300013297 | Bacteria | 23172 |
| 294 | Ga0157378_10116931 | 3300013297 | Bacteria | 2453 |
| 295 | Ga0157378_10168535 | 3300013297 | Bacteria | 2052 |
| 296 | Ga0157378_10198443 | 3300013297 | Bacteria | 1897 |
| 297 | Ga0163162_10015395 | 3300013306 | Bacteria | 7472 |
| 298 | Ga0163162_10019591 | 3300013306 | Bacteria | 6641 |
| 299 | Ga0163162_10042969 | 3300013306 | Bacteria | 4524 |
| 300 | Ga0157372_10000489 | 3300013307 | Bacteria | 43671 |
| 301 | Ga0157372_10002530 | 3300013307 | Bacteria | 19830 |
| 302 | Ga0157372_10005787 | 3300013307 | Bacteria | 13169 |
| 303 | Ga0157372_10016367 | 3300013307 | Bacteria | 7956 |
| 304 | Ga0157372_10018449 | 3300013307 | Bacteria | 7500 |
| 305 | Ga0157372_10021867 | 3300013307 | Bacteria | 6913 |
| 306 | Ga0157372_10030681 | 3300013307 | Bacteria | 5882 |
| 307 | Ga0157372_10033266 | 3300013307 | Bacteria | 5660 |
| 308 | Ga0157372_10045594 | 3300013307 | Bacteria | 4865 |
| 309 | Ga0157372_10063239 | 3300013307 | Bacteria | 4149 |
| 310 | Ga0157372_10083559 | 3300013307 | Bacteria | 3617 |
| 311 | Ga0157372_10109569 | 3300013307 | Bacteria | 3162 |
| 312 | Ga0157372_10598166 | 3300013307 | Bacteria | 1286 |
| 313 | Ga0157375_10180667 | 3300013308 | Bacteria | 2261 |
| 314 | Ga0163163_10000356 | 3300014325 | Bacteria | 44127 |
| 315 | Ga0163163_10015546 | 3300014325 | Bacteria | 7038 |
| 316 | Ga0163163_10411721 | 3300014325 | Bacteria | 1411 |
| 317 | Ga0182008_10002765 | 3300014497 | Bacteria | 10876 |
| 318 | Ga0157377_10003673 | 3300014745 | Bacteria | 6960 |
| 319 | Ga0157379_10000116 | 3300014968 | Bacteria | 55439 |
| 320 | Ga0157379_10001161 | 3300014968 | Bacteria | 21462 |
| 321 | Ga0157379_10117665 | 3300014968 | Bacteria | 2391 |
| 322 | Ga0157376_10001779 | 3300014969 | Bacteria | 14335 |
| 323 | Ga0157376_10025462 | 3300014969 | Bacteria | 4660 |
| 324 | Ga0157376_10072125 | 3300014969 | Bacteria | 2937 |
| 325 | Ga0157376_10086495 | 3300014969 | Bacteria | 2703 |
| 326 | Ga0157376_10341203 | 3300014969 | Bacteria | 1431 |
| 327 | Ga0157376_10395324 | 3300014969 | Bacteria | 1335 |
| 328 | Ga0157376_10396492 | 3300014969 | Bacteria | 1333 |
| 329 | Ga0163161_10001800 | 3300017792 | Bacteria | 15648 |
| 330 | Ga0163161_10039515 | 3300017792 | Bacteria | 3388 |
| 331 | Ga0213872_10097784 | 3300021361 | Bacteria | 1310 |
| 332 | Ga0213875_10000318 | 3300021388 | Bacteria | 45734 |
| 333 | Ga0224570_101846 | 3300022730 | Bacteria | 1489 |
| 334 | Ga0224572_1000995 | 3300024225 | Bacteria | 3910 |
| 335 | Ga0228598_1000192 | 3300024227 | Bacteria | 11121 |
| 336 | Ga0228598_1007044 | 3300024227 | Bacteria | 2306 |
| 337 | Ga0228598_1035688 | 3300024227 | Bacteria | 980 |
| 338 | Ga0207656_10008959 | 3300025321 | Bacteria | 3707 |
| 339 | Ga0207656_10017570 | 3300025321 | Bacteria | 2804 |
| 340 | Ga0207656_10131912 | 3300025321 | Bacteria | 1171 |
| 341 | Ga0207692_10003860 | 3300025898 | Bacteria | 5886 |
| 342 | Ga0207692_10005757 | 3300025898 | Bacteria | 4986 |
| 343 | Ga0207692_10009222 | 3300025898 | Bacteria | 4113 |
| 344 | Ga0207642_10113057 | 3300025899 | Bacteria | 1386 |
| 345 | Ga0207710_10002111 | 3300025900 | Bacteria | 9395 |
| 346 | Ga0207688_10011720 | 3300025901 | Bacteria | 4769 |
| 347 | Ga0207680_10003486 | 3300025903 | Bacteria | 7409 |
| 348 | Ga0207680_10036670 | 3300025903 | Bacteria | 2825 |
| 349 | Ga0207647_10001383 | 3300025904 | Bacteria | 18638 |
| 350 | Ga0207647_10011830 | 3300025904 | Bacteria | 6099 |
| 351 | Ga0207647_10161479 | 3300025904 | Bacteria | 1307 |
| 352 | Ga0207685_10007635 | 3300025905 | Bacteria | 3026 |
| 353 | Ga0207685_10019615 | 3300025905 | Bacteria | 2232 |
| 354 | Ga0207699_10001295 | 3300025906 | Bacteria | 11891 |
| 355 | Ga0207699_10005473 | 3300025906 | Bacteria | 6081 |
| 356 | Ga0207699_10065337 | 3300025906 | Bacteria | 2205 |
| 357 | Ga0207699_10077669 | 3300025906 | Bacteria | 2049 |
| 358 | Ga0207699_10194072 | 3300025906 | Bacteria | 1372 |
| 359 | Ga0207645_10000998 | 3300025907 | Bacteria | 23374 |
| 360 | Ga0207645_10025211 | 3300025907 | Bacteria | 3849 |
| 361 | Ga0207643_10000240 | 3300025908 | Bacteria | 38064 |
| 362 | Ga0207705_10035217 | 3300025909 | Bacteria | 3581 |
| 363 | Ga0207705_10070132 | 3300025909 | Bacteria | 2539 |
| 364 | Ga0207684_10000283 | 3300025910 | Bacteria | 73904 |
| 365 | Ga0207684_10000414 | 3300025910 | Bacteria | 57184 |
| 366 | Ga0207684_10022136 | 3300025910 | Bacteria | 5428 |
| 367 | Ga0207684_10235082 | 3300025910 | Bacteria | 1581 |
| 368 | Ga0207654_10000074 | 3300025911 | Bacteria | 66092 |
| 369 | Ga0207654_10000138 | 3300025911 | Bacteria | 46993 |
| 370 | Ga0207654_10000199 | 3300025911 | Bacteria | 37066 |
| 371 | Ga0207654_10052928 | 3300025911 | Bacteria | 2341 |
| 372 | Ga0207654_10075649 | 3300025911 | Bacteria | 2013 |
| 373 | Ga0207654_10140016 | 3300025911 | Bacteria | 1542 |
| 374 | Ga0207707_10056074 | 3300025912 | Bacteria | 3427 |
| 375 | Ga0207695_10000119 | 3300025913 | Bacteria | 235221 |
| 376 | Ga0207695_10000598 | 3300025913 | Bacteria | 72240 |
| 377 | Ga0207695_10001003 | 3300025913 | Bacteria | 49974 |
| 378 | Ga0207695_10001155 | 3300025913 | Bacteria | 45756 |
| 379 | Ga0207695_10007106 | 3300025913 | Bacteria | 14343 |
| 380 | Ga0207695_10011787 | 3300025913 | Bacteria | 10552 |
| 381 | Ga0207695_10029888 | 3300025913 | Bacteria | 6010 |
| 382 | Ga0207695_10035407 | 3300025913 | Bacteria | 5413 |
| 383 | Ga0207695_10038357 | 3300025913 | Bacteria | 5159 |
| 384 | Ga0207695_10046245 | 3300025913 | Bacteria | 4614 |
| 385 | Ga0207671_10000047 | 3300025914 | Bacteria | 196307 |
| 386 | Ga0207671_10000238 | 3300025914 | Bacteria | 82806 |
| 387 | Ga0207671_10319364 | 3300025914 | Bacteria | 1229 |
| 388 | Ga0207693_10000054 | 3300025915 | Bacteria | 96633 |
| 389 | Ga0207693_10000446 | 3300025915 | Bacteria | 37811 |
| 390 | Ga0207693_10028475 | 3300025915 | Bacteria | 4414 |
| 391 | Ga0207693_10040240 | 3300025915 | Bacteria | 3682 |
| 392 | Ga0207693_10041737 | 3300025915 | Bacteria | 3611 |
| 393 | Ga0207693_10115188 | 3300025915 | Bacteria | 2110 |
| 394 | Ga0207693_10146351 | 3300025915 | Bacteria | 1858 |
| 395 | Ga0207693_10231850 | 3300025915 | Bacteria | 1450 |
| 396 | Ga0207693_10258439 | 3300025915 | Bacteria | 1366 |
| 397 | Ga0207663_10003834 | 3300025916 | Bacteria | 7423 |
| 398 | Ga0207663_10164691 | 3300025916 | Bacteria | 1569 |
| 399 | Ga0207660_10041118 | 3300025917 | Bacteria | 3239 |
| 400 | Ga0207660_10113785 | 3300025917 | Bacteria | 2040 |
| 401 | Ga0207662_10003083 | 3300025918 | Bacteria | 8507 |
| 402 | Ga0207657_10000662 | 3300025919 | Bacteria | 36691 |
| 403 | Ga0207649_10001853 | 3300025920 | Bacteria | 12081 |
| 404 | Ga0207649_10005019 | 3300025920 | Bacteria | 7156 |
| 405 | Ga0207649_10007573 | 3300025920 | Bacteria | 5902 |
| 406 | Ga0207649_10061578 | 3300025920 | Bacteria | 2363 |
| 407 | Ga0207652_10010342 | 3300025921 | Bacteria | 7515 |
| 408 | Ga0207652_10458649 | 3300025921 | Bacteria | 1149 |
| 409 | Ga0207646_10000433 | 3300025922 | Bacteria | 55881 |
| 410 | Ga0207646_10001325 | 3300025922 | Bacteria | 30725 |
| 411 | Ga0207694_10000089 | 3300025924 | Bacteria | 103520 |
| 412 | Ga0207694_10000198 | 3300025924 | Bacteria | 60251 |
| 413 | Ga0207694_10001686 | 3300025924 | Bacteria | 18506 |
| 414 | Ga0207694_10024425 | 3300025924 | Bacteria | 4591 |
| 415 | Ga0207694_10085417 | 3300025924 | Bacteria | 2484 |
| 416 | Ga0207650_10000227 | 3300025925 | Bacteria | 63337 |
| 417 | Ga0207650_10003537 | 3300025925 | Bacteria | 10718 |
| 418 | Ga0207650_10036901 | 3300025925 | Bacteria | 3558 |
| 419 | Ga0207659_10010402 | 3300025926 | Bacteria | 5847 |
| 420 | Ga0207687_10001108 | 3300025927 | Bacteria | 18304 |
| 421 | Ga0207687_10100885 | 3300025927 | Bacteria | 2124 |
| 422 | Ga0207700_10000252 | 3300025928 | Bacteria | 32074 |
| 423 | Ga0207700_10000595 | 3300025928 | Bacteria | 21091 |
| 424 | Ga0207700_10002236 | 3300025928 | Bacteria | 11113 |
| 425 | Ga0207700_10004990 | 3300025928 | Bacteria | 7889 |
| 426 | Ga0207700_10112658 | 3300025928 | Bacteria | 2192 |
| 427 | Ga0207700_10127933 | 3300025928 | Bacteria | 2069 |
| 428 | Ga0207700_10312090 | 3300025928 | Bacteria | 1360 |
| 429 | Ga0207700_10327516 | 3300025928 | Bacteria | 1329 |
| 430 | Ga0207664_10000370 | 3300025929 | Bacteria | 32851 |
| 431 | Ga0207664_10034020 | 3300025929 | Bacteria | 3922 |
| 432 | Ga0207664_10048391 | 3300025929 | Bacteria | 3343 |
| 433 | Ga0207664_10089474 | 3300025929 | Bacteria | 2521 |
| 434 | Ga0207664_10363143 | 3300025929 | Bacteria | 1283 |
| 435 | Ga0207664_10495941 | 3300025929 | Bacteria | 1093 |
| 436 | Ga0207644_10018965 | 3300025931 | Bacteria | 4663 |
| 437 | Ga0207706_10000417 | 3300025933 | Bacteria | 45607 |
| 438 | Ga0207686_10033518 | 3300025934 | Bacteria | 3067 |
| 439 | Ga0207709_10269114 | 3300025935 | Bacteria | 1253 |
| 440 | Ga0207670_10048769 | 3300025936 | Bacteria | 2828 |
| 441 | Ga0207670_10168836 | 3300025936 | Bacteria | 1639 |
| 442 | Ga0207704_10135592 | 3300025938 | Bacteria | 1713 |
| 443 | Ga0207665_10003611 | 3300025939 | Bacteria | 10333 |
| 444 | Ga0207665_10004041 | 3300025939 | Bacteria | 9790 |
| 445 | Ga0207665_10009355 | 3300025939 | Bacteria | 6432 |
| 446 | Ga0207665_10030851 | 3300025939 | Bacteria | 3545 |
| 447 | Ga0207665_10047410 | 3300025939 | Bacteria | 2881 |
| 448 | Ga0207665_10141023 | 3300025939 | Bacteria | 1718 |
| 449 | Ga0207691_10000567 | 3300025940 | Bacteria | 37008 |
| 450 | Ga0207711_10021999 | 3300025941 | Bacteria | 5328 |
| 451 | Ga0207711_10048431 | 3300025941 | Bacteria | 3636 |
| 452 | Ga0207711_10050096 | 3300025941 | Bacteria | 3575 |
| 453 | Ga0207711_10446308 | 3300025941 | Bacteria | 1204 |
| 454 | Ga0207689_10001207 | 3300025942 | Bacteria | 24845 |
| 455 | Ga0207689_10001404 | 3300025942 | Bacteria | 22986 |
| 456 | Ga0207689_10003086 | 3300025942 | Bacteria | 15333 |
| 457 | Ga0207689_10018555 | 3300025942 | Bacteria | 5868 |
| 458 | Ga0207661_10000111 | 3300025944 | Bacteria | 51639 |
| 459 | Ga0207661_10002956 | 3300025944 | Bacteria | 11756 |
| 460 | Ga0207661_10036751 | 3300025944 | Bacteria | 3826 |
| 461 | Ga0207661_10040830 | 3300025944 | Bacteria | 3650 |
| 462 | Ga0207661_10213502 | 3300025944 | Bacteria | 1702 |
| 463 | Ga0207661_10391758 | 3300025944 | Bacteria | 1259 |
| 464 | Ga0207679_10000198 | 3300025945 | Bacteria | 48302 |
| 465 | Ga0207679_10037214 | 3300025945 | Bacteria | 3457 |
| 466 | Ga0207679_10107727 | 3300025945 | Bacteria | 2193 |
| 467 | Ga0207667_10001777 | 3300025949 | Bacteria | 27129 |
| 468 | Ga0207667_10005872 | 3300025949 | Bacteria | 14951 |
| 469 | Ga0207667_10005917 | 3300025949 | Bacteria | 14896 |
| 470 | Ga0207667_10006597 | 3300025949 | Bacteria | 14030 |
| 471 | Ga0207667_10215369 | 3300025949 | Bacteria | 1968 |
| 472 | Ga0207651_10013389 | 3300025960 | Bacteria | 4692 |
| 473 | Ga0207651_10239640 | 3300025960 | Bacteria | 1477 |
| 474 | Ga0207668_10045392 | 3300025972 | Bacteria | 2996 |
| 475 | Ga0207640_10018632 | 3300025981 | Bacteria | 4083 |
| 476 | Ga0207640_10358697 | 3300025981 | Bacteria | 1174 |
| 477 | Ga0207658_10000076 | 3300025986 | Bacteria | 108585 |
| 478 | Ga0207658_10024923 | 3300025986 | Bacteria | 4185 |
| 479 | Ga0207677_10000266 | 3300026023 | Bacteria | 39403 |
| 480 | Ga0207677_10005105 | 3300026023 | Bacteria | 7100 |
| 481 | Ga0207677_10007468 | 3300026023 | Bacteria | 6051 |
| 482 | Ga0207677_10086733 | 3300026023 | Bacteria | 2264 |
| 483 | Ga0207677_10148269 | 3300026023 | Bacteria | 1806 |
| 484 | Ga0207703_10003789 | 3300026035 | Bacteria | 12567 |
| 485 | Ga0207703_10007757 | 3300026035 | Bacteria | 8495 |
| 486 | Ga0207703_10019811 | 3300026035 | Bacteria | 5258 |
| 487 | Ga0207703_10114546 | 3300026035 | Bacteria | 2306 |
| 488 | Ga0207639_10000103 | 3300026041 | Bacteria | 70103 |
| 489 | Ga0207639_10038742 | 3300026041 | Bacteria | 3547 |
| 490 | Ga0207639_10497813 | 3300026041 | Bacteria | 1113 |
| 491 | Ga0207678_10000406 | 3300026067 | Bacteria | 39002 |
| 492 | Ga0207702_10000476 | 3300026078 | Bacteria | 45021 |
| 493 | Ga0207702_10000796 | 3300026078 | Bacteria | 33448 |
| 494 | Ga0207702_10001203 | 3300026078 | Bacteria | 26280 |
| 495 | Ga0207702_10057989 | 3300026078 | Bacteria | 3293 |
| 496 | Ga0207702_10111601 | 3300026078 | Bacteria | 2432 |
| 497 | Ga0207702_10177979 | 3300026078 | Bacteria | 1956 |
| 498 | Ga0207702_10365566 | 3300026078 | Bacteria | 1384 |
| 499 | Ga0207702_10457678 | 3300026078 | Bacteria | 1239 |
| 500 | Ga0207641_10000052 | 3300026088 | Bacteria | 173672 |
| 501 | Ga0207641_10001520 | 3300026088 | Bacteria | 22714 |
| 502 | Ga0207641_10136507 | 3300026088 | Bacteria | 2208 |
| 503 | Ga0207641_10154788 | 3300026088 | Bacteria | 2079 |
| 504 | Ga0207648_10000537 | 3300026089 | Bacteria | 42285 |
| 505 | Ga0207648_10022570 | 3300026089 | Bacteria | 5650 |
| 506 | Ga0207648_10096969 | 3300026089 | Bacteria | 2581 |
| 507 | Ga0207676_10000510 | 3300026095 | Bacteria | 32695 |
| 508 | Ga0207676_10001275 | 3300026095 | Bacteria | 18737 |
| 509 | Ga0207674_10000803 | 3300026116 | Bacteria | 40828 |
| 510 | Ga0207674_10001096 | 3300026116 | Bacteria | 35173 |
| 511 | Ga0207674_10010198 | 3300026116 | Bacteria | 10671 |
| 512 | Ga0207674_10345745 | 3300026116 | Bacteria | 1438 |
| 513 | Ga0207675_100038371 | 3300026118 | Bacteria | 4470 |
| 514 | Ga0207683_10016077 | 3300026121 | Bacteria | 6368 |
| 515 | Ga0207683_10030280 | 3300026121 | Bacteria | 4689 |
| 516 | Ga0207698_10000384 | 3300026142 | Bacteria | 25551 |
| 517 | Ga0207698_10001437 | 3300026142 | Bacteria | 13838 |
| 518 | Ga0207698_10012340 | 3300026142 | Bacteria | 5588 |
| 519 | Ga0207698_10127457 | 3300026142 | Bacteria | 2168 |
| 520 | Ga0207698_10581939 | 3300026142 | Bacteria | 1101 |
| 521 | Ga0209588_1000300 | 3300027671 | Bacteria | 12976 |
| 522 | Ga0265354_1000701 | 3300028016 | Bacteria | 5553 |
| 523 | Ga0268266_10002099 | 3300028379 | Bacteria | 22042 |
| 524 | Ga0268266_10492987 | 3300028379 | Bacteria | 1169 |
| 525 | Ga0268265_10053545 | 3300028380 | Bacteria | 3058 |
| 526 | Ga0268265_10630798 | 3300028380 | Bacteria | 1028 |
| 527 | Ga0268264_10000622 | 3300028381 | Bacteria | 42137 |
| 528 | Ga0268264_10015512 | 3300028381 | Bacteria | 6246 |
| 529 | Ga0265318_10022341 | 3300028577 | Bacteria | 2531 |
| 530 | Ga0265336_10040130 | 3300028666 | Bacteria | 1434 |
| 531 | Ga0265338_10002471 | 3300028800 | Bacteria | 27614 |
| 532 | Ga0265338_10024192 | 3300028800 | Bacteria | 6214 |
| 533 | Ga0265338_10030309 | 3300028800 | Bacteria | 5333 |
| 534 | Ga0265338_10057232 | 3300028800 | Bacteria | 3450 |
| 535 | Ga0265338_10062708 | 3300028800 | Bacteria | 3247 |
| 536 | Ga0265338_10130257 | 3300028800 | Bacteria | 1988 |
| 537 | Ga0265338_10145411 | 3300028800 | Bacteria | 1850 |
| 538 | Ga0265338_10428329 | 3300028800 | Bacteria | 939 |
| 539 | Ga0265762_1000488 | 3300030760 | Bacteria | 6889 |
| 540 | Ga0265770_1000602 | 3300030878 | Bacteria | 4976 |
| 541 | Ga0265770_1002322 | 3300030878 | Bacteria | 2589 |
| 542 | Ga0265770_1012904 | 3300030878 | Bacteria | 1243 |
| 543 | Ga0265765_1001244 | 3300030879 | Bacteria | 2315 |
| 544 | Ga0265765_1012374 | 3300030879 | Bacteria | 966 |
| 545 | Ga0265760_10000004 | 3300031090 | Bacteria | 149429 |
| 546 | Ga0265760_10003176 | 3300031090 | Bacteria | 4807 |
| 547 | Ga0265760_10003551 | 3300031090 | Bacteria | 4523 |
| 548 | Ga0265760_10018254 | 3300031090 | Bacteria | 2018 |
| 549 | Ga0265760_10054174 | 3300031090 | Bacteria | 1211 |
| 550 | Ga0265330_10016502 | 3300031235 | Bacteria | 3405 |
| 551 | Ga0265330_10051726 | 3300031235 | Bacteria | 1800 |
| 552 | Ga0265330_10071971 | 3300031235 | Bacteria | 1496 |
| 553 | Ga0265330_10106875 | 3300031235 | Bacteria | 1196 |
| 554 | Ga0265328_10013480 | 3300031239 | Bacteria | 3234 |
| 555 | Ga0265320_10014282 | 3300031240 | Bacteria | 4527 |
| 556 | Ga0265325_10001002 | 3300031241 | Bacteria | 20321 |
| 557 | Ga0265325_10011355 | 3300031241 | Bacteria | 5118 |
| 558 | Ga0265325_10063396 | 3300031241 | Bacteria | 1870 |
| 559 | Ga0265325_10095057 | 3300031241 | Bacteria | 1465 |
| 560 | Ga0265329_10026170 | 3300031242 | Bacteria | 1925 |
| 561 | Ga0265340_10013477 | 3300031247 | Bacteria | 4293 |
| 562 | Ga0265340_10077823 | 3300031247 | Bacteria | 1564 |
| 563 | Ga0265339_10000026 | 3300031249 | Bacteria | 165764 |
| 564 | Ga0265339_10006499 | 3300031249 | Bacteria | 7662 |
| 565 | Ga0265339_10020456 | 3300031249 | Bacteria | 3866 |
| 566 | Ga0265339_10049454 | 3300031249 | Bacteria | 2302 |
| 567 | Ga0265331_10055339 | 3300031250 | Bacteria | 1887 |
| 568 | Ga0265331_10161555 | 3300031250 | Bacteria | 1015 |
| 569 | Ga0265316_10007137 | 3300031344 | Bacteria | 10562 |
| 570 | Ga0265316_10023164 | 3300031344 | Bacteria | 5221 |
| 571 | Ga0265316_10042856 | 3300031344 | Bacteria | 3613 |
| 572 | Ga0265316_10056146 | 3300031344 | Bacteria | 3078 |
| 573 | Ga0265316_10068614 | 3300031344 | Bacteria | 2738 |
| 574 | Ga0265316_10077223 | 3300031344 | Bacteria | 2557 |
| 575 | Ga0265316_10144565 | 3300031344 | Bacteria | 1784 |
| 576 | Ga0265316_10238546 | 3300031344 | Bacteria | 1337 |
| 577 | Ga0265313_10004027 | 3300031595 | Bacteria | 11483 |
| 578 | Ga0265313_10017181 | 3300031595 | Bacteria | 4122 |
| 579 | Ga0265314_10000027 | 3300031711 | Bacteria | 278331 |
| 580 | Ga0265314_10001129 | 3300031711 | Bacteria | 30906 |
| 581 | Ga0265342_10001088 | 3300031712 | Bacteria | 26276 |
| 582 | Ga0265342_10003716 | 3300031712 | Bacteria | 12371 |
| 583 | Ga0265342_10010070 | 3300031712 | Bacteria | 6593 |
| 584 | Ga0265342_10014725 | 3300031712 | Bacteria | 5181 |
| 585 | Ga0265342_10116157 | 3300031712 | Bacteria | 1510 |
| 586 | Ga0265342_10122531 | 3300031712 | Bacteria | 1463 |
| 587 | Ga0265342_10247958 | 3300031712 | Bacteria | 951 |
| 588 | Ga0307410_10026419 | 3300031852 | Bacteria | 3655 |
| 589 | Ga0307410_10055566 | 3300031852 | Bacteria | 2688 |
| 590 | Ga0307406_10109943 | 3300031901 | Bacteria | 1896 |
| 591 | Ga0307406_10196916 | 3300031901 | Bacteria | 1480 |
| 592 | Ga0307412_10038414 | 3300031911 | Bacteria | 3083 |
| 593 | Ga0307409_100003218 | 3300031995 | Bacteria | 8794 |
| 594 | Ga0307409_100190214 | 3300031995 | Bacteria | 1826 |
| 595 | Ga0307416_100156518 | 3300032002 | Bacteria | 2099 |
| 596 | Ga0307414_10036710 | 3300032004 | Bacteria | 3275 |
| 597 | Ga0307415_100093447 | 3300032126 | Bacteria | 2184 |
| 598 | Ga0316212_1006505 | 3300033547 | Bacteria | 1692 |
| 599 | Ga0373926_0006926 | 3300035083 | Bacteria | 3768 |
| 600 | Ga0373934_0000404 | 3300035086 | Bacteria | 15111 |
| 601 | Ga0373944_0036806 | 3300035089 | Bacteria | 1497 |
| 602 | Ga0373923_0003069 | 3300035111 | Bacteria | 5287 |
| 603 | Ga0373923_0049425 | 3300035111 | Bacteria | 1759 |
| 604 | Ga0373936_0002785 | 3300035113 | Bacteria | 6517 |
| 605 | Ga0373936_0003142 | 3300035113 | Bacteria | 6181 |
| 606 | Ga0373945_0001964 | 3300035116 | Bacteria | 6379 |
| 607 | Ga0373954_0000224 | 3300035118 | Bacteria | 20728 |
| 608 | Ga0373956_0001105 | 3300035119 | Bacteria | 11121 |
| 609 | Ga0373957_0032284 | 3300035120 | Bacteria | 1927 |
| 610 | Ga0373957_0039100 | 3300035120 | Bacteria | 1778 |
| 611 | Ga0373960_0002247 | 3300035121 | Bacteria | 4346 |
| 612 | Ga0373943_0001585 | 3300035170 | Bacteria | 10297 |
| 613 | Ga0373943_0014755 | 3300035170 | Bacteria | 3543 |
| 614 | Ga0373943_0076764 | 3300035170 | Bacteria | 1705 |
| 615 | Ga0373943_0194782 | 3300035170 | Bacteria | 1119 |
| 616 | Ga0373946_0011405 | 3300035171 | Bacteria | 3316 |
| 617 | Ga0373955_0000521 | 3300035172 | Bacteria | 16367 |
| 618 | Ga0373955_0023790 | 3300035172 | Bacteria | 3125 |
| 619 | Ga0373955_0040947 | 3300035172 | Bacteria | 2481 |
| 620 | Ga0373924_0008466 | 3300035410 | Bacteria | 3741 |
| 621 | Ga0373924_0063975 | 3300035410 | Bacteria | 1543 |
| 622 | Ga0373931_0014910 | 3300035691 | Bacteria | 3808 |
| 623 | Ga0373931_0062918 | 3300035691 | Bacteria | 2004 |
| 624 | Ga0373935_0010715 | 3300035692 | Bacteria | 5506 |
| 625 | Ga0373935_0010969 | 3300035692 | Bacteria | 5442 |
| 626 | Ga0373935_0020173 | 3300035692 | Bacteria | 4069 |
| 627 | Ga0373935_0095867 | 3300035692 | Bacteria | 1949 |
| 628 | Ga0373927_0000705 | 3300035695 | Bacteria | 25605 |
| 629 | Ga0373927_0016272 | 3300035695 | Bacteria | 4908 |
| 630 | Ga0373927_0099070 | 3300035695 | Bacteria | 1895 |
| 631 | Ga0373927_0103647 | 3300035695 | Bacteria | 1851 |
| 632 | Ga0373927_0159178 | 3300035695 | Bacteria | 1479 |
| 633 | Ga0373927_0377675 | 3300035695 | Bacteria | 934 |
| 634 | Ga0373933_0001196 | 3300035724 | Bacteria | 15359 |
| 635 | Ga0373947_0000098 | 3300035725 | Bacteria | 44133 |
| 636 | Ga0373947_0001211 | 3300035725 | Bacteria | 15877 |
| 637 | Ga0373947_0007307 | 3300035725 | Bacteria | 6397 |
| 638 | Ga0373947_0207103 | 3300035725 | Bacteria | 1285 |
| 639 | Ga0373937_0006834 | 3300036401 | Bacteria | 9844 |
| 640 | Ga0373937_0022927 | 3300036401 | Bacteria | 5614 |
| 641 | Ga0373937_0076583 | 3300036401 | Bacteria | 3089 |
| 642 | Ga0373937_0118008 | 3300036401 | Bacteria | 2471 |
| 643 | Ga0373937_0245157 | 3300036401 | Bacteria | 1689 |
| 644 | Ga0373937_0371883 | 3300036401 | Bacteria | 1355 |
| 645 | Ga0373937_0520630 | 3300036401 | Bacteria | 1130 |
| 646 | Ga0373937_0710474 | 3300036401 | Bacteria | 952 |
| 647 | Ga0373925_0002146 | 3300037068 | Bacteria | 16118 |
| 648 | Ga0373925_0002505 | 3300037068 | Bacteria | 14678 |
| 649 | Ga0373925_0008716 | 3300037068 | Bacteria | 7388 |
| 650 | Ga0373925_0015235 | 3300037068 | Bacteria | 5559 |
| 651 | Ga0373925_0070341 | 3300037068 | Bacteria | 2645 |
| 652 | Ga0373925_0155499 | 3300037068 | Bacteria | 1798 |
| 653 | Ga0395905_0019672 | 3300037471 | Bacteria | 6399 |
| 654 | Ga0395905_0047114 | 3300037471 | Bacteria | 4042 |
| 655 | Ga0395905_0069760 | 3300037471 | Bacteria | 3292 |
| 656 | Ga0395905_0090202 | 3300037471 | Bacteria | 2873 |
| 657 | Ga0395905_0381212 | 3300037471 | Bacteria | 1304 |
| 658 | Ga0436364_0595239 | 3300037853 | Bacteria | 105667 |
| 659 | Ga0436360_0017782 | 3300039438 | Bacteria | 5268 |
| 660 | Ga0436361_0063152 | 3300039447 | Bacteria | 16055 |
| 661 | Ga0436361_0684605 | 3300039447 | Bacteria | 16884 |
| 662 | Ga0436363_0563853 | 3300039450 | Bacteria | 3393 |
| 663 | Ga0451577_0371796 | 3300042876 | Bacteria | 1297 |
| 664 | Ga0451577_0394681 | 3300042876 | Bacteria | 1256 |
| 665 | Ga0466963_0061959 | 3300044694 | Bacteria | 2502 |
| 666 | Ga0451576_0192585 | 3300045051 | Bacteria | 2130 |
| 667 | Ga0466967_0026088 | 3300045976 | Bacteria | 4833 |
| 668 | Ga0466967_0062269 | 3300045976 | Bacteria | 3311 |
| 669 | Ga0495592_0004618 | 3300046454 | Bacteria | 10086 |
| 670 | Ga0495629_0029703 | 3300046459 | Bacteria | 3876 |
| 671 | Ga0495651_0001722 | 3300046462 | Bacteria | 16879 |
| 672 | Ga0495651_0006546 | 3300046462 | Bacteria | 8896 |
| 673 | Ga0495651_0057396 | 3300046462 | Bacteria | 2989 |
| 674 | Ga0495653_0025724 | 3300046463 | Bacteria | 4722 |
| 675 | Ga0495653_0120492 | 3300046463 | Bacteria | 1871 |
| 676 | Ga0495653_0184859 | 3300046463 | Bacteria | 1427 |
| 677 | Ga0495580_0000007 | 3300046472 | Bacteria | 103420 |
| 678 | Ga0495580_0000616 | 3300046472 | Bacteria | 30136 |
| 679 | Ga0495580_0001673 | 3300046472 | Bacteria | 19470 |
| 680 | Ga0495580_0005636 | 3300046472 | Bacteria | 10300 |
| 681 | Ga0495580_0005942 | 3300046472 | Bacteria | 10013 |
| 682 | Ga0495580_0054936 | 3300046472 | Bacteria | 2808 |
| 683 | Ga0495580_0077068 | 3300046472 | Bacteria | 2325 |
| 684 | Ga0495582_0000596 | 3300046473 | Bacteria | 19949 |
| 685 | Ga0495582_0028246 | 3300046473 | Bacteria | 3078 |
| 686 | Ga0495664_0280043 | 3300046477 | Bacteria | 1008 |
| 687 | Ga0495608_0017454 | 3300046511 | Bacteria | 4964 |
| 688 | Ga0495608_0024797 | 3300046511 | Bacteria | 4098 |
| 689 | Ga0495628_0000986 | 3300046516 | Bacteria | 26034 |
| 690 | Ga0495628_0012015 | 3300046516 | Bacteria | 7304 |
| 691 | Ga0495628_0194153 | 3300046516 | Bacteria | 1532 |
| 692 | Ga0495628_0372698 | 3300046516 | Bacteria | 1047 |
| 693 | Ga0495630_0004524 | 3300046517 | Bacteria | 9743 |
| 694 | Ga0495630_0019124 | 3300046517 | Bacteria | 5034 |
| 695 | Ga0495630_0049307 | 3300046517 | Bacteria | 3152 |
| 696 | Ga0495630_0066967 | 3300046517 | Bacteria | 2700 |
| 697 | Ga0495630_0137018 | 3300046517 | Bacteria | 1860 |
| 698 | Ga0495630_0215039 | 3300046517 | Bacteria | 1467 |
| 699 | Ga0495652_0005269 | 3300046529 | Bacteria | 12200 |
| 700 | Ga0495652_0178033 | 3300046529 | Bacteria | 1635 |
| 701 | Ga0495665_0009559 | 3300046531 | Bacteria | 5253 |
| 702 | Ga0495640_0160338 | 3300046533 | Bacteria | 1442 |
| 703 | Ga0495640_0229867 | 3300046533 | Bacteria | 1167 |
| 704 | Ga0495586_0062141 | 3300046535 | Bacteria | 2033 |
| 705 | Ga0495586_0110116 | 3300046535 | Bacteria | 1532 |
| 706 | Ga0495587_0002546 | 3300046536 | Bacteria | 12190 |
| 707 | Ga0495587_0004017 | 3300046536 | Bacteria | 9749 |
| 708 | Ga0495645_0004522 | 3300046543 | Bacteria | 9493 |
| 709 | Ga0495667_0008035 | 3300046559 | Bacteria | 7158 |
| 710 | Ga0495667_0011423 | 3300046559 | Bacteria | 6009 |
| 711 | Ga0495667_0019669 | 3300046559 | Bacteria | 4555 |
| 712 | Ga0495634_0040225 | 3300046642 | Bacteria | 3181 |
| 713 | Ga0495634_0304811 | 3300046642 | Bacteria | 962 |
| 714 | Ga0495625_0096041 | 3300046660 | Bacteria | 2042 |
| 715 | Ga0495635_0054021 | 3300046663 | Bacteria | 2767 |
| 716 | Ga0495657_0124534 | 3300046675 | Bacteria | 1620 |
| 717 | Ga0495599_0015185 | 3300046678 | Bacteria | 4776 |
| 718 | Ga0495599_0298485 | 3300046678 | Bacteria | 973 |
| 719 | Ga0495623_0004319 | 3300046679 | Bacteria | 9354 |
| 720 | Ga0495623_0026906 | 3300046679 | Bacteria | 3701 |
| 721 | Ga0495623_0063746 | 3300046679 | Bacteria | 2307 |
| 722 | Ga0495646_0182180 | 3300046680 | Bacteria | 1152 |
| 723 | Ga0495600_0001209 | 3300046809 | Bacteria | 14159 |
| 724 | Ga0495600_0114690 | 3300046809 | Bacteria | 1754 |
| 725 | Ga0495581_0044528 | 3300047315 | Bacteria | 2566 |
| 726 | Ga0495604_0000910 | 3300047317 | Bacteria | 24583 |
| 727 | Ga0495604_0001439 | 3300047317 | Bacteria | 19540 |
| 728 | Ga0495604_0096793 | 3300047317 | Bacteria | 2177 |
| 729 | Ga0495674_0005521 | 3300047319 | Bacteria | 12132 |
| 730 | Ga0495674_0010450 | 3300047319 | Bacteria | 8788 |
| 731 | Ga0495674_0011051 | 3300047319 | Bacteria | 8525 |
| 732 | Ga0495674_0028291 | 3300047319 | Bacteria | 5114 |
| 733 | Ga0495674_0108374 | 3300047319 | Bacteria | 2357 |
| 734 | Ga0495674_0125797 | 3300047319 | Bacteria | 2163 |
| 735 | Ga0495680_0004430 | 3300047322 | Bacteria | 13421 |
| 736 | Ga0495680_0005530 | 3300047322 | Bacteria | 11861 |
| 737 | Ga0495680_0013756 | 3300047322 | Bacteria | 7042 |
| 738 | Ga0495675_0000586 | 3300047444 | Bacteria | 23418 |
| 739 | Ga0495675_0066528 | 3300047444 | Bacteria | 2278 |
| 740 | Ga0495684_0000891 | 3300047471 | Bacteria | 24204 |
| 741 | Ga0495684_0002088 | 3300047471 | Bacteria | 16070 |
| 742 | Ga0495684_0042674 | 3300047471 | Bacteria | 3473 |
| 743 | Ga0495602_0021671 | 3300048088 | Bacteria | 6316 |
| 744 | Ga0495602_0054057 | 3300048088 | Bacteria | 3549 |
| 745 | Ga0495602_0055423 | 3300048088 | Bacteria | 3491 |
| 746 | Ga0495602_0135472 | 3300048088 | Bacteria | 1957 |
| 747 | Ga0495602_0210783 | 3300048088 | Bacteria | 1475 |
| 748 | Ga0495602_0321004 | 3300048088 | Bacteria | 1127 |
| 749 | Ga0496100_0010694 | 3300048903 | Bacteria | 5204 |
| 750 | Ga0496100_0028214 | 3300048903 | Bacteria | 3461 |
| 751 | Ga0496100_0136980 | 3300048903 | Bacteria | 1731 |
| 752 | Ga0496101_0054727 | 3300048904 | Bacteria | 2881 |
| 753 | Ga0496101_0085054 | 3300048904 | Bacteria | 2343 |
| 754 | Ga0496102_0023540 | 3300048905 | Bacteria | 5472 |
| 755 | Ga0496102_0041679 | 3300048905 | Bacteria | 4159 |
| 756 | Ga0496102_0122189 | 3300048905 | Bacteria | 2433 |
| 757 | Ga0496103_0004099 | 3300048906 | Bacteria | 8856 |
| 758 | Ga0496104_0002935 | 3300048907 | Bacteria | 14692 |
| 759 | Ga0496104_0022237 | 3300048907 | Bacteria | 5823 |
| 760 | Ga0496104_0027472 | 3300048907 | Bacteria | 5266 |
| 761 | Ga0496104_0088978 | 3300048907 | Bacteria | 2950 |
| 762 | Ga0496104_0530688 | 3300048907 | Bacteria | 1088 |
| 763 | Ga0496105_0025158 | 3300048908 | Bacteria | 4843 |
| 764 | Ga0496105_0150797 | 3300048908 | Bacteria | 1911 |
| 765 | Ga0496106_0056476 | 3300048909 | Bacteria | 2967 |
| 766 | Ga0496107_0020293 | 3300048910 | Bacteria | 4692 |
| 767 | Ga0496107_0051391 | 3300048910 | Bacteria | 2973 |
| 768 | Ga0496107_0301290 | 3300048910 | Bacteria | 1193 |
| 769 | Ga0496108_0001842 | 3300048911 | Bacteria | 16943 |
| 770 | Ga0496108_0160302 | 3300048911 | Bacteria | 1944 |
| 771 | Ga0496109_0000178 | 3300048912 | Bacteria | 63365 |
| 772 | Ga0496110_0001986 | 3300048913 | Bacteria | 15204 |
| 773 | Ga0496110_0399971 | 3300048913 | Bacteria | 1252 |
| 774 | Ga0496111_0005461 | 3300048914 | Bacteria | 8148 |
| 775 | Ga0496112_0000068 | 3300048915 | Bacteria | 68390 |
| 776 | Ga0496112_0010744 | 3300048915 | Bacteria | 8325 |
| 777 | Ga0496112_0022198 | 3300048915 | Bacteria | 6049 |
| 778 | Ga0496112_0024389 | 3300048915 | Bacteria | 5790 |
| 779 | Ga0496112_0040934 | 3300048915 | Bacteria | 4532 |
| 780 | Ga0496112_0292122 | 3300048915 | Bacteria | 1576 |
| 781 | Ga0496112_0719641 | 3300048915 | Bacteria | 925 |
| 782 | Ga0496113_0003902 | 3300048916 | Bacteria | 9036 |
| 783 | Ga0496114_0037963 | 3300048917 | Bacteria | 3984 |
| 784 | Ga0496114_0215583 | 3300048917 | Bacteria | 1684 |
| 785 | Ga0496114_0327437 | 3300048917 | Bacteria | 1354 |
| 786 | Ga0496115_0007191 | 3300048918 | Bacteria | 8179 |
| 787 | Ga0496115_0034019 | 3300048918 | Bacteria | 4027 |
| 788 | Ga0496115_0063161 | 3300048918 | Bacteria | 2987 |
| 789 | Ga0496126_0001003 | 3300048929 | Bacteria | 48082 |
| 790 | Ga0496126_0003062 | 3300048929 | Bacteria | 21661 |
| 791 | Ga0496126_0111699 | 3300048929 | Bacteria | 2380 |
| 792 | Ga0501036_0062117 | 3300049572 | Bacteria | 3164 |
| 793 | Ga0501038_0163667 | 3300049574 | Bacteria | 1806 |
| 794 | Ga0501039_0022894 | 3300049575 | Bacteria | 4793 |
| 795 | Ga0501048_0123646 | 3300049582 | Bacteria | 1829 |
| 796 | Ga0501071_0290700 | 3300049587 | Bacteria | 1238 |
| 797 | Ga0501075_0072217 | 3300049591 | Bacteria | 2609 |
| 798 | Ga0501079_0090591 | 3300049741 | Bacteria | 2369 |
| 799 | Ga0501081_0021619 | 3300049743 | Bacteria | 4294 |
| 800 | Ga0501045_0325196 | 3300049824 | Bacteria | 1144 |
| 801 | nmdc:mga05p37_168803_c1 | 3300050507 | Bacteria | 2669 |
| 802 | nmdc:mga09592_69077_c1 | 3300050508 | Bacteria | 2997 |
| 803 | nmdc:mga0qj67_2331_c1 | 3300050509 | Bacteria | 13498 |
| 804 | nmdc:mga06r32_111777_c1 | 3300050510 | Bacteria | 2689 |
| 805 | nmdc:mga0n895_910_c1 | 3300050512 | Bacteria | 21318 |
| 806 | nmdc:mga0rr50_143436_c1 | 3300050513 | Bacteria | 1923 |
| 807 | nmdc:mga0rr50_2425_c2 | 3300050513 | Bacteria | 8267 |
| 808 | nmdc:mga0rr50_68603_c1 | 3300050513 | Bacteria | 2697 |
| 809 | nmdc:mga08x19_1302_c1 | 3300050514 | Bacteria | 15495 |
| 810 | nmdc:mga08x19_151853_c1 | 3300050514 | Bacteria | 1569 |
| 811 | Ga0495601_0146043 | 3300053077 | Bacteria | 1544 |
| 812 | Ga0495619_0052150 | 3300053085 | Bacteria | 2704 |
| 813 | Ga0530510_0074219 | 3300061734 | Bacteria | 2469 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021388 | Ga0213875_10000318 | Ga0213875_100003189 | 259 |
| 2 | 3300037853 | Ga0436364_0595239 | Ga0436364_0595239_8150_9025 | 259 |
| 3 | 3300031090 | Ga0265760_10000004 | Ga0265760_1000000493 | 264 |
| 4 | 3300006028 | Ga0070717_10002337 | Ga0070717_100023377 | 265 |
| 5 | 3300005549 | Ga0070704_100226175 | Ga0070704_1002261752 | 266 |
| 6 | 3300028380 | Ga0268265_10630798 | Ga0268265_106307981 | 266 |
| 7 | 3300005547 | Ga0070693_100104615 | Ga0070693_1001046153 | 267 |
| 8 | 3300006163 | Ga0070715_10025595 | Ga0070715_100255951 | 267 |
| 9 | 3300006237 | Ga0097621_100385173 | Ga0097621_1003851732 | 267 |
| 10 | 3300009093 | Ga0105240_10309065 | Ga0105240_103090652 | 267 |
| 11 | 3300013297 | Ga0157378_10168535 | Ga0157378_101685352 | 267 |
| 12 | 3300025915 | Ga0207693_10040240 | Ga0207693_100402402 | 267 |
| 13 | 3300025939 | Ga0207665_10141023 | Ga0207665_101410233 | 267 |
| 14 | 3300028016 | Ga0265354_1000701 | Ga0265354_10007016 | 267 |
| 15 | 3300030878 | Ga0265770_1000602 | Ga0265770_10006026 | 267 |
| 16 | 3300030878 | Ga0265770_1002322 | Ga0265770_10023223 | 267 |
| 17 | 3300030879 | Ga0265765_1001244 | Ga0265765_10012442 | 267 |
| 18 | 3300030879 | Ga0265765_1012374 | Ga0265765_10123741 | 267 |
| 19 | 3300031090 | Ga0265760_10003176 | Ga0265760_100031765 | 267 |
| 20 | 3300031090 | Ga0265760_10003551 | Ga0265760_100035512 | 267 |
| 21 | 3300035086 | Ga0373934_0000404 | Ga0373934_0000404_11902_12771 | 267 |
| 22 | 3300035118 | Ga0373954_0000224 | Ga0373954_0000224_7565_8434 | 267 |
| 23 | 3300035119 | Ga0373956_0001105 | Ga0373956_0001105_8385_9254 | 267 |
| 24 | 3300035120 | Ga0373957_0039100 | Ga0373957_0039100_510_1379 | 267 |
| 25 | 3300035172 | Ga0373955_0000521 | Ga0373955_0000521_5973_6842 | 267 |
| 26 | 3300035724 | Ga0373933_0001196 | Ga0373933_0001196_6846_7715 | 267 |
| 27 | 3300036401 | Ga0373937_0076583 | Ga0373937_0076583_2125_2994 | 267 |
| 28 | 3300046462 | Ga0495651_0057396 | Ga0495651_0057396_1920_2789 | 267 |
| 29 | 3300046463 | Ga0495653_0120492 | Ga0495653_0120492_178_1047 | 267 |
| 30 | 3300046517 | Ga0495630_0019124 | Ga0495630_0019124_751_1620 | 267 |
| 31 | 3300046533 | Ga0495640_0229867 | Ga0495640_0229867_135_1004 | 267 |
| 32 | 3300046535 | Ga0495586_0062141 | Ga0495586_0062141_923_1792 | 267 |
| 33 | 3300046536 | Ga0495587_0002546 | Ga0495587_0002546_9281_10150 | 267 |
| 34 | 3300046679 | Ga0495623_0004319 | Ga0495623_0004319_1701_2570 | 267 |
| 35 | 3300047317 | Ga0495604_0000910 | Ga0495604_0000910_13644_14513 | 267 |
| 36 | 3300047471 | Ga0495684_0042674 | Ga0495684_0042674_2509_3378 | 267 |
| 37 | 3300048088 | Ga0495602_0055423 | Ga0495602_0055423_2547_3416 | 267 |
| 38 | 3300048915 | Ga0496112_0040934 | Ga0496112_0040934_1111_1980 | 267 |
| 39 | 3300049824 | Ga0501045_0325196 | Ga0501045_0325196_159_1028 | 267 |
| 40 | 3300050513 | nmdc:mga0rr50_143436_c1 | nmdc:mga0rr50_143436_c1_187_1059 | 267 |
| 41 | 3300005327 | Ga0070658_10207850 | Ga0070658_102078502 | 268 |
| 42 | 3300005329 | Ga0070683_100001214 | Ga0070683_1000012143 | 268 |
| 43 | 3300005329 | Ga0070683_100010141 | Ga0070683_1000101416 | 268 |
| 44 | 3300005329 | Ga0070683_100059328 | Ga0070683_1000593284 | 268 |
| 45 | 3300005331 | Ga0070670_100025125 | Ga0070670_1000251253 | 268 |
| 46 | 3300005334 | Ga0068869_100001306 | Ga0068869_1000013065 | 268 |
| 47 | 3300005335 | Ga0070666_10006701 | Ga0070666_100067014 | 268 |
| 48 | 3300005335 | Ga0070666_10078904 | Ga0070666_100789042 | 268 |
| 49 | 3300005338 | Ga0068868_100000161 | Ga0068868_10000016117 | 268 |
| 50 | 3300005338 | Ga0068868_100017936 | Ga0068868_1000179363 | 268 |
| 51 | 3300005344 | Ga0070661_100012417 | Ga0070661_1000124176 | 268 |
| 52 | 3300005344 | Ga0070661_100017342 | Ga0070661_1000173422 | 268 |
| 53 | 3300005355 | Ga0070671_100028590 | Ga0070671_1000285903 | 268 |
| 54 | 3300005355 | Ga0070671_100047488 | Ga0070671_1000474882 | 268 |
| 55 | 3300005364 | Ga0070673_100032826 | Ga0070673_1000328262 | 268 |
| 56 | 3300005367 | Ga0070667_100000343 | Ga0070667_10000034326 | 268 |
| 57 | 3300005436 | Ga0070713_100005973 | Ga0070713_1000059733 | 268 |
| 58 | 3300005535 | Ga0070684_100000175 | Ga0070684_10000017521 | 268 |
| 59 | 3300005539 | Ga0068853_100000389 | Ga0068853_10000038926 | 268 |
| 60 | 3300005563 | Ga0068855_100001498 | Ga0068855_10000149818 | 268 |
| 61 | 3300005563 | Ga0068855_100002300 | Ga0068855_10000230020 | 268 |
| 62 | 3300005563 | Ga0068855_100028592 | Ga0068855_1000285922 | 268 |
| 63 | 3300005563 | Ga0068855_100044544 | Ga0068855_1000445443 | 268 |
| 64 | 3300005564 | Ga0070664_100051825 | Ga0070664_1000518253 | 268 |
| 65 | 3300005564 | Ga0070664_100066482 | Ga0070664_1000664822 | 268 |
| 66 | 3300005577 | Ga0068857_100000481 | Ga0068857_10000048114 | 268 |
| 67 | 3300005578 | Ga0068854_100290684 | Ga0068854_1002906842 | 268 |
| 68 | 3300005614 | Ga0068856_100000671 | Ga0068856_10000067116 | 268 |
| 69 | 3300005614 | Ga0068856_100002276 | Ga0068856_10000227614 | 268 |
| 70 | 3300005616 | Ga0068852_100000028 | Ga0068852_10000002885 | 268 |
| 71 | 3300005616 | Ga0068852_100000191 | Ga0068852_1000001912 | 268 |
| 72 | 3300005616 | Ga0068852_100016117 | Ga0068852_1000161172 | 268 |
| 73 | 3300005616 | Ga0068852_100140566 | Ga0068852_1001405662 | 268 |
| 74 | 3300005617 | Ga0068859_100095740 | Ga0068859_1000957401 | 268 |
| 75 | 3300005618 | Ga0068864_100004314 | Ga0068864_1000043148 | 268 |
| 76 | 3300005834 | Ga0068851_10010774 | Ga0068851_100107743 | 268 |
| 77 | 3300005834 | Ga0068851_10032692 | Ga0068851_100326923 | 268 |
| 78 | 3300005834 | Ga0068851_10044734 | Ga0068851_100447342 | 268 |
| 79 | 3300005834 | Ga0068851_10083770 | Ga0068851_100837702 | 268 |
| 80 | 3300005841 | Ga0068863_100000933 | Ga0068863_10000093312 | 268 |
| 81 | 3300005842 | Ga0068858_100001871 | Ga0068858_10000187119 | 268 |
| 82 | 3300005842 | Ga0068858_100012399 | Ga0068858_1000123993 | 268 |
| 83 | 3300005843 | Ga0068860_100000608 | Ga0068860_10000060821 | 268 |
| 84 | 3300006173 | Ga0070716_100034442 | Ga0070716_1000344422 | 268 |
| 85 | 3300006175 | Ga0070712_100333899 | Ga0070712_1003338991 | 268 |
| 86 | 3300006237 | Ga0097621_100000561 | Ga0097621_10000056116 | 268 |
| 87 | 3300006237 | Ga0097621_100012142 | Ga0097621_1000121424 | 268 |
| 88 | 3300006358 | Ga0068871_100000647 | Ga0068871_10000064710 | 268 |
| 89 | 3300006844 | Ga0075428_100104384 | Ga0075428_1001043843 | 268 |
| 90 | 3300006846 | Ga0075430_100027811 | Ga0075430_1000278116 | 268 |
| 91 | 3300006847 | Ga0075431_100039845 | Ga0075431_1000398453 | 268 |
| 92 | 3300006847 | Ga0075431_100322653 | Ga0075431_1003226531 | 268 |
| 93 | 3300006880 | Ga0075429_100539160 | Ga0075429_1005391601 | 268 |
| 94 | 3300006931 | Ga0097620_100095747 | Ga0097620_1000957471 | 268 |
| 95 | 3300007265 | Ga0099794_10000543 | Ga0099794_100005435 | 268 |
| 96 | 3300009093 | Ga0105240_10000735 | Ga0105240_1000073520 | 268 |
| 97 | 3300009093 | Ga0105240_10000796 | Ga0105240_1000079617 | 268 |
| 98 | 3300009093 | Ga0105240_10001270 | Ga0105240_100012704 | 268 |
| 99 | 3300009093 | Ga0105240_10005354 | Ga0105240_100053547 | 268 |
| 100 | 3300009093 | Ga0105240_10018325 | Ga0105240_100183255 | 268 |
| 101 | 3300009093 | Ga0105240_10043745 | Ga0105240_100437452 | 268 |
| 102 | 3300009093 | Ga0105240_10057253 | Ga0105240_100572533 | 268 |
| 103 | 3300009098 | Ga0105245_10000204 | Ga0105245_1000020418 | 268 |
| 104 | 3300009098 | Ga0105245_10027085 | Ga0105245_100270852 | 268 |
| 105 | 3300009101 | Ga0105247_10009145 | Ga0105247_100091451 | 268 |
| 106 | 3300009147 | Ga0114129_10176610 | Ga0114129_101766104 | 268 |
| 107 | 3300009174 | Ga0105241_10000162 | Ga0105241_1000016233 | 268 |
| 108 | 3300009174 | Ga0105241_10000233 | Ga0105241_1000023328 | 268 |
| 109 | 3300009174 | Ga0105241_10076855 | Ga0105241_100768552 | 268 |
| 110 | 3300009177 | Ga0105248_10001505 | Ga0105248_1000150514 | 268 |
| 111 | 3300009177 | Ga0105248_10069389 | Ga0105248_100693892 | 268 |
| 112 | 3300009545 | Ga0105237_10014468 | Ga0105237_100144681 | 268 |
| 113 | 3300009545 | Ga0105237_10529851 | Ga0105237_105298512 | 268 |
| 114 | 3300009551 | Ga0105238_10000252 | Ga0105238_1000025220 | 268 |
| 115 | 3300009551 | Ga0105238_10000373 | Ga0105238_1000037319 | 268 |
| 116 | 3300009551 | Ga0105238_10005396 | Ga0105238_100053967 | 268 |
| 117 | 3300009551 | Ga0105238_10015341 | Ga0105238_100153413 | 268 |
| 118 | 3300009551 | Ga0105238_10117302 | Ga0105238_101173022 | 268 |
| 119 | 3300010375 | Ga0105239_10000774 | Ga0105239_1000077428 | 268 |
| 120 | 3300010375 | Ga0105239_10003276 | Ga0105239_1000327616 | 268 |
| 121 | 3300010375 | Ga0105239_10055427 | Ga0105239_100554272 | 268 |
| 122 | 3300010375 | Ga0105239_10115544 | Ga0105239_101155444 | 268 |
| 123 | 3300010375 | Ga0105239_10337868 | Ga0105239_103378682 | 268 |
| 124 | 3300013100 | Ga0157373_10289812 | Ga0157373_102898122 | 268 |
| 125 | 3300013104 | Ga0157370_10000003 | Ga0157370_1000000363 | 268 |
| 126 | 3300013105 | Ga0157369_10000767 | Ga0157369_100007672 | 268 |
| 127 | 3300013105 | Ga0157369_10011205 | Ga0157369_1001120510 | 268 |
| 128 | 3300013105 | Ga0157369_10016768 | Ga0157369_100167685 | 268 |
| 129 | 3300013105 | Ga0157369_10076109 | Ga0157369_100761092 | 268 |
| 130 | 3300013296 | Ga0157374_10001833 | Ga0157374_1000183313 | 268 |
| 131 | 3300013296 | Ga0157374_10019314 | Ga0157374_100193141 | 268 |
| 132 | 3300013296 | Ga0157374_10027731 | Ga0157374_100277314 | 268 |
| 133 | 3300013296 | Ga0157374_10075742 | Ga0157374_100757422 | 268 |
| 134 | 3300013296 | Ga0157374_10098749 | Ga0157374_100987491 | 268 |
| 135 | 3300013297 | Ga0157378_10000427 | Ga0157378_1000042724 | 268 |
| 136 | 3300013297 | Ga0157378_10198443 | Ga0157378_101984432 | 268 |
| 137 | 3300013306 | Ga0163162_10042969 | Ga0163162_100429695 | 268 |
| 138 | 3300013307 | Ga0157372_10000489 | Ga0157372_1000048934 | 268 |
| 139 | 3300013307 | Ga0157372_10002530 | Ga0157372_1000253015 | 268 |
| 140 | 3300013307 | Ga0157372_10005787 | Ga0157372_100057876 | 268 |
| 141 | 3300013307 | Ga0157372_10033266 | Ga0157372_100332661 | 268 |
| 142 | 3300013307 | Ga0157372_10109569 | Ga0157372_101095692 | 268 |
| 143 | 3300013307 | Ga0157372_10598166 | Ga0157372_105981661 | 268 |
| 144 | 3300013308 | Ga0157375_10180667 | Ga0157375_101806672 | 268 |
| 145 | 3300014325 | Ga0163163_10000356 | Ga0163163_1000035624 | 268 |
| 146 | 3300014968 | Ga0157379_10001161 | Ga0157379_1000116116 | 268 |
| 147 | 3300014969 | Ga0157376_10001779 | Ga0157376_100017797 | 268 |
| 148 | 3300014969 | Ga0157376_10395324 | Ga0157376_103953242 | 268 |
| 149 | 3300017792 | Ga0163161_10039515 | Ga0163161_100395152 | 268 |
| 150 | 3300024227 | Ga0228598_1007044 | Ga0228598_10070444 | 268 |
| 151 | 3300025321 | Ga0207656_10008959 | Ga0207656_100089591 | 268 |
| 152 | 3300025321 | Ga0207656_10017570 | Ga0207656_100175702 | 268 |
| 153 | 3300025321 | Ga0207656_10131912 | Ga0207656_101319121 | 268 |
| 154 | 3300025900 | Ga0207710_10002111 | Ga0207710_100021117 | 268 |
| 155 | 3300025903 | Ga0207680_10036670 | Ga0207680_100366701 | 268 |
| 156 | 3300025907 | Ga0207645_10025211 | Ga0207645_100252112 | 268 |
| 157 | 3300025911 | Ga0207654_10000138 | Ga0207654_1000013835 | 268 |
| 158 | 3300025911 | Ga0207654_10000199 | Ga0207654_1000019917 | 268 |
| 159 | 3300025911 | Ga0207654_10075649 | Ga0207654_100756493 | 268 |
| 160 | 3300025913 | Ga0207695_10000119 | Ga0207695_10000119108 | 268 |
| 161 | 3300025913 | Ga0207695_10000598 | Ga0207695_1000059836 | 268 |
| 162 | 3300025913 | Ga0207695_10001003 | Ga0207695_100010035 | 268 |
| 163 | 3300025913 | Ga0207695_10001155 | Ga0207695_1000115519 | 268 |
| 164 | 3300025913 | Ga0207695_10011787 | Ga0207695_100117877 | 268 |
| 165 | 3300025913 | Ga0207695_10029888 | Ga0207695_100298884 | 268 |
| 166 | 3300025913 | Ga0207695_10035407 | Ga0207695_100354072 | 268 |
| 167 | 3300025913 | Ga0207695_10038357 | Ga0207695_100383575 | 268 |
| 168 | 3300025914 | Ga0207671_10000047 | Ga0207671_1000004761 | 268 |
| 169 | 3300025914 | Ga0207671_10000238 | Ga0207671_1000023829 | 268 |
| 170 | 3300025920 | Ga0207649_10001853 | Ga0207649_100018538 | 268 |
| 171 | 3300025920 | Ga0207649_10007573 | Ga0207649_100075732 | 268 |
| 172 | 3300025920 | Ga0207649_10061578 | Ga0207649_100615782 | 268 |
| 173 | 3300025924 | Ga0207694_10000089 | Ga0207694_1000008965 | 268 |
| 174 | 3300025924 | Ga0207694_10000198 | Ga0207694_1000019839 | 268 |
| 175 | 3300025924 | Ga0207694_10001686 | Ga0207694_100016864 | 268 |
| 176 | 3300025925 | Ga0207650_10003537 | Ga0207650_100035377 | 268 |
| 177 | 3300025927 | Ga0207687_10001108 | Ga0207687_1000110810 | 268 |
| 178 | 3300025927 | Ga0207687_10100885 | Ga0207687_101008852 | 268 |
| 179 | 3300025928 | Ga0207700_10002236 | Ga0207700_100022364 | 268 |
| 180 | 3300025931 | Ga0207644_10018965 | Ga0207644_100189655 | 268 |
| 181 | 3300025941 | Ga0207711_10021999 | Ga0207711_100219992 | 268 |
| 182 | 3300025941 | Ga0207711_10048431 | Ga0207711_100484314 | 268 |
| 183 | 3300025942 | Ga0207689_10003086 | Ga0207689_100030866 | 268 |
| 184 | 3300025942 | Ga0207689_10018555 | Ga0207689_100185554 | 268 |
| 185 | 3300025944 | Ga0207661_10000111 | Ga0207661_1000011136 | 268 |
| 186 | 3300025944 | Ga0207661_10036751 | Ga0207661_100367512 | 268 |
| 187 | 3300025944 | Ga0207661_10040830 | Ga0207661_100408302 | 268 |
| 188 | 3300025944 | Ga0207661_10213502 | Ga0207661_102135022 | 268 |
| 189 | 3300025945 | Ga0207679_10037214 | Ga0207679_100372142 | 268 |
| 190 | 3300025945 | Ga0207679_10107727 | Ga0207679_101077272 | 268 |
| 191 | 3300025949 | Ga0207667_10001777 | Ga0207667_100017775 | 268 |
| 192 | 3300025949 | Ga0207667_10005872 | Ga0207667_100058726 | 268 |
| 193 | 3300025949 | Ga0207667_10006597 | Ga0207667_100065976 | 268 |
| 194 | 3300025960 | Ga0207651_10239640 | Ga0207651_102396402 | 268 |
| 195 | 3300025981 | Ga0207640_10358697 | Ga0207640_103586972 | 268 |
| 196 | 3300025986 | Ga0207658_10000076 | Ga0207658_1000007658 | 268 |
| 197 | 3300026023 | Ga0207677_10000266 | Ga0207677_1000026632 | 268 |
| 198 | 3300026035 | Ga0207703_10003789 | Ga0207703_100037897 | 268 |
| 199 | 3300026035 | Ga0207703_10114546 | Ga0207703_101145462 | 268 |
| 200 | 3300026041 | Ga0207639_10000103 | Ga0207639_1000010362 | 268 |
| 201 | 3300026041 | Ga0207639_10038742 | Ga0207639_100387422 | 268 |
| 202 | 3300026041 | Ga0207639_10497813 | Ga0207639_104978131 | 268 |
| 203 | 3300026078 | Ga0207702_10000476 | Ga0207702_1000047629 | 268 |
| 204 | 3300026078 | Ga0207702_10001203 | Ga0207702_1000120320 | 268 |
| 205 | 3300026078 | Ga0207702_10177979 | Ga0207702_101779792 | 268 |
| 206 | 3300026078 | Ga0207702_10457678 | Ga0207702_104576782 | 268 |
| 207 | 3300026088 | Ga0207641_10001520 | Ga0207641_1000152013 | 268 |
| 208 | 3300026089 | Ga0207648_10096969 | Ga0207648_100969692 | 268 |
| 209 | 3300026095 | Ga0207676_10000510 | Ga0207676_100005107 | 268 |
| 210 | 3300026116 | Ga0207674_10001096 | Ga0207674_1000109612 | 268 |
| 211 | 3300026116 | Ga0207674_10345745 | Ga0207674_103457452 | 268 |
| 212 | 3300026121 | Ga0207683_10016077 | Ga0207683_100160773 | 268 |
| 213 | 3300026142 | Ga0207698_10000384 | Ga0207698_1000038412 | 268 |
| 214 | 3300026142 | Ga0207698_10001437 | Ga0207698_100014378 | 268 |
| 215 | 3300026142 | Ga0207698_10012340 | Ga0207698_100123406 | 268 |
| 216 | 3300026142 | Ga0207698_10127457 | Ga0207698_101274571 | 268 |
| 217 | 3300027671 | Ga0209588_1000300 | Ga0209588_10003005 | 268 |
| 218 | 3300028381 | Ga0268264_10000622 | Ga0268264_1000062221 | 268 |
| 219 | 3300028800 | Ga0265338_10062708 | Ga0265338_100627082 | 268 |
| 220 | 3300031090 | Ga0265760_10018254 | Ga0265760_100182543 | 268 |
| 221 | 3300031235 | Ga0265330_10016502 | Ga0265330_100165022 | 268 |
| 222 | 3300031249 | Ga0265339_10006499 | Ga0265339_100064996 | 268 |
| 223 | 3300031344 | Ga0265316_10023164 | Ga0265316_100231646 | 268 |
| 224 | 3300031712 | Ga0265342_10010070 | Ga0265342_100100708 | 268 |
| 225 | 3300031852 | Ga0307410_10055566 | Ga0307410_100555662 | 268 |
| 226 | 3300031901 | Ga0307406_10196916 | Ga0307406_101969161 | 268 |
| 227 | 3300031995 | Ga0307409_100190214 | Ga0307409_1001902142 | 268 |
| 228 | 3300036401 | Ga0373937_0371883 | Ga0373937_0371883_261_1133 | 268 |
| 229 | 3300037471 | Ga0395905_0019672 | Ga0395905_0019672_1219_2109 | 268 |
| 230 | 3300037471 | Ga0395905_0047114 | Ga0395905_0047114_2576_3466 | 268 |
| 231 | 3300037471 | Ga0395905_0069760 | Ga0395905_0069760_1627_2517 | 268 |
| 232 | 3300046454 | Ga0495592_0004618 | Ga0495592_0004618_2913_3785 | 268 |
| 233 | 3300046462 | Ga0495651_0001722 | Ga0495651_0001722_4027_4899 | 268 |
| 234 | 3300046462 | Ga0495651_0006546 | Ga0495651_0006546_2811_3683 | 268 |
| 235 | 3300046463 | Ga0495653_0025724 | Ga0495653_0025724_2529_3401 | 268 |
| 236 | 3300046463 | Ga0495653_0184859 | Ga0495653_0184859_227_1099 | 268 |
| 237 | 3300046477 | Ga0495664_0280043 | Ga0495664_0280043_81_953 | 268 |
| 238 | 3300046511 | Ga0495608_0017454 | Ga0495608_0017454_774_1646 | 268 |
| 239 | 3300046511 | Ga0495608_0024797 | Ga0495608_0024797_2537_3409 | 268 |
| 240 | 3300046516 | Ga0495628_0000986 | Ga0495628_0000986_18960_19832 | 268 |
| 241 | 3300046516 | Ga0495628_0012015 | Ga0495628_0012015_4265_5137 | 268 |
| 242 | 3300046517 | Ga0495630_0004524 | Ga0495630_0004524_414_1286 | 268 |
| 243 | 3300046517 | Ga0495630_0049307 | Ga0495630_0049307_1910_2782 | 268 |
| 244 | 3300046517 | Ga0495630_0215039 | Ga0495630_0215039_551_1423 | 268 |
| 245 | 3300046529 | Ga0495652_0005269 | Ga0495652_0005269_328_1200 | 268 |
| 246 | 3300046529 | Ga0495652_0178033 | Ga0495652_0178033_253_1125 | 268 |
| 247 | 3300046536 | Ga0495587_0004017 | Ga0495587_0004017_5303_6175 | 268 |
| 248 | 3300046543 | Ga0495645_0004522 | Ga0495645_0004522_5042_5914 | 268 |
| 249 | 3300046559 | Ga0495667_0008035 | Ga0495667_0008035_5103_5975 | 268 |
| 250 | 3300046559 | Ga0495667_0011423 | Ga0495667_0011423_3839_4711 | 268 |
| 251 | 3300046559 | Ga0495667_0019669 | Ga0495667_0019669_754_1626 | 268 |
| 252 | 3300046663 | Ga0495635_0054021 | Ga0495635_0054021_1283_2155 | 268 |
| 253 | 3300046675 | Ga0495657_0124534 | Ga0495657_0124534_671_1543 | 268 |
| 254 | 3300046678 | Ga0495599_0015185 | Ga0495599_0015185_3098_3970 | 268 |
| 255 | 3300046678 | Ga0495599_0298485 | Ga0495599_0298485_25_897 | 268 |
| 256 | 3300046679 | Ga0495623_0063746 | Ga0495623_0063746_788_1660 | 268 |
| 257 | 3300046680 | Ga0495646_0182180 | Ga0495646_0182180_59_931 | 268 |
| 258 | 3300046809 | Ga0495600_0001209 | Ga0495600_0001209_9734_10606 | 268 |
| 259 | 3300046809 | Ga0495600_0114690 | Ga0495600_0114690_170_1042 | 268 |
| 260 | 3300047317 | Ga0495604_0001439 | Ga0495604_0001439_3607_4479 | 268 |
| 261 | 3300047317 | Ga0495604_0096793 | Ga0495604_0096793_180_1052 | 268 |
| 262 | 3300047319 | Ga0495674_0005521 | Ga0495674_0005521_2666_3538 | 268 |
| 263 | 3300047322 | Ga0495680_0004430 | Ga0495680_0004430_3421_4293 | 268 |
| 264 | 3300047322 | Ga0495680_0005530 | Ga0495680_0005530_7143_8015 | 268 |
| 265 | 3300047444 | Ga0495675_0000586 | Ga0495675_0000586_18949_19821 | 268 |
| 266 | 3300047471 | Ga0495684_0000891 | Ga0495684_0000891_13015_13887 | 268 |
| 267 | 3300047471 | Ga0495684_0002088 | Ga0495684_0002088_11614_12486 | 268 |
| 268 | 3300048088 | Ga0495602_0021671 | Ga0495602_0021671_3885_4757 | 268 |
| 269 | 3300048088 | Ga0495602_0210783 | Ga0495602_0210783_264_1136 | 268 |
| 270 | 3300048929 | Ga0496126_0001003 | Ga0496126_0001003_41218_42090 | 268 |
| 271 | 3300048929 | Ga0496126_0111699 | Ga0496126_0111699_222_1094 | 268 |
| 272 | 3300049572 | Ga0501036_0062117 | Ga0501036_0062117_1343_2215 | 268 |
| 273 | 3300049574 | Ga0501038_0163667 | Ga0501038_0163667_26_898 | 268 |
| 274 | 3300049575 | Ga0501039_0022894 | Ga0501039_0022894_1559_2431 | 268 |
| 275 | 3300049582 | Ga0501048_0123646 | Ga0501048_0123646_299_1171 | 268 |
| 276 | 3300049587 | Ga0501071_0290700 | Ga0501071_0290700_40_912 | 268 |
| 277 | 3300049591 | Ga0501075_0072217 | Ga0501075_0072217_1366_2238 | 268 |
| 278 | 3300049741 | Ga0501079_0090591 | Ga0501079_0090591_213_1085 | 268 |
| 279 | 3300049743 | Ga0501081_0021619 | Ga0501081_0021619_504_1376 | 268 |
| 280 | 3300050507 | nmdc:mga05p37_168803_c1 | nmdc:mga05p37_168803_c1_167_1039 | 268 |
| 281 | 3300050508 | nmdc:mga09592_69077_c1 | nmdc:mga09592_69077_c1_1032_1904 | 268 |
| 282 | 3300050509 | nmdc:mga0qj67_2331_c1 | nmdc:mga0qj67_2331_c1_3352_4224 | 268 |
| 283 | 3300050510 | nmdc:mga06r32_111777_c1 | nmdc:mga06r32_111777_c1_1331_2203 | 268 |
| 284 | 3300053077 | Ga0495601_0146043 | Ga0495601_0146043_290_1162 | 268 |
| 285 | 3300061734 | Ga0530510_0074219 | Ga0530510_0074219_1444_2316 | 268 |
| 286 | 3300001976 | JGI24752J21851_1000626 | JGI24752J21851_10006262 | 269 |
| 287 | 3300001990 | JGI24737J22298_10010409 | JGI24737J22298_100104095 | 269 |
| 288 | 3300001991 | JGI24743J22301_10001628 | JGI24743J22301_100016281 | 269 |
| 289 | 3300002076 | JGI24749J21850_1001307 | JGI24749J21850_10013072 | 269 |
| 290 | 3300002239 | JGI24034J26672_10000790 | JGI24034J26672_100007902 | 269 |
| 291 | 3300002459 | JGI24751J29686_10001033 | JGI24751J29686_100010337 | 269 |
| 292 | 3300005328 | Ga0070676_10014694 | Ga0070676_100146941 | 269 |
| 293 | 3300005329 | Ga0070683_100005374 | Ga0070683_1000053743 | 269 |
| 294 | 3300005330 | Ga0070690_100006108 | Ga0070690_1000061088 | 269 |
| 295 | 3300005331 | Ga0070670_100044971 | Ga0070670_1000449713 | 269 |
| 296 | 3300005334 | Ga0068869_100005208 | Ga0068869_1000052083 | 269 |
| 297 | 3300005335 | Ga0070666_10423122 | Ga0070666_104231221 | 269 |
| 298 | 3300005336 | Ga0070680_100039817 | Ga0070680_1000398173 | 269 |
| 299 | 3300005338 | Ga0068868_100038382 | Ga0068868_1000383822 | 269 |
| 300 | 3300005343 | Ga0070687_100001381 | Ga0070687_1000013817 | 269 |
| 301 | 3300005344 | Ga0070661_100009497 | Ga0070661_1000094972 | 269 |
| 302 | 3300005353 | Ga0070669_100003106 | Ga0070669_1000031062 | 269 |
| 303 | 3300005354 | Ga0070675_100021770 | Ga0070675_1000217702 | 269 |
| 304 | 3300005355 | Ga0070671_100590431 | Ga0070671_1005904311 | 269 |
| 305 | 3300005356 | Ga0070674_100007866 | Ga0070674_1000078663 | 269 |
| 306 | 3300005364 | Ga0070673_100017012 | Ga0070673_1000170127 | 269 |
| 307 | 3300005365 | Ga0070688_100045066 | Ga0070688_1000450662 | 269 |
| 308 | 3300005365 | Ga0070688_100173717 | Ga0070688_1001737172 | 269 |
| 309 | 3300005366 | Ga0070659_100016747 | Ga0070659_1000167477 | 269 |
| 310 | 3300005434 | Ga0070709_10000566 | Ga0070709_1000056613 | 269 |
| 311 | 3300005434 | Ga0070709_10007162 | Ga0070709_100071624 | 269 |
| 312 | 3300005434 | Ga0070709_10087946 | Ga0070709_100879464 | 269 |
| 313 | 3300005434 | Ga0070709_10095846 | Ga0070709_100958462 | 269 |
| 314 | 3300005435 | Ga0070714_100000188 | Ga0070714_10000018832 | 269 |
| 315 | 3300005435 | Ga0070714_100044012 | Ga0070714_1000440125 | 269 |
| 316 | 3300005435 | Ga0070714_100072720 | Ga0070714_1000727204 | 269 |
| 317 | 3300005435 | Ga0070714_100114255 | Ga0070714_1001142552 | 269 |
| 318 | 3300005435 | Ga0070714_100125324 | Ga0070714_1001253244 | 269 |
| 319 | 3300005435 | Ga0070714_100519825 | Ga0070714_1005198251 | 269 |
| 320 | 3300005436 | Ga0070713_100000319 | Ga0070713_1000003197 | 269 |
| 321 | 3300005436 | Ga0070713_100001167 | Ga0070713_10000116717 | 269 |
| 322 | 3300005436 | Ga0070713_100006607 | Ga0070713_1000066075 | 269 |
| 323 | 3300005436 | Ga0070713_100018741 | Ga0070713_1000187418 | 269 |
| 324 | 3300005436 | Ga0070713_100034370 | Ga0070713_1000343704 | 269 |
| 325 | 3300005436 | Ga0070713_100382370 | Ga0070713_1003823702 | 269 |
| 326 | 3300005437 | Ga0070710_10011986 | Ga0070710_100119865 | 269 |
| 327 | 3300005437 | Ga0070710_10040214 | Ga0070710_100402142 | 269 |
| 328 | 3300005439 | Ga0070711_100001058 | Ga0070711_10000105812 | 269 |
| 329 | 3300005439 | Ga0070711_100361214 | Ga0070711_1003612141 | 269 |
| 330 | 3300005445 | Ga0070708_100000759 | Ga0070708_1000007598 | 269 |
| 331 | 3300005445 | Ga0070708_100007253 | Ga0070708_1000072537 | 269 |
| 332 | 3300005445 | Ga0070708_100025721 | Ga0070708_1000257212 | 269 |
| 333 | 3300005445 | Ga0070708_100090042 | Ga0070708_1000900422 | 269 |
| 334 | 3300005445 | Ga0070708_100155620 | Ga0070708_1001556202 | 269 |
| 335 | 3300005455 | Ga0070663_100100919 | Ga0070663_1001009192 | 269 |
| 336 | 3300005457 | Ga0070662_100019973 | Ga0070662_1000199731 | 269 |
| 337 | 3300005458 | Ga0070681_10021100 | Ga0070681_100211008 | 269 |
| 338 | 3300005459 | Ga0068867_100121912 | Ga0068867_1001219122 | 269 |
| 339 | 3300005466 | Ga0070685_10001186 | Ga0070685_100011862 | 269 |
| 340 | 3300005467 | Ga0070706_100000665 | Ga0070706_1000006658 | 269 |
| 341 | 3300005467 | Ga0070706_100002304 | Ga0070706_1000023046 | 269 |
| 342 | 3300005467 | Ga0070706_100023869 | Ga0070706_1000238695 | 269 |
| 343 | 3300005467 | Ga0070706_100320686 | Ga0070706_1003206862 | 269 |
| 344 | 3300005468 | Ga0070707_100000449 | Ga0070707_10000044922 | 269 |
| 345 | 3300005468 | Ga0070707_100005258 | Ga0070707_10000525810 | 269 |
| 346 | 3300005468 | Ga0070707_100096983 | Ga0070707_1000969832 | 269 |
| 347 | 3300005471 | Ga0070698_100000007 | Ga0070698_10000000724 | 269 |
| 348 | 3300005471 | Ga0070698_100001842 | Ga0070698_10000184218 | 269 |
| 349 | 3300005471 | Ga0070698_100188887 | Ga0070698_1001888872 | 269 |
| 350 | 3300005518 | Ga0070699_100009157 | Ga0070699_1000091575 | 269 |
| 351 | 3300005518 | Ga0070699_100013744 | Ga0070699_1000137445 | 269 |
| 352 | 3300005518 | Ga0070699_100106454 | Ga0070699_1001064542 | 269 |
| 353 | 3300005530 | Ga0070679_100013019 | Ga0070679_1000130192 | 269 |
| 354 | 3300005530 | Ga0070679_100085217 | Ga0070679_1000852174 | 269 |
| 355 | 3300005530 | Ga0070679_100494216 | Ga0070679_1004942161 | 269 |
| 356 | 3300005535 | Ga0070684_100000965 | Ga0070684_10000096518 | 269 |
| 357 | 3300005536 | Ga0070697_100001330 | Ga0070697_10000133013 | 269 |
| 358 | 3300005536 | Ga0070697_100002365 | Ga0070697_1000023657 | 269 |
| 359 | 3300005536 | Ga0070697_100007175 | Ga0070697_1000071755 | 269 |
| 360 | 3300005536 | Ga0070697_100037719 | Ga0070697_1000377193 | 269 |
| 361 | 3300005539 | Ga0068853_100004157 | Ga0068853_10000415710 | 269 |
| 362 | 3300005543 | Ga0070672_100001289 | Ga0070672_1000012892 | 269 |
| 363 | 3300005544 | Ga0070686_100013418 | Ga0070686_1000134183 | 269 |
| 364 | 3300005547 | Ga0070693_100157013 | Ga0070693_1001570132 | 269 |
| 365 | 3300005563 | Ga0068855_100008944 | Ga0068855_1000089449 | 269 |
| 366 | 3300005563 | Ga0068855_100025034 | Ga0068855_1000250347 | 269 |
| 367 | 3300005563 | Ga0068855_100029001 | Ga0068855_1000290013 | 269 |
| 368 | 3300005563 | Ga0068855_100209777 | Ga0068855_1002097773 | 269 |
| 369 | 3300005564 | Ga0070664_100280186 | Ga0070664_1002801862 | 269 |
| 370 | 3300005577 | Ga0068857_100017006 | Ga0068857_1000170064 | 269 |
| 371 | 3300005577 | Ga0068857_100025522 | Ga0068857_1000255223 | 269 |
| 372 | 3300005578 | Ga0068854_100015244 | Ga0068854_1000152443 | 269 |
| 373 | 3300005614 | Ga0068856_100000273 | Ga0068856_10000027363 | 269 |
| 374 | 3300005614 | Ga0068856_100008342 | Ga0068856_1000083424 | 269 |
| 375 | 3300005614 | Ga0068856_100023355 | Ga0068856_1000233552 | 269 |
| 376 | 3300005614 | Ga0068856_100137652 | Ga0068856_1001376522 | 269 |
| 377 | 3300005614 | Ga0068856_100457535 | Ga0068856_1004575351 | 269 |
| 378 | 3300005616 | Ga0068852_100008182 | Ga0068852_1000081826 | 269 |
| 379 | 3300005616 | Ga0068852_100355223 | Ga0068852_1003552231 | 269 |
| 380 | 3300005617 | Ga0068859_100002618 | Ga0068859_1000026182 | 269 |
| 381 | 3300005617 | Ga0068859_100079897 | Ga0068859_1000798973 | 269 |
| 382 | 3300005618 | Ga0068864_100007640 | Ga0068864_1000076408 | 269 |
| 383 | 3300005718 | Ga0068866_10012028 | Ga0068866_100120282 | 269 |
| 384 | 3300005719 | Ga0068861_100070644 | Ga0068861_1000706445 | 269 |
| 385 | 3300005840 | Ga0068870_10000651 | Ga0068870_1000065115 | 269 |
| 386 | 3300005841 | Ga0068863_100047570 | Ga0068863_1000475703 | 269 |
| 387 | 3300005841 | Ga0068863_100154203 | Ga0068863_1001542032 | 269 |
| 388 | 3300005842 | Ga0068858_100002860 | Ga0068858_10000286014 | 269 |
| 389 | 3300005842 | Ga0068858_100158081 | Ga0068858_1001580812 | 269 |
| 390 | 3300005843 | Ga0068860_100105013 | Ga0068860_1001050131 | 269 |
| 391 | 3300005843 | Ga0068860_100243484 | Ga0068860_1002434842 | 269 |
| 392 | 3300005843 | Ga0068860_100327868 | Ga0068860_1003278681 | 269 |
| 393 | 3300005844 | Ga0068862_100014301 | Ga0068862_1000143015 | 269 |
| 394 | 3300005983 | Ga0081540_1084386 | Ga0081540_10843861 | 269 |
| 395 | 3300006028 | Ga0070717_10000586 | Ga0070717_1000058612 | 269 |
| 396 | 3300006028 | Ga0070717_10004883 | Ga0070717_1000488311 | 269 |
| 397 | 3300006028 | Ga0070717_10005765 | Ga0070717_100057657 | 269 |
| 398 | 3300006028 | Ga0070717_10013549 | Ga0070717_100135498 | 269 |
| 399 | 3300006028 | Ga0070717_10040541 | Ga0070717_100405415 | 269 |
| 400 | 3300006028 | Ga0070717_10135074 | Ga0070717_101350742 | 269 |
| 401 | 3300006028 | Ga0070717_10220677 | Ga0070717_102206772 | 269 |
| 402 | 3300006028 | Ga0070717_10260243 | Ga0070717_102602432 | 269 |
| 403 | 3300006028 | Ga0070717_10317991 | Ga0070717_103179912 | 269 |
| 404 | 3300006028 | Ga0070717_10404848 | Ga0070717_104048482 | 269 |
| 405 | 3300006163 | Ga0070715_10021658 | Ga0070715_100216582 | 269 |
| 406 | 3300006173 | Ga0070716_100014849 | Ga0070716_1000148494 | 269 |
| 407 | 3300006173 | Ga0070716_100020099 | Ga0070716_1000200993 | 269 |
| 408 | 3300006173 | Ga0070716_100073589 | Ga0070716_1000735892 | 269 |
| 409 | 3300006173 | Ga0070716_100110727 | Ga0070716_1001107272 | 269 |
| 410 | 3300006175 | Ga0070712_100001025 | Ga0070712_1000010259 | 269 |
| 411 | 3300006175 | Ga0070712_100014266 | Ga0070712_1000142666 | 269 |
| 412 | 3300006175 | Ga0070712_100026939 | Ga0070712_1000269391 | 269 |
| 413 | 3300006175 | Ga0070712_100028712 | Ga0070712_1000287123 | 269 |
| 414 | 3300006175 | Ga0070712_100042976 | Ga0070712_1000429762 | 269 |
| 415 | 3300006175 | Ga0070712_100433903 | Ga0070712_1004339032 | 269 |
| 416 | 3300006237 | Ga0097621_100027526 | Ga0097621_1000275262 | 269 |
| 417 | 3300006237 | Ga0097621_100061653 | Ga0097621_1000616531 | 269 |
| 418 | 3300006358 | Ga0068871_100201790 | Ga0068871_1002017902 | 269 |
| 419 | 3300006871 | Ga0075434_100136166 | Ga0075434_1001361662 | 269 |
| 420 | 3300006881 | Ga0068865_100022464 | Ga0068865_1000224645 | 269 |
| 421 | 3300006914 | Ga0075436_100000510 | Ga0075436_1000005106 | 269 |
| 422 | 3300006914 | Ga0075436_100130776 | Ga0075436_1001307761 | 269 |
| 423 | 3300006914 | Ga0075436_100346981 | Ga0075436_1003469812 | 269 |
| 424 | 3300006931 | Ga0097620_100002618 | Ga0097620_10000261818 | 269 |
| 425 | 3300006931 | Ga0097620_100079898 | Ga0097620_1000798983 | 269 |
| 426 | 3300009093 | Ga0105240_10012404 | Ga0105240_100124045 | 269 |
| 427 | 3300009093 | Ga0105240_10042131 | Ga0105240_100421315 | 269 |
| 428 | 3300009093 | Ga0105240_10117957 | Ga0105240_101179574 | 269 |
| 429 | 3300009093 | Ga0105240_10309654 | Ga0105240_103096542 | 269 |
| 430 | 3300009098 | Ga0105245_10272084 | Ga0105245_102720842 | 269 |
| 431 | 3300009098 | Ga0105245_10350598 | Ga0105245_103505982 | 269 |
| 432 | 3300009101 | Ga0105247_10005566 | Ga0105247_100055663 | 269 |
| 433 | 3300009101 | Ga0105247_10063114 | Ga0105247_100631142 | 269 |
| 434 | 3300009101 | Ga0105247_10199155 | Ga0105247_101991552 | 269 |
| 435 | 3300009148 | Ga0105243_10256244 | Ga0105243_102562442 | 269 |
| 436 | 3300009174 | Ga0105241_10000311 | Ga0105241_1000031112 | 269 |
| 437 | 3300009174 | Ga0105241_10002253 | Ga0105241_100022537 | 269 |
| 438 | 3300009174 | Ga0105241_10007254 | Ga0105241_100072548 | 269 |
| 439 | 3300009174 | Ga0105241_10023715 | Ga0105241_100237155 | 269 |
| 440 | 3300009174 | Ga0105241_10192007 | Ga0105241_101920072 | 269 |
| 441 | 3300009176 | Ga0105242_10034156 | Ga0105242_100341561 | 269 |
| 442 | 3300009176 | Ga0105242_10047800 | Ga0105242_100478002 | 269 |
| 443 | 3300009177 | Ga0105248_10043192 | Ga0105248_100431923 | 269 |
| 444 | 3300009177 | Ga0105248_10083959 | Ga0105248_100839592 | 269 |
| 445 | 3300009545 | Ga0105237_10024585 | Ga0105237_100245853 | 269 |
| 446 | 3300009545 | Ga0105237_10086762 | Ga0105237_100867623 | 269 |
| 447 | 3300009545 | Ga0105237_10147100 | Ga0105237_101471002 | 269 |
| 448 | 3300009551 | Ga0105238_10017675 | Ga0105238_100176757 | 269 |
| 449 | 3300009551 | Ga0105238_10190466 | Ga0105238_101904663 | 269 |
| 450 | 3300009551 | Ga0105238_10370892 | Ga0105238_103708921 | 269 |
| 451 | 3300010375 | Ga0105239_10004218 | Ga0105239_100042182 | 269 |
| 452 | 3300010375 | Ga0105239_10026022 | Ga0105239_100260222 | 269 |
| 453 | 3300011119 | Ga0105246_10002780 | Ga0105246_100027803 | 269 |
| 454 | 3300013100 | Ga0157373_10005148 | Ga0157373_100051489 | 269 |
| 455 | 3300013100 | Ga0157373_10007159 | Ga0157373_100071598 | 269 |
| 456 | 3300013100 | Ga0157373_10238948 | Ga0157373_102389481 | 269 |
| 457 | 3300013102 | Ga0157371_10022024 | Ga0157371_100220245 | 269 |
| 458 | 3300013102 | Ga0157371_10271187 | Ga0157371_102711872 | 269 |
| 459 | 3300013105 | Ga0157369_10013700 | Ga0157369_100137008 | 269 |
| 460 | 3300013105 | Ga0157369_10086085 | Ga0157369_100860851 | 269 |
| 461 | 3300013105 | Ga0157369_10108439 | Ga0157369_101084392 | 269 |
| 462 | 3300013105 | Ga0157369_10137555 | Ga0157369_101375552 | 269 |
| 463 | 3300013105 | Ga0157369_10236047 | Ga0157369_102360472 | 269 |
| 464 | 3300013105 | Ga0157369_10380005 | Ga0157369_103800052 | 269 |
| 465 | 3300013296 | Ga0157374_10026827 | Ga0157374_100268276 | 269 |
| 466 | 3300013296 | Ga0157374_10027888 | Ga0157374_100278883 | 269 |
| 467 | 3300013296 | Ga0157374_10053114 | Ga0157374_100531142 | 269 |
| 468 | 3300013296 | Ga0157374_10069959 | Ga0157374_100699594 | 269 |
| 469 | 3300013296 | Ga0157374_10083424 | Ga0157374_100834242 | 269 |
| 470 | 3300013296 | Ga0157374_10178394 | Ga0157374_101783943 | 269 |
| 471 | 3300013296 | Ga0157374_10185380 | Ga0157374_101853802 | 269 |
| 472 | 3300013297 | Ga0157378_10001228 | Ga0157378_1000122819 | 269 |
| 473 | 3300013297 | Ga0157378_10116931 | Ga0157378_101169315 | 269 |
| 474 | 3300013306 | Ga0163162_10015395 | Ga0163162_100153957 | 269 |
| 475 | 3300013306 | Ga0163162_10019591 | Ga0163162_100195916 | 269 |
| 476 | 3300013307 | Ga0157372_10016367 | Ga0157372_100163673 | 269 |
| 477 | 3300013307 | Ga0157372_10018449 | Ga0157372_100184497 | 269 |
| 478 | 3300013307 | Ga0157372_10021867 | Ga0157372_100218672 | 269 |
| 479 | 3300013307 | Ga0157372_10030681 | Ga0157372_100306814 | 269 |
| 480 | 3300013307 | Ga0157372_10045594 | Ga0157372_100455942 | 269 |
| 481 | 3300013307 | Ga0157372_10063239 | Ga0157372_100632391 | 269 |
| 482 | 3300013307 | Ga0157372_10083559 | Ga0157372_100835592 | 269 |
| 483 | 3300014325 | Ga0163163_10015546 | Ga0163163_100155463 | 269 |
| 484 | 3300014325 | Ga0163163_10411721 | Ga0163163_104117212 | 269 |
| 485 | 3300014497 | Ga0182008_10002765 | Ga0182008_100027655 | 269 |
| 486 | 3300014745 | Ga0157377_10003673 | Ga0157377_100036733 | 269 |
| 487 | 3300014968 | Ga0157379_10000116 | Ga0157379_1000011610 | 269 |
| 488 | 3300014968 | Ga0157379_10117665 | Ga0157379_101176653 | 269 |
| 489 | 3300014969 | Ga0157376_10025462 | Ga0157376_100254623 | 269 |
| 490 | 3300014969 | Ga0157376_10072125 | Ga0157376_100721253 | 269 |
| 491 | 3300014969 | Ga0157376_10086495 | Ga0157376_100864954 | 269 |
| 492 | 3300014969 | Ga0157376_10341203 | Ga0157376_103412032 | 269 |
| 493 | 3300014969 | Ga0157376_10396492 | Ga0157376_103964922 | 269 |
| 494 | 3300017792 | Ga0163161_10001800 | Ga0163161_1000180016 | 269 |
| 495 | 3300021361 | Ga0213872_10097784 | Ga0213872_100977842 | 269 |
| 496 | 3300022730 | Ga0224570_101846 | Ga0224570_1018462 | 269 |
| 497 | 3300024225 | Ga0224572_1000995 | Ga0224572_10009955 | 269 |
| 498 | 3300024227 | Ga0228598_1000192 | Ga0228598_10001925 | 269 |
| 499 | 3300024227 | Ga0228598_1035688 | Ga0228598_10356881 | 269 |
| 500 | 3300025898 | Ga0207692_10003860 | Ga0207692_100038603 | 269 |
| 501 | 3300025898 | Ga0207692_10005757 | Ga0207692_100057573 | 269 |
| 502 | 3300025898 | Ga0207692_10009222 | Ga0207692_100092224 | 269 |
| 503 | 3300025899 | Ga0207642_10113057 | Ga0207642_101130572 | 269 |
| 504 | 3300025901 | Ga0207688_10011720 | Ga0207688_100117202 | 269 |
| 505 | 3300025903 | Ga0207680_10003486 | Ga0207680_100034867 | 269 |
| 506 | 3300025904 | Ga0207647_10001383 | Ga0207647_100013834 | 269 |
| 507 | 3300025904 | Ga0207647_10011830 | Ga0207647_100118303 | 269 |
| 508 | 3300025904 | Ga0207647_10161479 | Ga0207647_101614791 | 269 |
| 509 | 3300025905 | Ga0207685_10007635 | Ga0207685_100076351 | 269 |
| 510 | 3300025905 | Ga0207685_10019615 | Ga0207685_100196152 | 269 |
| 511 | 3300025906 | Ga0207699_10001295 | Ga0207699_100012954 | 269 |
| 512 | 3300025906 | Ga0207699_10005473 | Ga0207699_100054734 | 269 |
| 513 | 3300025906 | Ga0207699_10065337 | Ga0207699_100653375 | 269 |
| 514 | 3300025906 | Ga0207699_10077669 | Ga0207699_100776692 | 269 |
| 515 | 3300025906 | Ga0207699_10194072 | Ga0207699_101940722 | 269 |
| 516 | 3300025907 | Ga0207645_10000998 | Ga0207645_100009983 | 269 |
| 517 | 3300025908 | Ga0207643_10000240 | Ga0207643_1000024038 | 269 |
| 518 | 3300025909 | Ga0207705_10035217 | Ga0207705_100352174 | 269 |
| 519 | 3300025909 | Ga0207705_10070132 | Ga0207705_100701322 | 269 |
| 520 | 3300025910 | Ga0207684_10000283 | Ga0207684_1000028361 | 269 |
| 521 | 3300025910 | Ga0207684_10000414 | Ga0207684_1000041453 | 269 |
| 522 | 3300025910 | Ga0207684_10022136 | Ga0207684_100221365 | 269 |
| 523 | 3300025910 | Ga0207684_10235082 | Ga0207684_102350822 | 269 |
| 524 | 3300025911 | Ga0207654_10000074 | Ga0207654_1000007433 | 269 |
| 525 | 3300025911 | Ga0207654_10052928 | Ga0207654_100529282 | 269 |
| 526 | 3300025911 | Ga0207654_10140016 | Ga0207654_101400162 | 269 |
| 527 | 3300025912 | Ga0207707_10056074 | Ga0207707_100560744 | 269 |
| 528 | 3300025913 | Ga0207695_10007106 | Ga0207695_1000710613 | 269 |
| 529 | 3300025913 | Ga0207695_10046245 | Ga0207695_100462453 | 269 |
| 530 | 3300025914 | Ga0207671_10319364 | Ga0207671_103193641 | 269 |
| 531 | 3300025915 | Ga0207693_10000054 | Ga0207693_1000005417 | 269 |
| 532 | 3300025915 | Ga0207693_10000446 | Ga0207693_100004468 | 269 |
| 533 | 3300025915 | Ga0207693_10028475 | Ga0207693_100284755 | 269 |
| 534 | 3300025915 | Ga0207693_10041737 | Ga0207693_100417372 | 269 |
| 535 | 3300025915 | Ga0207693_10115188 | Ga0207693_101151882 | 269 |
| 536 | 3300025915 | Ga0207693_10146351 | Ga0207693_101463512 | 269 |
| 537 | 3300025915 | Ga0207693_10231850 | Ga0207693_102318502 | 269 |
| 538 | 3300025915 | Ga0207693_10258439 | Ga0207693_102584392 | 269 |
| 539 | 3300025916 | Ga0207663_10003834 | Ga0207663_100038342 | 269 |
| 540 | 3300025916 | Ga0207663_10164691 | Ga0207663_101646911 | 269 |
| 541 | 3300025917 | Ga0207660_10041118 | Ga0207660_100411183 | 269 |
| 542 | 3300025917 | Ga0207660_10113785 | Ga0207660_101137852 | 269 |
| 543 | 3300025918 | Ga0207662_10003083 | Ga0207662_100030837 | 269 |
| 544 | 3300025919 | Ga0207657_10000662 | Ga0207657_100006622 | 269 |
| 545 | 3300025920 | Ga0207649_10005019 | Ga0207649_100050192 | 269 |
| 546 | 3300025921 | Ga0207652_10010342 | Ga0207652_100103424 | 269 |
| 547 | 3300025921 | Ga0207652_10458649 | Ga0207652_104586492 | 269 |
| 548 | 3300025922 | Ga0207646_10000433 | Ga0207646_1000043323 | 269 |
| 549 | 3300025922 | Ga0207646_10001325 | Ga0207646_1000132528 | 269 |
| 550 | 3300025924 | Ga0207694_10024425 | Ga0207694_100244255 | 269 |
| 551 | 3300025924 | Ga0207694_10085417 | Ga0207694_100854172 | 269 |
| 552 | 3300025925 | Ga0207650_10000227 | Ga0207650_1000022766 | 269 |
| 553 | 3300025925 | Ga0207650_10036901 | Ga0207650_100369015 | 269 |
| 554 | 3300025926 | Ga0207659_10010402 | Ga0207659_100104026 | 269 |
| 555 | 3300025928 | Ga0207700_10000252 | Ga0207700_1000025220 | 269 |
| 556 | 3300025928 | Ga0207700_10000595 | Ga0207700_100005955 | 269 |
| 557 | 3300025928 | Ga0207700_10004990 | Ga0207700_100049906 | 269 |
| 558 | 3300025928 | Ga0207700_10112658 | Ga0207700_101126583 | 269 |
| 559 | 3300025928 | Ga0207700_10127933 | Ga0207700_101279333 | 269 |
| 560 | 3300025928 | Ga0207700_10312090 | Ga0207700_103120902 | 269 |
| 561 | 3300025928 | Ga0207700_10327516 | Ga0207700_103275161 | 269 |
| 562 | 3300025929 | Ga0207664_10000370 | Ga0207664_1000037026 | 269 |
| 563 | 3300025929 | Ga0207664_10034020 | Ga0207664_100340205 | 269 |
| 564 | 3300025929 | Ga0207664_10048391 | Ga0207664_100483915 | 269 |
| 565 | 3300025929 | Ga0207664_10089474 | Ga0207664_100894742 | 269 |
| 566 | 3300025929 | Ga0207664_10363143 | Ga0207664_103631432 | 269 |
| 567 | 3300025929 | Ga0207664_10495941 | Ga0207664_104959411 | 269 |
| 568 | 3300025933 | Ga0207706_10000417 | Ga0207706_100004173 | 269 |
| 569 | 3300025934 | Ga0207686_10033518 | Ga0207686_100335184 | 269 |
| 570 | 3300025935 | Ga0207709_10269114 | Ga0207709_102691141 | 269 |
| 571 | 3300025936 | Ga0207670_10048769 | Ga0207670_100487694 | 269 |
| 572 | 3300025936 | Ga0207670_10168836 | Ga0207670_101688362 | 269 |
| 573 | 3300025938 | Ga0207704_10135592 | Ga0207704_101355922 | 269 |
| 574 | 3300025939 | Ga0207665_10003611 | Ga0207665_1000361110 | 269 |
| 575 | 3300025939 | Ga0207665_10004041 | Ga0207665_100040412 | 269 |
| 576 | 3300025939 | Ga0207665_10009355 | Ga0207665_100093555 | 269 |
| 577 | 3300025939 | Ga0207665_10030851 | Ga0207665_100308513 | 269 |
| 578 | 3300025939 | Ga0207665_10047410 | Ga0207665_100474102 | 269 |
| 579 | 3300025940 | Ga0207691_10000567 | Ga0207691_1000056738 | 269 |
| 580 | 3300025941 | Ga0207711_10050096 | Ga0207711_100500963 | 269 |
| 581 | 3300025941 | Ga0207711_10446308 | Ga0207711_104463082 | 269 |
| 582 | 3300025942 | Ga0207689_10001207 | Ga0207689_1000120719 | 269 |
| 583 | 3300025942 | Ga0207689_10001404 | Ga0207689_100014043 | 269 |
| 584 | 3300025944 | Ga0207661_10002956 | Ga0207661_1000295611 | 269 |
| 585 | 3300025944 | Ga0207661_10391758 | Ga0207661_103917582 | 269 |
| 586 | 3300025945 | Ga0207679_10000198 | Ga0207679_100001983 | 269 |
| 587 | 3300025949 | Ga0207667_10005917 | Ga0207667_1000591713 | 269 |
| 588 | 3300025949 | Ga0207667_10215369 | Ga0207667_102153693 | 269 |
| 589 | 3300025960 | Ga0207651_10013389 | Ga0207651_100133896 | 269 |
| 590 | 3300025972 | Ga0207668_10045392 | Ga0207668_100453924 | 269 |
| 591 | 3300025981 | Ga0207640_10018632 | Ga0207640_100186326 | 269 |
| 592 | 3300025986 | Ga0207658_10024923 | Ga0207658_100249236 | 269 |
| 593 | 3300026023 | Ga0207677_10005105 | Ga0207677_100051052 | 269 |
| 594 | 3300026023 | Ga0207677_10007468 | Ga0207677_100074685 | 269 |
| 595 | 3300026023 | Ga0207677_10086733 | Ga0207677_100867332 | 269 |
| 596 | 3300026023 | Ga0207677_10148269 | Ga0207677_101482692 | 269 |
| 597 | 3300026035 | Ga0207703_10007757 | Ga0207703_100077577 | 269 |
| 598 | 3300026035 | Ga0207703_10019811 | Ga0207703_100198117 | 269 |
| 599 | 3300026067 | Ga0207678_10000406 | Ga0207678_100004063 | 269 |
| 600 | 3300026078 | Ga0207702_10000796 | Ga0207702_1000079618 | 269 |
| 601 | 3300026078 | Ga0207702_10057989 | Ga0207702_100579894 | 269 |
| 602 | 3300026078 | Ga0207702_10111601 | Ga0207702_101116013 | 269 |
| 603 | 3300026078 | Ga0207702_10365566 | Ga0207702_103655662 | 269 |
| 604 | 3300026088 | Ga0207641_10000052 | Ga0207641_1000005283 | 269 |
| 605 | 3300026088 | Ga0207641_10136507 | Ga0207641_101365072 | 269 |
| 606 | 3300026088 | Ga0207641_10154788 | Ga0207641_101547882 | 269 |
| 607 | 3300026089 | Ga0207648_10000537 | Ga0207648_100005373 | 269 |
| 608 | 3300026089 | Ga0207648_10022570 | Ga0207648_100225707 | 269 |
| 609 | 3300026095 | Ga0207676_10001275 | Ga0207676_100012753 | 269 |
| 610 | 3300026116 | Ga0207674_10000803 | Ga0207674_1000080343 | 269 |
| 611 | 3300026116 | Ga0207674_10010198 | Ga0207674_100101989 | 269 |
| 612 | 3300026118 | Ga0207675_100038371 | Ga0207675_1000383715 | 269 |
| 613 | 3300026121 | Ga0207683_10030280 | Ga0207683_100302802 | 269 |
| 614 | 3300026142 | Ga0207698_10581939 | Ga0207698_105819391 | 269 |
| 615 | 3300028379 | Ga0268266_10002099 | Ga0268266_1000209919 | 269 |
| 616 | 3300028379 | Ga0268266_10492987 | Ga0268266_104929871 | 269 |
| 617 | 3300028380 | Ga0268265_10053545 | Ga0268265_100535452 | 269 |
| 618 | 3300028381 | Ga0268264_10015512 | Ga0268264_100155123 | 269 |
| 619 | 3300028577 | Ga0265318_10022341 | Ga0265318_100223413 | 269 |
| 620 | 3300028666 | Ga0265336_10040130 | Ga0265336_100401302 | 269 |
| 621 | 3300028800 | Ga0265338_10002471 | Ga0265338_1000247117 | 269 |
| 622 | 3300028800 | Ga0265338_10024192 | Ga0265338_100241925 | 269 |
| 623 | 3300028800 | Ga0265338_10030309 | Ga0265338_100303093 | 269 |
| 624 | 3300028800 | Ga0265338_10057232 | Ga0265338_100572322 | 269 |
| 625 | 3300028800 | Ga0265338_10130257 | Ga0265338_101302572 | 269 |
| 626 | 3300028800 | Ga0265338_10145411 | Ga0265338_101454112 | 269 |
| 627 | 3300028800 | Ga0265338_10428329 | Ga0265338_104283291 | 269 |
| 628 | 3300030760 | Ga0265762_1000488 | Ga0265762_10004882 | 269 |
| 629 | 3300030878 | Ga0265770_1012904 | Ga0265770_10129041 | 269 |
| 630 | 3300031090 | Ga0265760_10054174 | Ga0265760_100541742 | 269 |
| 631 | 3300031235 | Ga0265330_10051726 | Ga0265330_100517261 | 269 |
| 632 | 3300031235 | Ga0265330_10071971 | Ga0265330_100719712 | 269 |
| 633 | 3300031235 | Ga0265330_10106875 | Ga0265330_101068752 | 269 |
| 634 | 3300031239 | Ga0265328_10013480 | Ga0265328_100134802 | 269 |
| 635 | 3300031240 | Ga0265320_10014282 | Ga0265320_100142822 | 269 |
| 636 | 3300031241 | Ga0265325_10001002 | Ga0265325_1000100217 | 269 |
| 637 | 3300031241 | Ga0265325_10011355 | Ga0265325_100113553 | 269 |
| 638 | 3300031241 | Ga0265325_10063396 | Ga0265325_100633962 | 269 |
| 639 | 3300031241 | Ga0265325_10095057 | Ga0265325_100950571 | 269 |
| 640 | 3300031242 | Ga0265329_10026170 | Ga0265329_100261702 | 269 |
| 641 | 3300031247 | Ga0265340_10013477 | Ga0265340_100134773 | 269 |
| 642 | 3300031247 | Ga0265340_10077823 | Ga0265340_100778233 | 269 |
| 643 | 3300031249 | Ga0265339_10000026 | Ga0265339_1000002690 | 269 |
| 644 | 3300031249 | Ga0265339_10020456 | Ga0265339_100204564 | 269 |
| 645 | 3300031249 | Ga0265339_10049454 | Ga0265339_100494542 | 269 |
| 646 | 3300031250 | Ga0265331_10055339 | Ga0265331_100553392 | 269 |
| 647 | 3300031250 | Ga0265331_10161555 | Ga0265331_101615551 | 269 |
| 648 | 3300031344 | Ga0265316_10007137 | Ga0265316_100071374 | 269 |
| 649 | 3300031344 | Ga0265316_10042856 | Ga0265316_100428563 | 269 |
| 650 | 3300031344 | Ga0265316_10056146 | Ga0265316_100561462 | 269 |
| 651 | 3300031344 | Ga0265316_10068614 | Ga0265316_100686141 | 269 |
| 652 | 3300031344 | Ga0265316_10077223 | Ga0265316_100772232 | 269 |
| 653 | 3300031344 | Ga0265316_10144565 | Ga0265316_101445651 | 269 |
| 654 | 3300031344 | Ga0265316_10238546 | Ga0265316_102385462 | 269 |
| 655 | 3300031595 | Ga0265313_10004027 | Ga0265313_100040274 | 269 |
| 656 | 3300031595 | Ga0265313_10017181 | Ga0265313_100171814 | 269 |
| 657 | 3300031711 | Ga0265314_10000027 | Ga0265314_10000027205 | 269 |
| 658 | 3300031711 | Ga0265314_10001129 | Ga0265314_1000112920 | 269 |
| 659 | 3300031712 | Ga0265342_10001088 | Ga0265342_1000108810 | 269 |
| 660 | 3300031712 | Ga0265342_10003716 | Ga0265342_100037168 | 269 |
| 661 | 3300031712 | Ga0265342_10014725 | Ga0265342_100147253 | 269 |
| 662 | 3300031712 | Ga0265342_10116157 | Ga0265342_101161572 | 269 |
| 663 | 3300031712 | Ga0265342_10122531 | Ga0265342_101225312 | 269 |
| 664 | 3300031712 | Ga0265342_10247958 | Ga0265342_102479581 | 269 |
| 665 | 3300031852 | Ga0307410_10026419 | Ga0307410_100264194 | 269 |
| 666 | 3300031901 | Ga0307406_10109943 | Ga0307406_101099433 | 269 |
| 667 | 3300031911 | Ga0307412_10038414 | Ga0307412_100384142 | 269 |
| 668 | 3300031995 | Ga0307409_100003218 | Ga0307409_1000032185 | 269 |
| 669 | 3300032002 | Ga0307416_100156518 | Ga0307416_1001565181 | 269 |
| 670 | 3300032004 | Ga0307414_10036710 | Ga0307414_100367105 | 269 |
| 671 | 3300032126 | Ga0307415_100093447 | Ga0307415_1000934472 | 269 |
| 672 | 3300033547 | Ga0316212_1006505 | Ga0316212_10065052 | 269 |
| 673 | 3300035083 | Ga0373926_0006926 | Ga0373926_0006926_109_993 | 269 |
| 674 | 3300035089 | Ga0373944_0036806 | Ga0373944_0036806_485_1363 | 269 |
| 675 | 3300035111 | Ga0373923_0003069 | Ga0373923_0003069_2814_3692 | 269 |
| 676 | 3300035111 | Ga0373923_0049425 | Ga0373923_0049425_43_927 | 269 |
| 677 | 3300035113 | Ga0373936_0002785 | Ga0373936_0002785_686_1570 | 269 |
| 678 | 3300035113 | Ga0373936_0003142 | Ga0373936_0003142_5079_5957 | 269 |
| 679 | 3300035116 | Ga0373945_0001964 | Ga0373945_0001964_318_1196 | 269 |
| 680 | 3300035120 | Ga0373957_0032284 | Ga0373957_0032284_53_931 | 269 |
| 681 | 3300035121 | Ga0373960_0002247 | Ga0373960_0002247_1884_2768 | 269 |
| 682 | 3300035170 | Ga0373943_0001585 | Ga0373943_0001585_163_1041 | 269 |
| 683 | 3300035170 | Ga0373943_0014755 | Ga0373943_0014755_582_1466 | 269 |
| 684 | 3300035170 | Ga0373943_0076764 | Ga0373943_0076764_42_920 | 269 |
| 685 | 3300035170 | Ga0373943_0194782 | Ga0373943_0194782_208_1086 | 269 |
| 686 | 3300035171 | Ga0373946_0011405 | Ga0373946_0011405_439_1317 | 269 |
| 687 | 3300035172 | Ga0373955_0023790 | Ga0373955_0023790_2092_2970 | 269 |
| 688 | 3300035172 | Ga0373955_0040947 | Ga0373955_0040947_284_1162 | 269 |
| 689 | 3300035410 | Ga0373924_0008466 | Ga0373924_0008466_1124_2002 | 269 |
| 690 | 3300035410 | Ga0373924_0063975 | Ga0373924_0063975_156_1034 | 269 |
| 691 | 3300035691 | Ga0373931_0014910 | Ga0373931_0014910_1511_2389 | 269 |
| 692 | 3300035691 | Ga0373931_0062918 | Ga0373931_0062918_219_1103 | 269 |
| 693 | 3300035692 | Ga0373935_0010715 | Ga0373935_0010715_4289_5167 | 269 |
| 694 | 3300035692 | Ga0373935_0010969 | Ga0373935_0010969_1368_2252 | 269 |
| 695 | 3300035692 | Ga0373935_0020173 | Ga0373935_0020173_2940_3818 | 269 |
| 696 | 3300035692 | Ga0373935_0095867 | Ga0373935_0095867_839_1720 | 269 |
| 697 | 3300035695 | Ga0373927_0000705 | Ga0373927_0000705_19883_20761 | 269 |
| 698 | 3300035695 | Ga0373927_0016272 | Ga0373927_0016272_3254_4165 | 269 |
| 699 | 3300035695 | Ga0373927_0099070 | Ga0373927_0099070_102_986 | 269 |
| 700 | 3300035695 | Ga0373927_0103647 | Ga0373927_0103647_136_1020 | 269 |
| 701 | 3300035695 | Ga0373927_0159178 | Ga0373927_0159178_229_1158 | 269 |
| 702 | 3300035695 | Ga0373927_0377675 | Ga0373927_0377675_16_900 | 269 |
| 703 | 3300035725 | Ga0373947_0000098 | Ga0373947_0000098_5286_6164 | 269 |
| 704 | 3300035725 | Ga0373947_0001211 | Ga0373947_0001211_5259_6143 | 269 |
| 705 | 3300035725 | Ga0373947_0007307 | Ga0373947_0007307_4882_5760 | 269 |
| 706 | 3300035725 | Ga0373947_0207103 | Ga0373947_0207103_358_1242 | 269 |
| 707 | 3300036401 | Ga0373937_0006834 | Ga0373937_0006834_5681_6556 | 269 |
| 708 | 3300036401 | Ga0373937_0022927 | Ga0373937_0022927_1930_2808 | 269 |
| 709 | 3300036401 | Ga0373937_0118008 | Ga0373937_0118008_762_1640 | 269 |
| 710 | 3300036401 | Ga0373937_0245157 | Ga0373937_0245157_183_1061 | 269 |
| 711 | 3300036401 | Ga0373937_0520630 | Ga0373937_0520630_154_1032 | 269 |
| 712 | 3300036401 | Ga0373937_0710474 | Ga0373937_0710474_16_900 | 269 |
| 713 | 3300037068 | Ga0373925_0002146 | Ga0373925_0002146_1480_2358 | 269 |
| 714 | 3300037068 | Ga0373925_0002505 | Ga0373925_0002505_9334_10218 | 269 |
| 715 | 3300037068 | Ga0373925_0008716 | Ga0373925_0008716_2819_3697 | 269 |
| 716 | 3300037068 | Ga0373925_0015235 | Ga0373925_0015235_3934_4818 | 269 |
| 717 | 3300037068 | Ga0373925_0070341 | Ga0373925_0070341_1539_2423 | 269 |
| 718 | 3300037068 | Ga0373925_0155499 | Ga0373925_0155499_463_1341 | 269 |
| 719 | 3300037471 | Ga0395905_0090202 | Ga0395905_0090202_1650_2540 | 269 |
| 720 | 3300037471 | Ga0395905_0381212 | Ga0395905_0381212_355_1245 | 269 |
| 721 | 3300039438 | Ga0436360_0017782 | Ga0436360_0017782_2197_3072 | 269 |
| 722 | 3300039447 | Ga0436361_0063152 | Ga0436361_0063152_120_995 | 269 |
| 723 | 3300039447 | Ga0436361_0684605 | Ga0436361_0684605_14842_15717 | 269 |
| 724 | 3300039450 | Ga0436363_0563853 | Ga0436363_0563853_612_1490 | 269 |
| 725 | 3300042876 | Ga0451577_0371796 | Ga0451577_0371796_400_1287 | 269 |
| 726 | 3300042876 | Ga0451577_0394681 | Ga0451577_0394681_46_921 | 269 |
| 727 | 3300044694 | Ga0466963_0061959 | Ga0466963_0061959_1446_2321 | 269 |
| 728 | 3300045051 | Ga0451576_0192585 | Ga0451576_0192585_520_1398 | 269 |
| 729 | 3300045976 | Ga0466967_0026088 | Ga0466967_0026088_3599_4474 | 269 |
| 730 | 3300045976 | Ga0466967_0062269 | Ga0466967_0062269_302_1186 | 269 |
| 731 | 3300046459 | Ga0495629_0029703 | Ga0495629_0029703_1825_2700 | 269 |
| 732 | 3300046472 | Ga0495580_0000007 | Ga0495580_0000007_71527_72405 | 269 |
| 733 | 3300046472 | Ga0495580_0000616 | Ga0495580_0000616_24620_25531 | 269 |
| 734 | 3300046472 | Ga0495580_0001673 | Ga0495580_0001673_8204_9088 | 269 |
| 735 | 3300046472 | Ga0495580_0005636 | Ga0495580_0005636_3587_4474 | 269 |
| 736 | 3300046472 | Ga0495580_0005942 | Ga0495580_0005942_738_1622 | 269 |
| 737 | 3300046472 | Ga0495580_0054936 | Ga0495580_0054936_501_1388 | 269 |
| 738 | 3300046472 | Ga0495580_0077068 | Ga0495580_0077068_552_1439 | 269 |
| 739 | 3300046473 | Ga0495582_0000596 | Ga0495582_0000596_7357_8241 | 269 |
| 740 | 3300046473 | Ga0495582_0028246 | Ga0495582_0028246_655_1533 | 269 |
| 741 | 3300046516 | Ga0495628_0194153 | Ga0495628_0194153_582_1460 | 269 |
| 742 | 3300046516 | Ga0495628_0372698 | Ga0495628_0372698_82_960 | 269 |
| 743 | 3300046517 | Ga0495630_0066967 | Ga0495630_0066967_1057_1935 | 269 |
| 744 | 3300046517 | Ga0495630_0137018 | Ga0495630_0137018_687_1571 | 269 |
| 745 | 3300046531 | Ga0495665_0009559 | Ga0495665_0009559_121_1005 | 269 |
| 746 | 3300046533 | Ga0495640_0160338 | Ga0495640_0160338_41_919 | 269 |
| 747 | 3300046535 | Ga0495586_0110116 | Ga0495586_0110116_231_1115 | 269 |
| 748 | 3300046642 | Ga0495634_0040225 | Ga0495634_0040225_993_1868 | 269 |
| 749 | 3300046642 | Ga0495634_0304811 | Ga0495634_0304811_61_939 | 269 |
| 750 | 3300046660 | Ga0495625_0096041 | Ga0495625_0096041_1075_1950 | 269 |
| 751 | 3300046679 | Ga0495623_0026906 | Ga0495623_0026906_432_1307 | 269 |
| 752 | 3300047315 | Ga0495581_0044528 | Ga0495581_0044528_1408_2292 | 269 |
| 753 | 3300047319 | Ga0495674_0010450 | Ga0495674_0010450_7646_8524 | 269 |
| 754 | 3300047319 | Ga0495674_0011051 | Ga0495674_0011051_54_929 | 269 |
| 755 | 3300047319 | Ga0495674_0028291 | Ga0495674_0028291_3971_4849 | 269 |
| 756 | 3300047319 | Ga0495674_0108374 | Ga0495674_0108374_706_1584 | 269 |
| 757 | 3300047319 | Ga0495674_0125797 | Ga0495674_0125797_521_1405 | 269 |
| 758 | 3300047322 | Ga0495680_0013756 | Ga0495680_0013756_1758_2636 | 269 |
| 759 | 3300047444 | Ga0495675_0066528 | Ga0495675_0066528_662_1537 | 269 |
| 760 | 3300048088 | Ga0495602_0054057 | Ga0495602_0054057_1765_2649 | 269 |
| 761 | 3300048088 | Ga0495602_0135472 | Ga0495602_0135472_672_1556 | 269 |
| 762 | 3300048088 | Ga0495602_0321004 | Ga0495602_0321004_215_1090 | 269 |
| 763 | 3300048903 | Ga0496100_0010694 | Ga0496100_0010694_2855_3733 | 269 |
| 764 | 3300048903 | Ga0496100_0028214 | Ga0496100_0028214_43_921 | 269 |
| 765 | 3300048903 | Ga0496100_0136980 | Ga0496100_0136980_196_1074 | 269 |
| 766 | 3300048904 | Ga0496101_0054727 | Ga0496101_0054727_343_1227 | 269 |
| 767 | 3300048904 | Ga0496101_0085054 | Ga0496101_0085054_1316_2194 | 269 |
| 768 | 3300048905 | Ga0496102_0023540 | Ga0496102_0023540_2990_3868 | 269 |
| 769 | 3300048905 | Ga0496102_0041679 | Ga0496102_0041679_2706_3590 | 269 |
| 770 | 3300048905 | Ga0496102_0122189 | Ga0496102_0122189_246_1121 | 269 |
| 771 | 3300048906 | Ga0496103_0004099 | Ga0496103_0004099_5585_6463 | 269 |
| 772 | 3300048907 | Ga0496104_0002935 | Ga0496104_0002935_11728_12606 | 269 |
| 773 | 3300048907 | Ga0496104_0022237 | Ga0496104_0022237_4725_5600 | 269 |
| 774 | 3300048907 | Ga0496104_0027472 | Ga0496104_0027472_1248_2123 | 269 |
| 775 | 3300048907 | Ga0496104_0088978 | Ga0496104_0088978_1977_2861 | 269 |
| 776 | 3300048907 | Ga0496104_0530688 | Ga0496104_0530688_65_949 | 269 |
| 777 | 3300048908 | Ga0496105_0025158 | Ga0496105_0025158_2259_3137 | 269 |
| 778 | 3300048908 | Ga0496105_0150797 | Ga0496105_0150797_34_909 | 269 |
| 779 | 3300048909 | Ga0496106_0056476 | Ga0496106_0056476_1538_2416 | 269 |
| 780 | 3300048910 | Ga0496107_0020293 | Ga0496107_0020293_17_892 | 269 |
| 781 | 3300048910 | Ga0496107_0051391 | Ga0496107_0051391_1007_1885 | 269 |
| 782 | 3300048910 | Ga0496107_0301290 | Ga0496107_0301290_43_921 | 269 |
| 783 | 3300048911 | Ga0496108_0001842 | Ga0496108_0001842_14349_15233 | 269 |
| 784 | 3300048911 | Ga0496108_0160302 | Ga0496108_0160302_392_1270 | 269 |
| 785 | 3300048912 | Ga0496109_0000178 | Ga0496109_0000178_59242_60126 | 269 |
| 786 | 3300048913 | Ga0496110_0001986 | Ga0496110_0001986_6363_7247 | 269 |
| 787 | 3300048913 | Ga0496110_0399971 | Ga0496110_0399971_194_1069 | 269 |
| 788 | 3300048914 | Ga0496111_0005461 | Ga0496111_0005461_541_1425 | 269 |
| 789 | 3300048915 | Ga0496112_0000068 | Ga0496112_0000068_64250_65134 | 269 |
| 790 | 3300048915 | Ga0496112_0010744 | Ga0496112_0010744_4321_5199 | 269 |
| 791 | 3300048915 | Ga0496112_0022198 | Ga0496112_0022198_603_1481 | 269 |
| 792 | 3300048915 | Ga0496112_0024389 | Ga0496112_0024389_2166_3044 | 269 |
| 793 | 3300048915 | Ga0496112_0292122 | Ga0496112_0292122_45_923 | 269 |
| 794 | 3300048915 | Ga0496112_0719641 | Ga0496112_0719641_23_898 | 269 |
| 795 | 3300048916 | Ga0496113_0003902 | Ga0496113_0003902_5200_6084 | 269 |
| 796 | 3300048917 | Ga0496114_0037963 | Ga0496114_0037963_2132_3007 | 269 |
| 797 | 3300048917 | Ga0496114_0215583 | Ga0496114_0215583_635_1513 | 269 |
| 798 | 3300048917 | Ga0496114_0327437 | Ga0496114_0327437_347_1234 | 269 |
| 799 | 3300048918 | Ga0496115_0007191 | Ga0496115_0007191_4318_5196 | 269 |
| 800 | 3300048918 | Ga0496115_0034019 | Ga0496115_0034019_1360_2238 | 269 |
| 801 | 3300048918 | Ga0496115_0063161 | Ga0496115_0063161_1270_2145 | 269 |
| 802 | 3300048929 | Ga0496126_0003062 | Ga0496126_0003062_5972_6847 | 269 |
| 803 | 3300050512 | nmdc:mga0n895_910_c1 | nmdc:mga0n895_910_c1_2033_2917 | 269 |
| 804 | 3300050513 | nmdc:mga0rr50_2425_c2 | nmdc:mga0rr50_2425_c2_695_1579 | 269 |
| 805 | 3300050513 | nmdc:mga0rr50_68603_c1 | nmdc:mga0rr50_68603_c1_154_1038 | 269 |
| 806 | 3300050514 | nmdc:mga08x19_1302_c1 | nmdc:mga08x19_1302_c1_6406_7290 | 269 |
| 807 | 3300050514 | nmdc:mga08x19_151853_c1 | nmdc:mga08x19_151853_c1_546_1430 | 269 |
| 808 | 3300053085 | Ga0495619_0052150 | Ga0495619_0052150_1663_2541 | 269 |
| 809 | 2162886011 | MRS1b_contig_200623 | MRS1b_0843.00000690 | 270 |
| 810 | 3300005290 | Ga0065712_10082087 | Ga0065712_100820872 | 270 |
| 811 | 3300005293 | Ga0065715_10118715 | Ga0065715_101187152 | 270 |
| 812 | 3300006846 | Ga0075430_100137326 | Ga0075430_1001373262 | 270 |
| 813 | 3300006847 | Ga0075431_100036989 | Ga0075431_1000369893 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mss-assembly1.cif.gz_A | human e105qa gtp-specific succinyl-coa synthetase complexed with succinate, magnesium ion and coa | 0.8988 | 2 | 269 |
| 2nua-assembly1.cif.gz_A | c123av mutant of e. coli succinyl-coa synthetase | 0.8922 | 5 | 266 |
| 7mss-assembly1.cif.gz_A | human e105qa gtp-specific succinyl-coa synthetase complexed with succinate, magnesium ion and coa | 0.8895 | 2 | 269 |
| 6mgg-assembly1.cif.gz_A | succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa | 0.8874 | 2 | 270 |
| 3ufx-assembly1.cif.gz_A | thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ | 0.8867 | 5 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jllA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9743 | 5 | 124 | 3.40.50.720 |
| 2yv2A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9553 | 5 | 124 | 3.40.50.720 |
| 1jllA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9433 | 5 | 124 | 3.40.50.720 |
| af_P9WGC7_1_134_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9413 | 1 | 121 | 3.40.50.720 |
| 2yv2A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9401 | 5 | 124 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2C9VZS3-F1-model_v4 | CoA-binding domain-containing protein | 0.9963 | 5 | 105 |
GO:0004775
GO:0004776 GO:0005739 GO:0006099 GO:0009361 |
| AF-A0A382W6R5-F1-model_v4 | CoA-binding domain-containing protein | 0.995 | 12 | 105 |
GO:0004775
GO:0004776 GO:0006099 GO:0009361 |
| AF-A0A7R9UUU5-F1-model_v4 | CoA-binding domain-containing protein | 0.9946 | 5 | 101 |
GO:0004775
GO:0004776 GO:0005739 GO:0006099 GO:0009361 |
| AF-A0A2D4K3L3-F1-model_v4 | CoA-binding domain-containing protein | 0.9919 | 5 | 107 |
GO:0004775
GO:0004776 GO:0005739 GO:0006099 GO:0009361 |
| AF-A0A182S948-F1-model_v4 | CoA-binding domain-containing protein | 0.9918 | 5 | 106 |
GO:0004775
GO:0004776 GO:0005739 GO:0006099 GO:0009361 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar