F482000

General Info

Members Datasets Scaffolds Average Seq Length
814 389 1628 290

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0013395|Ga0501074_0013395_2297_3271
Length 324
Sequence MPGLVPGIHALAANGVDGRVKPGHDAEGKRVQMPMHPRERLPYSPIEGRPPLKFPDGVRLVIWPVLALEEWDMARPMARMVISPPQGQPMQPDHPNWSWHEYGMRVGFWRLRKVLQRLNIAPTVTLNARVCETYPQVAQACVDLGWELNAHGYDQVPMHKLDDQRAVIDKSMDIIETFGGKRPRGWFGPGLTQTFDTLDYLSEAGVEYIGDWVLDDEPVTLKTTHNPVVALPYNFEIHDIVMMALQHHPSDVWHARAMDQFNWLYKEAAERPKVMALACHPYLSGVPHRIGHVERTFEELLSKDGVVAWDGSKILDWYLKAKAA

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
225 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
231 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
266 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
267 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
268 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
269 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
384 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 7
Rhizosphere 91.77
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0013395 3300049590 Bacteria 5961
2 2214884090 2209111006 Bacteria 7476
3 ARSoilYngRDRAFT_c00124 3300000042 Bacteria 13179
4 ARcpr5yngRDRAFT_c000127 3300000043 Bacteria 11898
5 ARSoilOldRDRAFT_c000125 3300000044 Bacteria 13694
6 ARCol0yngRDRAFT_1000457 3300000652 Bacteria 4957
7 JGI24032J14994_100889 3300001430 Bacteria 1464
8 JGI24746J21847_1003010 3300001977 Bacteria 2651
9 JGI24739J22299_10000496 3300001989 Bacteria 13922
10 JGI24739J22299_10025357 3300001989 Bacteria 2085
11 JGI24737J22298_10000886 3300001990 Bacteria 10683
12 JGI24750J21931_1001502 3300002070 Bacteria 2882
13 JGI24745J21846_1002381 3300002073 Bacteria 1919
14 JGI24738J21930_10009478 3300002075 Bacteria 2190
15 JGI24749J21850_1001896 3300002076 Bacteria 2953
16 JGI24035J26624_1006618 3300002126 Bacteria 1121
17 JGI24034J26672_10009416 3300002239 Bacteria 1441
18 JGI24742J22300_10000526 3300002244 Bacteria 5718
19 JGI25404J52841_10002280 3300003659 Bacteria 3610
20 JGI25405J52794_10003226 3300003911 Bacteria 2845
21 Ga0065717_1002697 3300005276 Bacteria 1691
22 Ga0065716_1001902 3300005277 Bacteria 2809
23 Ga0065704_10146850 3300005289 Bacteria 1464
24 Ga0065712_10088653 3300005290 Bacteria 2509
25 Ga0065715_10095851 3300005293 Bacteria 3992
26 Ga0065715_10103296 3300005293 Bacteria 3044
27 Ga0070658_10004719 3300005327 Bacteria 11081
28 Ga0070676_10003793 3300005328 Bacteria 7927
29 Ga0070683_100000419 3300005329 Bacteria 29332
30 Ga0070683_100080648 3300005329 Bacteria 3046
31 Ga0070683_100112482 3300005329 Bacteria 2569
32 Ga0070683_100306447 3300005329 Bacteria 1511
33 Ga0070690_100040215 3300005330 Bacteria 2956
34 Ga0070690_100176812 3300005330 Bacteria 1473
35 Ga0070670_100004223 3300005331 Bacteria 12019
36 Ga0070670_100151986 3300005331 Bacteria 2004
37 Ga0070677_10000623 3300005333 Bacteria 11914
38 Ga0068869_100001088 3300005334 Bacteria 15856
39 Ga0070666_10005030 3300005335 Bacteria 8087
40 Ga0070680_100003470 3300005336 Bacteria 11772
41 Ga0070680_100013953 3300005336 Bacteria 6271
42 Ga0070680_100200094 3300005336 Bacteria 1684
43 Ga0070680_100350779 3300005336 Bacteria 1255
44 Ga0070682_100003573 3300005337 Bacteria 8606
45 Ga0068868_100004854 3300005338 Bacteria 9443
46 Ga0070660_100001074 3300005339 Bacteria 18362
47 Ga0070660_100001863 3300005339 Bacteria 14518
48 Ga0070660_100215838 3300005339 Bacteria 1558
49 Ga0070689_100010277 3300005340 Bacteria 6669
50 Ga0070689_100049301 3300005340 Bacteria 3250
51 Ga0070689_100108844 3300005340 Unclassified 2202
52 Ga0070689_100372045 3300005340 Bacteria 1203
53 Ga0070691_10101810 3300005341 Bacteria 1427
54 Ga0070687_100001557 3300005343 Bacteria 8144
55 Ga0070661_100000894 3300005344 Bacteria 21404
56 Ga0070668_100063434 3300005347 Bacteria 2864
57 Ga0070668_100273659 3300005347 Bacteria 1408
58 Ga0070669_100003330 3300005353 Bacteria 11549
59 Ga0070669_100234799 3300005353 Bacteria 1455
60 Ga0070675_100006928 3300005354 Bacteria 8704
61 Ga0070671_100226112 3300005355 Bacteria 1588
62 Ga0070674_100001693 3300005356 Bacteria 11933
63 Ga0070673_100001300 3300005364 Bacteria 14539
64 Ga0070688_100000384 3300005365 Bacteria 22439
65 Ga0070688_100056498 3300005365 Bacteria 2465
66 Ga0070659_100003102 3300005366 Bacteria 11820
67 Ga0070659_100046844 3300005366 Bacteria 3390
68 Ga0070667_100011097 3300005367 Bacteria 7454
69 Ga0070667_100069921 3300005367 Bacteria 2988
70 Ga0070667_100188414 3300005367 Bacteria 1827
71 Ga0070703_10038998 3300005406 Bacteria 1471
72 Ga0070709_10013109 3300005434 Bacteria 4654
73 Ga0070709_10020886 3300005434 Bacteria 3809
74 Ga0070714_100046839 3300005435 Bacteria 3670
75 Ga0070714_100252961 3300005435 Bacteria 1630
76 Ga0070714_100548327 3300005435 Bacteria 1107
77 Ga0070713_100003935 3300005436 Bacteria 9865
78 Ga0070713_100006430 3300005436 Bacteria 8146
79 Ga0070710_10006745 3300005437 Bacteria 5534
80 Ga0070701_10000053 3300005438 Bacteria 29673
81 Ga0070711_100044157 3300005439 Bacteria 3023
82 Ga0070711_100074528 3300005439 Bacteria 2400
83 Ga0070711_100188635 3300005439 Bacteria 1583
84 Ga0070705_100025013 3300005440 Bacteria 3231
85 Ga0070700_100000995 3300005441 Bacteria 13976
86 Ga0070694_100004798 3300005444 Bacteria 8139
87 Ga0070694_100500789 3300005444 Bacteria 967
88 Ga0070708_100142584 3300005445 Bacteria 2223
89 Ga0070708_100335278 3300005445 Unclassified 1425
90 Ga0070663_100005062 3300005455 Bacteria 7787
91 Ga0070663_100083500 3300005455 Bacteria 2352
92 Ga0070663_100190608 3300005455 Bacteria 1595
93 Ga0070663_100218673 3300005455 Bacteria 1495
94 Ga0070678_100011901 3300005456 Bacteria 5385
95 Ga0070678_100089594 3300005456 Bacteria 2355
96 Ga0070662_100001392 3300005457 Bacteria 14897
97 Ga0070662_100167618 3300005457 Bacteria 1722
98 Ga0070681_10010566 3300005458 Bacteria 9118
99 Ga0070681_10157101 3300005458 Bacteria 2198
100 Ga0068867_100007589 3300005459 Bacteria 7676
101 Ga0068867_100088580 3300005459 Bacteria 2346
102 Ga0070685_10001493 3300005466 Bacteria 12316
103 Ga0070706_100004167 3300005467 Bacteria 14057
104 Ga0070707_100449188 3300005468 Bacteria 1250
105 Ga0070698_100339980 3300005471 Bacteria 1432
106 Ga0070699_100000829 3300005518 Bacteria 28653
107 Ga0070679_100021813 3300005530 Bacteria 6255
108 Ga0070679_100062401 3300005530 Bacteria 3715
109 Ga0070679_100236204 3300005530 Bacteria 1787
110 Ga0070679_100642765 3300005530 Bacteria 1004
111 Ga0070684_100001048 3300005535 Bacteria 19748
112 Ga0070684_100294099 3300005535 Bacteria 1489
113 Ga0068853_100000976 3300005539 Bacteria 20134
114 Ga0070672_100000458 3300005543 Bacteria 23647
115 Ga0070686_100001811 3300005544 Bacteria 11922
116 Ga0070695_100000550 3300005545 Bacteria 19844
117 Ga0070696_100055945 3300005546 Bacteria 2751
118 Ga0070696_100115324 3300005546 Bacteria 1938
119 Ga0070696_100159818 3300005546 Bacteria 1659
120 Ga0070696_100198223 3300005546 Bacteria 1498
121 Ga0070693_100040580 3300005547 Bacteria 2613
122 Ga0070665_100077915 3300005548 Bacteria 3321
123 Ga0070665_100202705 3300005548 Bacteria 1984
124 Ga0070704_100007431 3300005549 Bacteria 6526
125 Ga0070704_100099683 3300005549 Bacteria 2185
126 Ga0070704_100522181 3300005549 Bacteria 1034
127 Ga0068855_100005184 3300005563 Bacteria 15895
128 Ga0068855_100015368 3300005563 Bacteria 9215
129 Ga0068855_100581964 3300005563 Bacteria 1209
130 Ga0070664_100001280 3300005564 Bacteria 20134
131 Ga0070664_100032243 3300005564 Bacteria 4382
132 Ga0070664_100128279 3300005564 Bacteria 2226
133 Ga0070664_100581263 3300005564 Bacteria 1038
134 Ga0068857_100000630 3300005577 Bacteria 25882
135 Ga0068854_100000802 3300005578 Bacteria 18733
136 Ga0068856_100001005 3300005614 Bacteria 30012
137 Ga0068856_100130400 3300005614 Bacteria 2518
138 Ga0070702_100004228 3300005615 Bacteria 6535
139 Ga0068852_100060331 3300005616 Bacteria 3292
140 Ga0068852_100129000 3300005616 Bacteria 2326
141 Ga0068852_100195391 3300005616 Bacteria 1911
142 Ga0068859_100251889 3300005617 Bacteria 1856
143 Ga0068864_100000140 3300005618 Bacteria 69827
144 Ga0068864_100204338 3300005618 Bacteria 1816
145 Ga0068861_100001121 3300005719 Bacteria 16605
146 Ga0068863_100000425 3300005841 Bacteria 42737
147 Ga0068863_100133417 3300005841 Bacteria 2372
148 Ga0068863_100190754 3300005841 Bacteria 1969
149 Ga0068863_100484232 3300005841 Bacteria 1217
150 Ga0068858_100004894 3300005842 Bacteria 13135
151 Ga0068858_100043093 3300005842 Bacteria 4184
152 Ga0068858_100065262 3300005842 Bacteria 3368
153 Ga0068858_100145563 3300005842 Bacteria 2225
154 Ga0068860_100002221 3300005843 Bacteria 20432
155 Ga0068860_100832392 3300005843 Bacteria 937
156 Ga0068862_100001418 3300005844 Bacteria 22202
157 Ga0081455_10000091 3300005937 Bacteria 97617
158 Ga0081455_10006350 3300005937 Bacteria 12691
159 Ga0081455_10007779 3300005937 Bacteria 11235
160 Ga0081455_10057711 3300005937 Bacteria 3289
161 Ga0081540_1000068 3300005983 Bacteria 112697
162 Ga0081540_1011418 3300005983 Bacteria 5937
163 Ga0081540_1050880 3300005983 Bacteria 2053
164 Ga0070717_10003725 3300006028 Bacteria 10947
165 Ga0070717_10041544 3300006028 Bacteria 3748
166 Ga0075365_10144773 3300006038 Bacteria 1651
167 Ga0070715_10002493 3300006163 Bacteria 5667
168 Ga0070716_100010029 3300006173 Bacteria 4738
169 Ga0070712_100100082 3300006175 Bacteria 2141
170 Ga0075369_10006378 3300006186 Bacteria 4459
171 Ga0075427_10001272 3300006194 Bacteria 3220
172 Ga0097621_100001542 3300006237 Bacteria 15764
173 Ga0097621_100006138 3300006237 Bacteria 8510
174 Ga0097621_100055513 3300006237 Bacteria 3235
175 Ga0097621_100207309 3300006237 Bacteria 1704
176 Ga0068871_100000938 3300006358 Bacteria 19471
177 Ga0068871_100057854 3300006358 Bacteria 3155
178 Ga0068871_100069536 3300006358 Bacteria 2892
179 Ga0075428_100144863 3300006844 Bacteria 2582
180 Ga0075430_100017069 3300006846 Bacteria 6183
181 Ga0075430_100018342 3300006846 Bacteria 5956
182 Ga0075430_100132135 3300006846 Bacteria 2080
183 Ga0075431_100014631 3300006847 Bacteria 7938
184 Ga0075431_100024210 3300006847 Bacteria 6218
185 Ga0075431_100121078 3300006847 Bacteria 2700
186 Ga0075431_100216345 3300006847 Bacteria 1955
187 Ga0075431_100235803 3300006847 Bacteria 1863
188 Ga0075433_10110347 3300006852 Bacteria 2440
189 Ga0075433_10181970 3300006852 Bacteria 1870
190 Ga0075434_100008958 3300006871 Bacteria 9320
191 Ga0075434_100016992 3300006871 Bacteria 7001
192 Ga0075434_100082865 3300006871 Bacteria 3205
193 Ga0075434_100178784 3300006871 Bacteria 2141
194 Ga0075434_100253886 3300006871 Bacteria 1777
195 Ga0075434_100402587 3300006871 Bacteria 1390
196 Ga0068865_100002772 3300006881 Bacteria 10413
197 Ga0075436_100021379 3300006914 Bacteria 4442
198 Ga0097620_100251864 3300006931 Bacteria 1856
199 Ga0075435_100011643 3300007076 Bacteria 6483
200 Ga0075435_100049443 3300007076 Bacteria 3382
201 Ga0075435_100141600 3300007076 Bacteria 2018
202 Ga0075435_100157945 3300007076 Bacteria 1909
203 Ga0099794_10010006 3300007265 Bacteria 4014
204 Ga0105244_10079447 3300009036 Bacteria 1626
205 Ga0105240_10410677 3300009093 Bacteria 1523
206 Ga0111539_10013242 3300009094 Bacteria 10308
207 Ga0111539_10068122 3300009094 Bacteria 4202
208 Ga0111539_10132394 3300009094 Bacteria 2920
209 Ga0111539_10148458 3300009094 Bacteria 2744
210 Ga0111539_10938521 3300009094 Bacteria 1006
211 Ga0105245_10004587 3300009098 Bacteria 12202
212 Ga0105245_10007019 3300009098 Bacteria 9882
213 Ga0105245_10014701 3300009098 Bacteria 6815
214 Ga0105247_10007542 3300009101 Bacteria 6664
215 Ga0105247_10013219 3300009101 Bacteria 4951
216 Ga0114129_10018126 3300009147 Bacteria 10027
217 Ga0114129_10045452 3300009147 Bacteria 6173
218 Ga0114129_10111386 3300009147 Bacteria 3777
219 Ga0114129_10199475 3300009147 Bacteria 2711
220 Ga0105243_10014317 3300009148 Bacteria 6001
221 Ga0105242_10002741 3300009176 Bacteria 13782
222 Ga0105242_10065486 3300009176 Bacteria 2998
223 Ga0105242_10374314 3300009176 Bacteria 1322
224 Ga0105248_10008864 3300009177 Bacteria 11055
225 Ga0105248_10047096 3300009177 Bacteria 4834
226 Ga0105248_10053904 3300009177 Bacteria 4511
227 Ga0105248_10113465 3300009177 Bacteria 3056
228 Ga0105237_10103613 3300009545 Bacteria 2837
229 Ga0105237_10128242 3300009545 Bacteria 2531
230 Ga0105238_10124446 3300009551 Bacteria 2558
231 Ga0105238_10126675 3300009551 Bacteria 2532
232 Ga0105249_10014469 3300009553 Bacteria 6974
233 Ga0099796_10001585 3300010159 Bacteria 4664
234 Ga0105239_10193263 3300010375 Bacteria 2278
235 Ga0105246_10000599 3300011119 Bacteria 19996
236 Ga0157336_1000226 3300012477 Bacteria 2474
237 Ga0157371_10027149 3300013102 Bacteria 4155
238 Ga0157371_10181661 3300013102 Bacteria 1504
239 Ga0157370_10365303 3300013104 Bacteria 1330
240 Ga0157369_10364446 3300013105 Bacteria 1500
241 Ga0157374_10090125 3300013296 Bacteria 2923
242 Ga0157374_10277257 3300013296 Bacteria 1655
243 Ga0157378_10268385 3300013297 Bacteria 1640
244 Ga0163162_10022422 3300013306 Bacteria 6221
245 Ga0163162_10029973 3300013306 Bacteria 5387
246 Ga0163162_10241226 3300013306 Bacteria 1938
247 Ga0163162_10349766 3300013306 Unclassified 1611
248 Ga0163162_10605011 3300013306 Bacteria 1222
249 Ga0157372_10081649 3300013307 Bacteria 3659
250 Ga0157375_10001131 3300013308 Bacteria 23092
251 Ga0157375_10002488 3300013308 Bacteria 15965
252 Ga0163163_10019116 3300014325 Bacteria 6428
253 Ga0163163_10022743 3300014325 Bacteria 5940
254 Ga0163163_10158680 3300014325 Bacteria 2307
255 Ga0157380_10000894 3300014326 Bacteria 18734
256 Ga0157380_10217025 3300014326 Bacteria 1709
257 Ga0157377_10000696 3300014745 Bacteria 13852
258 Ga0157377_10090537 3300014745 Bacteria 1806
259 Ga0157379_10005316 3300014968 Bacteria 11062
260 Ga0157379_10062283 3300014968 Bacteria 3337
261 Ga0157376_10008132 3300014969 Bacteria 7540
262 Ga0157376_10224250 3300014969 Bacteria 1743
263 Ga0157376_10225265 3300014969 Bacteria 1739
264 Ga0163161_10010626 3300017792 Bacteria 6374
265 Ga0213876_10038132 3300021384 Bacteria 2535
266 Ga0207666_1000052 3300025271 Bacteria 20908
267 Ga0207697_10000169 3300025315 Bacteria 33307
268 Ga0207655_1076877 3300025728 Bacteria 1219
269 Ga0207653_10001090 3300025885 Bacteria 8908
270 Ga0207682_10000859 3300025893 Bacteria 14091
271 Ga0207692_10035165 3300025898 Bacteria 2433
272 Ga0207692_10081781 3300025898 Bacteria 1729
273 Ga0207642_10001773 3300025899 Bacteria 6672
274 Ga0207688_10000024 3300025901 Bacteria 48792
275 Ga0207680_10002348 3300025903 Bacteria 8799
276 Ga0207699_10001996 3300025906 Bacteria 9644
277 Ga0207699_10171286 3300025906 Bacteria 1452
278 Ga0207699_10236634 3300025906 Bacteria 1253
279 Ga0207645_10000538 3300025907 Bacteria 31527
280 Ga0207643_10000035 3300025908 Bacteria 90905
281 Ga0207684_10003395 3300025910 Bacteria 15592
282 Ga0207707_10032345 3300025912 Bacteria 4578
283 Ga0207707_10072923 3300025912 Bacteria 2993
284 Ga0207707_10091109 3300025912 Bacteria 2665
285 Ga0207695_10068916 3300025913 Bacteria 3623
286 Ga0207671_10007789 3300025914 Bacteria 9222
287 Ga0207671_10078469 3300025914 Bacteria 2473
288 Ga0207671_10107971 3300025914 Bacteria 2115
289 Ga0207693_10003819 3300025915 Bacteria 12829
290 Ga0207693_10014157 3300025915 Bacteria 6424
291 Ga0207693_10038334 3300025915 Bacteria 3775
292 Ga0207663_10007219 3300025916 Bacteria 5750
293 Ga0207663_10018925 3300025916 Bacteria 3868
294 Ga0207663_10033317 3300025916 Bacteria 3068
295 Ga0207663_10235025 3300025916 Bacteria 1341
296 Ga0207663_10467073 3300025916 Bacteria 975
297 Ga0207660_10002466 3300025917 Bacteria 12145
298 Ga0207660_10009921 3300025917 Bacteria 6168
299 Ga0207662_10001196 3300025918 Bacteria 12377
300 Ga0207662_10028942 3300025918 Bacteria 3207
301 Ga0207657_10003229 3300025919 Bacteria 17451
302 Ga0207657_10005139 3300025919 Bacteria 13716
303 Ga0207657_10031263 3300025919 Bacteria 4826
304 Ga0207649_10000412 3300025920 Bacteria 31594
305 Ga0207649_10081125 3300025920 Bacteria 2100
306 Ga0207652_10021544 3300025921 Bacteria 5319
307 Ga0207652_10207941 3300025921 Bacteria 1762
308 Ga0207646_10371971 3300025922 Bacteria 1291
309 Ga0207681_10000553 3300025923 Bacteria 25812
310 Ga0207681_10490773 3300025923 Bacteria 1004
311 Ga0207694_10009714 3300025924 Bacteria 7257
312 Ga0207694_10090437 3300025924 Bacteria 2415
313 Ga0207694_10526840 3300025924 Bacteria 990
314 Ga0207650_10005710 3300025925 Bacteria 8492
315 Ga0207659_10000091 3300025926 Bacteria 53079
316 Ga0207687_10000161 3300025927 Bacteria 45255
317 Ga0207687_10010301 3300025927 Bacteria 6108
318 Ga0207700_10005167 3300025928 Bacteria 7772
319 Ga0207700_10052187 3300025928 Bacteria 3056
320 Ga0207700_10264082 3300025928 Bacteria 1475
321 Ga0207700_10475458 3300025928 Bacteria 1104
322 Ga0207664_10067292 3300025929 Bacteria 2874
323 Ga0207664_10465830 3300025929 Bacteria 1129
324 Ga0207644_10002790 3300025931 Bacteria 11252
325 Ga0207644_10011541 3300025931 Bacteria 5848
326 Ga0207690_10002912 3300025932 Bacteria 10313
327 Ga0207690_10024199 3300025932 Bacteria 3801
328 Ga0207690_10125811 3300025932 Bacteria 1869
329 Ga0207706_10027574 3300025933 Bacteria 5078
330 Ga0207706_10068037 3300025933 Bacteria 3135
331 Ga0207686_10001075 3300025934 Bacteria 16031
332 Ga0207686_10008756 3300025934 Bacteria 5467
333 Ga0207686_10122799 3300025934 Bacteria 1770
334 Ga0207709_10000575 3300025935 Bacteria 30869
335 Ga0207670_10000182 3300025936 Bacteria 41877
336 Ga0207669_10000082 3300025937 Bacteria 48083
337 Ga0207704_10000604 3300025938 Bacteria 15864
338 Ga0207704_10120109 3300025938 Bacteria 1796
339 Ga0207665_10004294 3300025939 Bacteria 9475
340 Ga0207665_10006035 3300025939 Bacteria 8048
341 Ga0207665_10336138 3300025939 Bacteria 1137
342 Ga0207691_10000336 3300025940 Bacteria 47166
343 Ga0207691_10127418 3300025940 Bacteria 2251
344 Ga0207711_10012924 3300025941 Bacteria 6935
345 Ga0207711_10015124 3300025941 Bacteria 6409
346 Ga0207711_10281434 3300025941 Bacteria 1532
347 Ga0207689_10002022 3300025942 Bacteria 19169
348 Ga0207661_10001715 3300025944 Bacteria 14983
349 Ga0207661_10059660 3300025944 Bacteria 3075
350 Ga0207679_10000035 3300025945 Bacteria 144173
351 Ga0207679_10034926 3300025945 Bacteria 3553
352 Ga0207679_10125845 3300025945 Bacteria 2048
353 Ga0207679_10536679 3300025945 Bacteria 1048
354 Ga0207667_10008094 3300025949 Bacteria 12534
355 Ga0207667_10025683 3300025949 Bacteria 6445
356 Ga0207667_10099832 3300025949 Bacteria 2995
357 Ga0207667_10515412 3300025949 Bacteria 1212
358 Ga0207651_10002513 3300025960 Bacteria 8759
359 Ga0207712_10000429 3300025961 Bacteria 35843
360 Ga0207712_10073978 3300025961 Bacteria 2459
361 Ga0207668_10000149 3300025972 Bacteria 48188
362 Ga0207668_10500743 3300025972 Bacteria 1045
363 Ga0207640_10008008 3300025981 Bacteria 5838
364 Ga0207640_10035961 3300025981 Bacteria 3105
365 Ga0207658_10003056 3300025986 Bacteria 11974
366 Ga0207658_10056414 3300025986 Bacteria 2915
367 Ga0207658_10105228 3300025986 Bacteria 2219
368 Ga0207658_10130044 3300025986 Bacteria 2021
369 Ga0207677_10003478 3300026023 Bacteria 8351
370 Ga0207703_10004085 3300026035 Bacteria 12041
371 Ga0207703_10236497 3300026035 Bacteria 1640
372 Ga0207703_10391373 3300026035 Bacteria 1288
373 Ga0207639_10002878 3300026041 Bacteria 11561
374 Ga0207678_10001400 3300026067 Bacteria 22181
375 Ga0207678_10012249 3300026067 Bacteria 7531
376 Ga0207678_10099921 3300026067 Bacteria 2478
377 Ga0207708_10000896 3300026075 Bacteria 22353
378 Ga0207702_10002760 3300026078 Bacteria 16441
379 Ga0207641_10008796 3300026088 Bacteria 8340
380 Ga0207641_10050146 3300026088 Bacteria 3530
381 Ga0207641_10088031 3300026088 Bacteria 2711
382 Ga0207648_10008471 3300026089 Bacteria 9953
383 Ga0207648_10056972 3300026089 Bacteria 3410
384 Ga0207648_10261405 3300026089 Bacteria 1544
385 Ga0207676_10000979 3300026095 Bacteria 22022
386 Ga0207676_10159117 3300026095 Bacteria 1954
387 Ga0207674_10006130 3300026116 Bacteria 14213
388 Ga0207674_10151601 3300026116 Bacteria 2275
389 Ga0207675_100001667 3300026118 Bacteria 22216
390 Ga0207675_100118496 3300026118 Bacteria 2503
391 Ga0207675_100533160 3300026118 Bacteria 1172
392 Ga0207683_10000457 3300026121 Bacteria 37951
393 Ga0207683_10006130 3300026121 Bacteria 10299
394 Ga0207683_10013806 3300026121 Bacteria 6888
395 Ga0207698_10149178 3300026142 Bacteria 2027
396 Ga0209984_1004399 3300027424 Bacteria 1659
397 Ga0209179_1022594 3300027512 Bacteria 1236
398 Ga0209588_1014590 3300027671 Bacteria 2407
399 Ga0209971_1004021 3300027682 Bacteria 3476
400 Ga0209966_1000836 3300027695 Bacteria 6020
401 Ga0209974_10003856 3300027876 Bacteria 5372
402 Ga0207428_10000075 3300027907 Bacteria 137887
403 Ga0207428_10001163 3300027907 Bacteria 28365
404 Ga0207428_10002495 3300027907 Bacteria 18379
405 Ga0268266_10116185 3300028379 Bacteria 2376
406 Ga0268266_10240167 3300028379 Bacteria 1672
407 Ga0268265_10001635 3300028380 Bacteria 18413
408 Ga0268264_10000813 3300028381 Bacteria 33664
409 Ga0268264_10089113 3300028381 Bacteria 2656
410 Ga0265342_10001792 3300031712 Bacteria 19528
411 Ga0373930_0009915 3300034816 Bacteria 1693
412 Ga0373930_0010916 3300034816 Bacteria 1631
413 Ga0373948_0000943 3300034817 Bacteria 3901
414 Ga0373959_0008280 3300034820 Bacteria 1767
415 Ga0373938_0000151 3300034957 Bacteria 10052
416 Ga0373929_0000167 3300035085 Bacteria 11504
417 Ga0373929_0006898 3300035085 Bacteria 2063
418 Ga0373929_0013103 3300035085 Bacteria 1585
419 Ga0373934_0008237 3300035086 Bacteria 3882
420 Ga0373940_0013026 3300035088 Bacteria 2002
421 Ga0373940_0016673 3300035088 Bacteria 1822
422 Ga0373944_0011315 3300035089 Bacteria 2443
423 Ga0373944_0018674 3300035089 Bacteria 1982
424 Ga0373949_0002205 3300035090 Bacteria 5098
425 Ga0373951_0001108 3300035091 Bacteria 7160
426 Ga0373952_0005537 3300035092 Bacteria 2311
427 Ga0373923_0003873 3300035111 Bacteria 4877
428 Ga0373923_0009787 3300035111 Bacteria 3467
429 Ga0373932_0001743 3300035112 Bacteria 5906
430 Ga0373936_0000458 3300035113 Bacteria 13726
431 Ga0373936_0003274 3300035113 Bacteria 6069
432 Ga0373936_0030845 3300035113 Bacteria 2115
433 Ga0373939_0004697 3300035114 Bacteria 3238
434 Ga0373941_0000235 3300035115 Bacteria 10656
435 Ga0373941_0001296 3300035115 Bacteria 5265
436 Ga0373941_0007755 3300035115 Bacteria 2639
437 Ga0373945_0036035 3300035116 Bacteria 1771
438 Ga0373945_0061497 3300035116 Bacteria 1402
439 Ga0373953_0000434 3300035117 Bacteria 11439
440 Ga0373954_0006934 3300035118 Bacteria 4945
441 Ga0373954_0031342 3300035118 Bacteria 2454
442 Ga0373956_0005231 3300035119 Bacteria 5197
443 Ga0373957_0031602 3300035120 Bacteria 1946
444 Ga0373957_0087160 3300035120 Bacteria 1237
445 Ga0373960_0001471 3300035121 Bacteria 5219
446 Ga0373960_0016391 3300035121 Bacteria 1905
447 Ga0373943_0009521 3300035170 Bacteria 4354
448 Ga0373943_0016632 3300035170 Bacteria 3356
449 Ga0373943_0115201 3300035170 Bacteria 1422
450 Ga0373943_0280982 3300035170 Bacteria 941
451 Ga0373946_0005518 3300035171 Bacteria 4563
452 Ga0373946_0007236 3300035171 Bacteria 4050
453 Ga0373946_0014747 3300035171 Bacteria 2952
454 Ga0373955_0006525 3300035172 Bacteria 5320
455 Ga0373955_0007396 3300035172 Bacteria 5048
456 Ga0373942_0011444 3300035207 Bacteria 2104
457 Ga0373961_0000465 3300035241 Bacteria 16011
458 Ga0373961_0004288 3300035241 Bacteria 3452
459 Ga0373961_0059474 3300035241 Bacteria 1155
460 Ga0373962_0000735 3300035242 Bacteria 7414
461 Ga0373962_0009420 3300035242 Bacteria 2420
462 Ga0373924_0000181 3300035410 Bacteria 18683
463 Ga0373924_0004865 3300035410 Bacteria 4719
464 Ga0373931_0000398 3300035691 Bacteria 17831
465 Ga0373931_0042107 3300035691 Bacteria 2400
466 Ga0373931_0063424 3300035691 Bacteria 1997
467 Ga0373935_0000332 3300035692 Bacteria 23823
468 Ga0373927_0004623 3300035695 Bacteria 9597
469 Ga0373927_0019391 3300035695 Bacteria 4460
470 Ga0373927_0022495 3300035695 Bacteria 4129
471 Ga0373933_0001128 3300035724 Bacteria 15860
472 Ga0373933_0007464 3300035724 Bacteria 5968
473 Ga0373933_0033137 3300035724 Bacteria 3003
474 Ga0373947_0000414 3300035725 Bacteria 24229
475 Ga0373947_0001411 3300035725 Bacteria 14804
476 Ga0373947_0035619 3300035725 Bacteria 2947
477 Ga0373937_0000256 3300036401 Bacteria 51768
478 Ga0373937_0021412 3300036401 Bacteria 5804
479 Ga0373925_0000087 3300037068 Bacteria 99043
480 Ga0373925_0048049 3300037068 Bacteria 3178
481 Ga0395900_0052170 3300037418 Bacteria 4210
482 Ga0395898_0005267 3300037466 Bacteria 13987
483 Ga0395898_0333468 3300037466 Bacteria 1446
484 Ga0395905_0494342 3300037471 Bacteria 1123
485 Ga0436364_0376058 3300037853 Bacteria 1456
486 Ga0395901_0025919 3300038443 Bacteria 6020
487 Ga0395901_0051386 3300038443 Bacteria 4286
488 Ga0395901_0093925 3300038443 Bacteria 3141
489 Ga0436365_0168259 3300039437 Bacteria 6780
490 Ga0436365_1032543 3300039437 Bacteria 1329
491 Ga0436361_0493839 3300039447 Bacteria 12715
492 Ga0439453_0006336 3300041408 Bacteria 1839
493 Ga0439448_0025287 3300042005 Bacteria 1862
494 Ga0439450_028226 3300042008 Bacteria 1247
495 Ga0439455_0003554 3300042012 Bacteria 2995
496 Ga0439463_048146 3300042016 Bacteria 1086
497 Ga0451577_0037092 3300042876 Bacteria 4389
498 Ga0466963_0000255 3300044694 Bacteria 23380
499 Ga0466963_0125865 3300044694 Bacteria 1767
500 Ga0466971_0058777 3300044719 Bacteria 1736
501 Ga0466971_0064934 3300044719 Bacteria 1652
502 Ga0466957_0003978 3300044842 Bacteria 8171
503 Ga0466958_0084321 3300045836 Bacteria 1959
504 Ga0466967_0026440 3300045976 Bacteria 4807
505 Ga0466967_0799341 3300045976 Bacteria 936
506 Ga0495617_018692 3300046452 Bacteria 2344
507 Ga0495592_0000001 3300046454 Bacteria 305819
508 Ga0495592_0064320 3300046454 Bacteria 2688
509 Ga0495592_0112911 3300046454 Bacteria 1920
510 Ga0495603_0000816 3300046455 Bacteria 17875
511 Ga0495603_0073531 3300046455 Bacteria 2008
512 Ga0495629_0000140 3300046459 Bacteria 63496
513 Ga0495629_0010438 3300046459 Bacteria 6756
514 Ga0495651_0000078 3300046462 Bacteria 71749
515 Ga0495651_0005725 3300046462 Bacteria 9471
516 Ga0495653_0000015 3300046463 Bacteria 213697
517 Ga0495653_0001195 3300046463 Bacteria 20126
518 Ga0495580_0017077 3300046472 Bacteria 5435
519 Ga0495639_0002630 3300046475 Bacteria 7822
520 Ga0495639_0214425 3300046475 Bacteria 945
521 Ga0495662_0000522 3300046476 Bacteria 17560
522 Ga0495662_0085402 3300046476 Bacteria 1537
523 Ga0495664_0000001 3300046477 Bacteria 757730
524 Ga0495664_0009802 3300046477 Bacteria 5370
525 Ga0495584_0035132 3300046491 Bacteria 2534
526 Ga0495584_0062275 3300046491 Bacteria 1875
527 Ga0495584_0136719 3300046491 Bacteria 1244
528 Ga0495585_0002257 3300046492 Bacteria 13934
529 Ga0495607_0063641 3300046501 Bacteria 2086
530 Ga0495608_0000066 3300046511 Bacteria 81664
531 Ga0495608_0018106 3300046511 Bacteria 4864
532 Ga0495618_0000021 3300046514 Bacteria 129750
533 Ga0495618_0026750 3300046514 Bacteria 3588
534 Ga0495628_0000005 3300046516 Bacteria 420969
535 Ga0495630_0000254 3300046517 Bacteria 43049
536 Ga0495630_0044578 3300046517 Bacteria 3314
537 Ga0495630_0053123 3300046517 Bacteria 3033
538 Ga0495637_0060385 3300046520 Bacteria 1557
539 Ga0495663_0013685 3300046525 Bacteria 2269
540 Ga0495652_0000001 3300046529 Bacteria 1045081
541 Ga0495652_0021598 3300046529 Bacteria 5720
542 Ga0495652_0098567 3300046529 Bacteria 2375
543 Ga0495665_0013635 3300046531 Bacteria 4393
544 Ga0495665_0093956 3300046531 Bacteria 1575
545 Ga0495665_0217787 3300046531 Bacteria 987
546 Ga0495640_0000006 3300046533 Bacteria 285419
547 Ga0495640_0010546 3300046533 Bacteria 7131
548 Ga0495586_0021471 3300046535 Bacteria 3442
549 Ga0495587_0000012 3300046536 Bacteria 197088
550 Ga0495645_0000041 3300046543 Bacteria 92278
551 Ga0495645_0117648 3300046543 Bacteria 1874
552 Ga0495622_0006473 3300046557 Bacteria 5432
553 Ga0495622_0126949 3300046557 Bacteria 1163
554 Ga0495633_0128891 3300046558 Bacteria 1170
555 Ga0495667_0000001 3300046559 Bacteria 834831
556 Ga0495667_0027192 3300046559 Bacteria 3856
557 Ga0495656_0002411 3300046615 Bacteria 6200
558 Ga0495634_0001073 3300046642 Bacteria 25523
559 Ga0495634_0010311 3300046642 Bacteria 6848
560 Ga0495634_0087639 3300046642 Bacteria 2026
561 Ga0495611_0001798 3300046648 Bacteria 10289
562 Ga0495635_0000007 3300046663 Bacteria 278786
563 Ga0495635_0027867 3300046663 Bacteria 3928
564 Ga0495659_0015536 3300046664 Bacteria 2504
565 Ga0495661_0055503 3300046665 Bacteria 2374
566 Ga0495657_0000047 3300046675 Bacteria 104362
567 Ga0495599_0000002 3300046678 Bacteria 348168
568 Ga0495599_0085279 3300046678 Bacteria 1972
569 Ga0495623_0000023 3300046679 Bacteria 96650
570 Ga0495623_0135747 3300046679 Bacteria 1468
571 Ga0495646_0000024 3300046680 Bacteria 107836
572 Ga0495646_0085815 3300046680 Bacteria 1826
573 Ga0495647_0024678 3300046681 Bacteria 2190
574 Ga0495647_0032805 3300046681 Bacteria 1937
575 Ga0495658_0000602 3300046683 Bacteria 19729
576 Ga0495658_0165875 3300046683 Bacteria 1364
577 Ga0495613_0009103 3300046689 Bacteria 7363
578 Ga0495613_0058975 3300046689 Bacteria 2815
579 Ga0495613_0069645 3300046689 Bacteria 2564
580 Ga0495624_0091065 3300046690 Bacteria 1881
581 Ga0495600_0000013 3300046809 Bacteria 119404
582 Ga0495600_0003864 3300046809 Bacteria 8889
583 Ga0495600_0022090 3300046809 Bacteria 4083
584 Ga0495581_0049093 3300047315 Bacteria 2436
585 Ga0495581_0051060 3300047315 Bacteria 2388
586 Ga0495581_0051638 3300047315 Bacteria 2374
587 Ga0495581_0067994 3300047315 Bacteria 2060
588 Ga0495604_0000007 3300047317 Bacteria 412174
589 Ga0495604_0118361 3300047317 Bacteria 1920
590 Ga0495674_0000001 3300047319 Bacteria 778665
591 Ga0495674_0029383 3300047319 Bacteria 5006
592 Ga0495674_0165306 3300047319 Bacteria 1849
593 Ga0495676_0040351 3300047321 Bacteria 3852
594 Ga0495676_0071724 3300047321 Bacteria 2662
595 Ga0495676_0244698 3300047321 Bacteria 1226
596 Ga0495680_0001670 3300047322 Bacteria 23595
597 Ga0495680_0045981 3300047322 Bacteria 3444
598 Ga0495680_0054664 3300047322 Bacteria 3099
599 Ga0495675_0000014 3300047444 Bacteria 137646
600 Ga0495675_0050645 3300047444 Bacteria 2639
601 Ga0495677_0115177 3300047445 Bacteria 1023
602 Ga0495684_0000027 3300047471 Bacteria 124367
603 Ga0495684_0003742 3300047471 Bacteria 11861
604 Ga0495684_0037841 3300047471 Bacteria 3701
605 Ga0495684_0232585 3300047471 Bacteria 1347
606 Ga0495593_0000253 3300047673 Bacteria 28885
607 Ga0495593_0027098 3300047673 Bacteria 3157
608 Ga0495602_0000004 3300048088 Bacteria 326932
609 Ga0495602_0091194 3300048088 Bacteria 2528
610 Ga0495614_0024493 3300048089 Bacteria 2605
611 Ga0496100_0001438 3300048903 Bacteria 11653
612 Ga0496100_0022753 3300048903 Bacteria 3797
613 Ga0496100_0025104 3300048903 Bacteria 3641
614 Ga0496100_0037961 3300048903 Bacteria 3049
615 Ga0496101_0001028 3300048904 Bacteria 16457
616 Ga0496101_0048823 3300048904 Bacteria 3042
617 Ga0496102_0002331 3300048905 Bacteria 16208
618 Ga0496102_0024720 3300048905 Bacteria 5342
619 Ga0496103_0008234 3300048906 Bacteria 6188
620 Ga0496103_0012139 3300048906 Bacteria 5117
621 Ga0496103_0023961 3300048906 Bacteria 3682
622 Ga0496104_0082845 3300048907 Bacteria 3059
623 Ga0496104_0101294 3300048907 Bacteria 2757
624 Ga0496105_0001448 3300048908 Bacteria 16699
625 Ga0496105_0010412 3300048908 Bacteria 7315
626 Ga0496105_0117203 3300048908 Bacteria 2196
627 Ga0496105_0125964 3300048908 Bacteria 2111
628 Ga0496106_0006122 3300048909 Bacteria 8899
629 Ga0496106_0049085 3300048909 Bacteria 3179
630 Ga0496106_0164915 3300048909 Bacteria 1753
631 Ga0496106_0198288 3300048909 Bacteria 1597
632 Ga0496107_0000338 3300048910 Bacteria 25395
633 Ga0496107_0013441 3300048910 Bacteria 5721
634 Ga0496107_0022527 3300048910 Bacteria 4452
635 Ga0496107_0155608 3300048910 Bacteria 1692
636 Ga0496108_0007499 3300048911 Bacteria 8844
637 Ga0496108_0030031 3300048911 Bacteria 4505
638 Ga0496108_0040592 3300048911 Bacteria 3881
639 Ga0496108_0051504 3300048911 Bacteria 3449
640 Ga0496108_0078759 3300048911 Bacteria 2790
641 Ga0496108_0501088 3300048911 Bacteria 1060
642 Ga0496109_0012676 3300048912 Bacteria 7285
643 Ga0496109_0013537 3300048912 Bacteria 7081
644 Ga0496109_0015251 3300048912 Bacteria 6690
645 Ga0496109_0367280 3300048912 Unclassified 1359
646 Ga0496110_0067643 3300048913 Bacteria 3161
647 Ga0496110_0179869 3300048913 Bacteria 1920
648 Ga0496110_0538510 3300048913 Bacteria 1061
649 Ga0496111_0090277 3300048914 Bacteria 2245
650 Ga0496111_0272115 3300048914 Bacteria 1256
651 Ga0496112_0009699 3300048915 Bacteria 8691
652 Ga0496112_0201864 3300048915 Bacteria 1947
653 Ga0496112_0238200 3300048915 Bacteria 1773
654 Ga0496112_0599583 3300048915 Bacteria 1033
655 Ga0496113_0002225 3300048916 Bacteria 11196
656 Ga0496113_0022009 3300048916 Bacteria 4503
657 Ga0496113_0034579 3300048916 Bacteria 3688
658 Ga0496113_0066585 3300048916 Bacteria 2728
659 Ga0496113_0198052 3300048916 Bacteria 1596
660 Ga0496114_0002900 3300048917 Bacteria 13140
661 Ga0496114_0031113 3300048917 Bacteria 4390
662 Ga0496114_0052118 3300048917 Bacteria 3408
663 Ga0496114_0142494 3300048917 Bacteria 2076
664 Ga0496115_0002388 3300048918 Bacteria 13461
665 Ga0496115_0012838 3300048918 Bacteria 6316
666 Ga0496115_0016818 3300048918 Bacteria 5576
667 Ga0496115_0093287 3300048918 Bacteria 2461
668 Ga0501032_0020708 3300049569 Bacteria 4578
669 Ga0501032_0021514 3300049569 Bacteria 4482
670 Ga0501033_0043473 3300049570 Bacteria 3346
671 Ga0501033_0075931 3300049570 Bacteria 2466
672 Ga0501034_0000439 3300049571 Bacteria 68932
673 Ga0501034_0000810 3300049571 Bacteria 46526
674 Ga0501034_0014998 3300049571 Bacteria 7971
675 Ga0501034_0029054 3300049571 Bacteria 5621
676 Ga0501034_0084171 3300049571 Bacteria 3182
677 Ga0501034_0084856 3300049571 Bacteria 3168
678 Ga0501034_0085960 3300049571 Bacteria 3146
679 Ga0501034_0162196 3300049571 Bacteria 2206
680 Ga0501034_0321792 3300049571 Bacteria 1479
681 Ga0501036_0005548 3300049572 Bacteria 10230
682 Ga0501036_0057010 3300049572 Bacteria 3309
683 Ga0501036_0214100 3300049572 Bacteria 1618
684 Ga0501036_0248059 3300049572 Bacteria 1492
685 Ga0501037_0004371 3300049573 Bacteria 10260
686 Ga0501037_0008008 3300049573 Bacteria 7742
687 Ga0501037_0043089 3300049573 Bacteria 3316
688 Ga0501037_0055560 3300049573 Bacteria 2894
689 Ga0501038_0068526 3300049574 Bacteria 3015
690 Ga0501038_0144624 3300049574 Bacteria 1942
691 Ga0501038_0156468 3300049574 Bacteria 1855
692 Ga0501038_0226321 3300049574 Bacteria 1490
693 Ga0501039_0025664 3300049575 Bacteria 4529
694 Ga0501039_0083513 3300049575 Bacteria 2487
695 Ga0501043_0010261 3300049579 Bacteria 7339
696 Ga0501043_0028689 3300049579 Bacteria 4368
697 Ga0501043_0076117 3300049579 Bacteria 2636
698 Ga0501043_0212660 3300049579 Bacteria 1498
699 Ga0501043_0245281 3300049579 Bacteria 1381
700 Ga0501046_0144407 3300049580 Bacteria 1798
701 Ga0501046_0173526 3300049580 Bacteria 1616
702 Ga0501047_0000073 3300049581 Bacteria 125990
703 Ga0501047_0030765 3300049581 Bacteria 5174
704 Ga0501047_0169779 3300049581 Bacteria 2050
705 Ga0501047_0301254 3300049581 Bacteria 1445
706 Ga0501048_0000391 3300049582 Bacteria 30448
707 Ga0501048_0107868 3300049582 Bacteria 1966
708 Ga0501048_0166733 3300049582 Bacteria 1560
709 Ga0501067_0018876 3300049583 Bacteria 3815
710 Ga0501067_0026794 3300049583 Bacteria 3192
711 Ga0501067_0062154 3300049583 Bacteria 2067
712 Ga0501068_0028094 3300049584 Bacteria 3324
713 Ga0501069_0074898 3300049585 Bacteria 1900
714 Ga0501069_0080778 3300049585 Bacteria 1831
715 Ga0501070_0036364 3300049586 Bacteria 4112
716 Ga0501070_0070884 3300049586 Bacteria 2885
717 Ga0501070_0099219 3300049586 Bacteria 2409
718 Ga0501070_0107418 3300049586 Bacteria 2306
719 Ga0501070_0121305 3300049586 Bacteria 2160
720 Ga0501070_0193618 3300049586 Bacteria 1670
721 Ga0501070_0236972 3300049586 Bacteria 1494
722 Ga0501071_0187505 3300049587 Bacteria 1550
723 Ga0501072_0007381 3300049588 Bacteria 8340
724 Ga0501072_0028692 3300049588 Bacteria 4344
725 Ga0501072_0365318 3300049588 Bacteria 1145
726 Ga0501073_0010362 3300049589 Bacteria 6838
727 Ga0501073_0041506 3300049589 Bacteria 3251
728 Ga0501073_0047948 3300049589 Bacteria 3000
729 Ga0501073_0078028 3300049589 Bacteria 2304
730 Ga0501073_0133542 3300049589 Bacteria 1720
731 Ga0501073_0256425 3300049589 Bacteria 1207
732 Ga0501074_0037466 3300049590 Bacteria 3515
733 Ga0501074_0074614 3300049590 Bacteria 2435
734 Ga0501074_0100751 3300049590 Bacteria 2067
735 Ga0501079_0036026 3300049741 Bacteria 3810
736 Ga0501080_0006835 3300049742 Bacteria 10289
737 Ga0501080_0029315 3300049742 Bacteria 5122
738 Ga0501080_0090041 3300049742 Bacteria 2850
739 Ga0501080_0131989 3300049742 Bacteria 2312
740 Ga0501080_0160220 3300049742 Bacteria 2078
741 Ga0501080_0218525 3300049742 Bacteria 1744
742 Ga0501083_0000139 3300049744 Bacteria 49384
743 Ga0501083_0055944 3300049744 Bacteria 2644
744 Ga0501083_0110965 3300049744 Bacteria 1803
745 Ga0501083_0132895 3300049744 Bacteria 1631
746 Ga0501035_0001020 3300049822 Bacteria 29508
747 Ga0501035_0092572 3300049822 Bacteria 2660
748 Ga0501035_0096114 3300049822 Bacteria 2603
749 Ga0501035_0111324 3300049822 Bacteria 2399
750 Ga0501035_0412901 3300049822 Bacteria 1121
751 Ga0501044_0005518 3300049823 Bacteria 14043
752 Ga0501044_0037733 3300049823 Bacteria 5049
753 Ga0501044_0267967 3300049823 Bacteria 1644
754 Ga0501045_0077542 3300049824 Bacteria 2449
755 Ga0501045_0078420 3300049824 Bacteria 2435
756 nmdc:mga05p37_129606_c1 3300050507 Bacteria 3095
757 nmdc:mga05p37_15207_c1 3300050507 Bacteria 9243
758 nmdc:mga05p37_18481_c1 3300050507 Bacteria 8421
759 nmdc:mga05p37_235544_c1 3300050507 Bacteria 2204
760 nmdc:mga05p37_53778_c1 3300050507 Bacteria 4952
761 nmdc:mga05p37_79680_c1 3300050507 Bacteria 4033
762 nmdc:mga09592_355495_c1 3300050508 Bacteria 1268
763 nmdc:mga09592_48564_c1 3300050508 Bacteria 3578
764 nmdc:mga09592_5221_c1 3300050508 Bacteria 10552
765 nmdc:mga0qj67_33781_c1 3300050509 Bacteria 3993
766 nmdc:mga0qj67_347350_c1 3300050509 Bacteria 1200
767 nmdc:mga0qj67_5138_c1 3300050509 Bacteria 9536
768 nmdc:mga06r32_163736_c1 3300050510 Bacteria 2207
769 nmdc:mga06r32_1670_c1 3300050510 Bacteria 20024
770 nmdc:mga06r32_85486_c1 3300050510 Bacteria 3076
771 nmdc:mga08y16_15015_c1 3300050511 Bacteria 8147
772 nmdc:mga08y16_20578_c1 3300050511 Bacteria 6965
773 nmdc:mga08y16_643734_c1 3300050511 Bacteria 1065
774 nmdc:mga08y16_6877_c1 3300050511 Bacteria 11928
775 nmdc:mga0n895_107079_c1 3300050512 Bacteria 2809
776 nmdc:mga0n895_1271_c1 3300050512 Bacteria 18631
777 nmdc:mga0n895_12797_c1 3300050512 Bacteria 7536
778 nmdc:mga0n895_148321_c1 3300050512 Bacteria 2375
779 nmdc:mga0n895_29981_c1 3300050512 Bacteria 5194
780 nmdc:mga0n895_482666_c1 3300050512 Bacteria 1250
781 nmdc:mga0n895_515895_c1 3300050512 Unclassified 1203
782 nmdc:mga0n895_92515_c1 3300050512 Bacteria 3027
783 nmdc:mga0n895_9812_c1 3300050512 Bacteria 8413
784 nmdc:mga0rr50_39133_c1 3300050513 Bacteria 3438
785 nmdc:mga0rr50_5080_c1 3300050513 Bacteria 7805
786 nmdc:mga0rr50_70636_c1 3300050513 Bacteria 2661
787 nmdc:mga08x19_197067_c1 3300050514 Bacteria 1379
788 nmdc:mga08x19_81078_c1 3300050514 Bacteria 2130
789 nmdc:mga0a205_16609_c1 3300050515 Bacteria 6894
790 nmdc:mga0a205_419881_c1 3300050515 Bacteria 1200
791 Ga0495601_0000006 3300053077 Bacteria 373770
792 Ga0495601_0031224 3300053077 Bacteria 3310
793 Ga0495601_0048428 3300053077 Bacteria 2676
794 Ga0495601_0054932 3300053077 Bacteria 2520
795 Ga0495612_0000004 3300053078 Bacteria 286946
796 Ga0495612_0005181 3300053078 Bacteria 5386
797 Ga0495612_0038945 3300053078 Bacteria 1932
798 Ga0495595_0000006 3300053084 Bacteria 231295
799 Ga0495595_0002169 3300053084 Bacteria 7628
800 Ga0495619_0000011 3300053085 Bacteria 287128
801 Ga0495619_0000384 3300053085 Bacteria 30338
802 Ga0495619_0012696 3300053085 Bacteria 5302
803 Ga0500566_0142359 3300053094 Bacteria 1271
804 Ga0500652_000006 3300053131 Bacteria 167437
805 Ga0500616_0037070 3300053153 Bacteria 2641
806 Ga0500616_0040910 3300053153 Bacteria 2490
807 Ga0501084_0143159 3300054114 Bacteria 2013
808 Ga0501084_0301680 3300054114 Bacteria 1353
809 Ga0501084_0394778 3300054114 Bacteria 1169
810 Ga0501082_0041891 3300060353 Bacteria 3948
811 Ga0501082_0050070 3300060353 Bacteria 3602
812 Ga0501082_0350369 3300060353 Bacteria 1287
813 Ga0466962_0097220 3300061719 Bacteria 1412
814 Ga0530510_0225736 3300061734 Bacteria 1393
815 Ga0501074_0013395
816 2214884090
817 ARSoilYngRDRAFT_c00124
818 ARcpr5yngRDRAFT_c000127
819 ARSoilOldRDRAFT_c000125
820 ARCol0yngRDRAFT_1000457
821 JGI24032J14994_100889
822 JGI24746J21847_1003010
823 JGI24739J22299_10000496
824 JGI24739J22299_10025357
825 JGI24737J22298_10000886
826 JGI24750J21931_1001502
827 JGI24745J21846_1002381
828 JGI24738J21930_10009478
829 JGI24749J21850_1001896
830 JGI24035J26624_1006618
831 JGI24034J26672_10009416
832 JGI24742J22300_10000526
833 JGI25404J52841_10002280
834 JGI25405J52794_10003226
835 Ga0065717_1002697
836 Ga0065716_1001902
837 Ga0065704_10146850
838 Ga0065712_10088653
839 Ga0065715_10095851
840 Ga0065715_10103296
841 Ga0070658_10004719
842 Ga0070676_10003793
843 Ga0070683_100000419
844 Ga0070683_100080648
845 Ga0070683_100112482
846 Ga0070683_100306447
847 Ga0070690_100040215
848 Ga0070690_100176812
849 Ga0070670_100004223
850 Ga0070670_100151986
851 Ga0070677_10000623
852 Ga0068869_100001088
853 Ga0070666_10005030
854 Ga0070680_100003470
855 Ga0070680_100013953
856 Ga0070680_100200094
857 Ga0070680_100350779
858 Ga0070682_100003573
859 Ga0068868_100004854
860 Ga0070660_100001074
861 Ga0070660_100001863
862 Ga0070660_100215838
863 Ga0070689_100010277
864 Ga0070689_100049301
865 Ga0070689_100108844
866 Ga0070689_100372045
867 Ga0070691_10101810
868 Ga0070687_100001557
869 Ga0070661_100000894
870 Ga0070668_100063434
871 Ga0070668_100273659
872 Ga0070669_100003330
873 Ga0070669_100234799
874 Ga0070675_100006928
875 Ga0070671_100226112
876 Ga0070674_100001693
877 Ga0070673_100001300
878 Ga0070688_100000384
879 Ga0070688_100056498
880 Ga0070659_100003102
881 Ga0070659_100046844
882 Ga0070667_100011097
883 Ga0070667_100069921
884 Ga0070667_100188414
885 Ga0070703_10038998
886 Ga0070709_10013109
887 Ga0070709_10020886
888 Ga0070714_100046839
889 Ga0070714_100252961
890 Ga0070714_100548327
891 Ga0070713_100003935
892 Ga0070713_100006430
893 Ga0070710_10006745
894 Ga0070701_10000053
895 Ga0070711_100044157
896 Ga0070711_100074528
897 Ga0070711_100188635
898 Ga0070705_100025013
899 Ga0070700_100000995
900 Ga0070694_100004798
901 Ga0070694_100500789
902 Ga0070708_100142584
903 Ga0070708_100335278
904 Ga0070663_100005062
905 Ga0070663_100083500
906 Ga0070663_100190608
907 Ga0070663_100218673
908 Ga0070678_100011901
909 Ga0070678_100089594
910 Ga0070662_100001392
911 Ga0070662_100167618
912 Ga0070681_10010566
913 Ga0070681_10157101
914 Ga0068867_100007589
915 Ga0068867_100088580
916 Ga0070685_10001493
917 Ga0070706_100004167
918 Ga0070707_100449188
919 Ga0070698_100339980
920 Ga0070699_100000829
921 Ga0070679_100021813
922 Ga0070679_100062401
923 Ga0070679_100236204
924 Ga0070679_100642765
925 Ga0070684_100001048
926 Ga0070684_100294099
927 Ga0068853_100000976
928 Ga0070672_100000458
929 Ga0070686_100001811
930 Ga0070695_100000550
931 Ga0070696_100055945
932 Ga0070696_100115324
933 Ga0070696_100159818
934 Ga0070696_100198223
935 Ga0070693_100040580
936 Ga0070665_100077915
937 Ga0070665_100202705
938 Ga0070704_100007431
939 Ga0070704_100099683
940 Ga0070704_100522181
941 Ga0068855_100005184
942 Ga0068855_100015368
943 Ga0068855_100581964
944 Ga0070664_100001280
945 Ga0070664_100032243
946 Ga0070664_100128279
947 Ga0070664_100581263
948 Ga0068857_100000630
949 Ga0068854_100000802
950 Ga0068856_100001005
951 Ga0068856_100130400
952 Ga0070702_100004228
953 Ga0068852_100060331
954 Ga0068852_100129000
955 Ga0068852_100195391
956 Ga0068859_100251889
957 Ga0068864_100000140
958 Ga0068864_100204338
959 Ga0068861_100001121
960 Ga0068863_100000425
961 Ga0068863_100133417
962 Ga0068863_100190754
963 Ga0068863_100484232
964 Ga0068858_100004894
965 Ga0068858_100043093
966 Ga0068858_100065262
967 Ga0068858_100145563
968 Ga0068860_100002221
969 Ga0068860_100832392
970 Ga0068862_100001418
971 Ga0081455_10000091
972 Ga0081455_10006350
973 Ga0081455_10007779
974 Ga0081455_10057711
975 Ga0081540_1000068
976 Ga0081540_1011418
977 Ga0081540_1050880
978 Ga0070717_10003725
979 Ga0070717_10041544
980 Ga0075365_10144773
981 Ga0070715_10002493
982 Ga0070716_100010029
983 Ga0070712_100100082
984 Ga0075369_10006378
985 Ga0075427_10001272
986 Ga0097621_100001542
987 Ga0097621_100006138
988 Ga0097621_100055513
989 Ga0097621_100207309
990 Ga0068871_100000938
991 Ga0068871_100057854
992 Ga0068871_100069536
993 Ga0075428_100144863
994 Ga0075430_100017069
995 Ga0075430_100018342
996 Ga0075430_100132135
997 Ga0075431_100014631
998 Ga0075431_100024210
999 Ga0075431_100121078
1000 Ga0075431_100216345
1001 Ga0075431_100235803
1002 Ga0075433_10110347
1003 Ga0075433_10181970
1004 Ga0075434_100008958
1005 Ga0075434_100016992
1006 Ga0075434_100082865
1007 Ga0075434_100178784
1008 Ga0075434_100253886
1009 Ga0075434_100402587
1010 Ga0068865_100002772
1011 Ga0075436_100021379
1012 Ga0097620_100251864
1013 Ga0075435_100011643
1014 Ga0075435_100049443
1015 Ga0075435_100141600
1016 Ga0075435_100157945
1017 Ga0099794_10010006
1018 Ga0105244_10079447
1019 Ga0105240_10410677
1020 Ga0111539_10013242
1021 Ga0111539_10068122
1022 Ga0111539_10132394
1023 Ga0111539_10148458
1024 Ga0111539_10938521
1025 Ga0105245_10004587
1026 Ga0105245_10007019
1027 Ga0105245_10014701
1028 Ga0105247_10007542
1029 Ga0105247_10013219
1030 Ga0114129_10018126
1031 Ga0114129_10045452
1032 Ga0114129_10111386
1033 Ga0114129_10199475
1034 Ga0105243_10014317
1035 Ga0105242_10002741
1036 Ga0105242_10065486
1037 Ga0105242_10374314
1038 Ga0105248_10008864
1039 Ga0105248_10047096
1040 Ga0105248_10053904
1041 Ga0105248_10113465
1042 Ga0105237_10103613
1043 Ga0105237_10128242
1044 Ga0105238_10124446
1045 Ga0105238_10126675
1046 Ga0105249_10014469
1047 Ga0099796_10001585
1048 Ga0105239_10193263
1049 Ga0105246_10000599
1050 Ga0157336_1000226
1051 Ga0157371_10027149
1052 Ga0157371_10181661
1053 Ga0157370_10365303
1054 Ga0157369_10364446
1055 Ga0157374_10090125
1056 Ga0157374_10277257
1057 Ga0157378_10268385
1058 Ga0163162_10022422
1059 Ga0163162_10029973
1060 Ga0163162_10241226
1061 Ga0163162_10349766
1062 Ga0163162_10605011
1063 Ga0157372_10081649
1064 Ga0157375_10001131
1065 Ga0157375_10002488
1066 Ga0163163_10019116
1067 Ga0163163_10022743
1068 Ga0163163_10158680
1069 Ga0157380_10000894
1070 Ga0157380_10217025
1071 Ga0157377_10000696
1072 Ga0157377_10090537
1073 Ga0157379_10005316
1074 Ga0157379_10062283
1075 Ga0157376_10008132
1076 Ga0157376_10224250
1077 Ga0157376_10225265
1078 Ga0163161_10010626
1079 Ga0213876_10038132
1080 Ga0207666_1000052
1081 Ga0207697_10000169
1082 Ga0207655_1076877
1083 Ga0207653_10001090
1084 Ga0207682_10000859
1085 Ga0207692_10035165
1086 Ga0207692_10081781
1087 Ga0207642_10001773
1088 Ga0207688_10000024
1089 Ga0207680_10002348
1090 Ga0207699_10001996
1091 Ga0207699_10171286
1092 Ga0207699_10236634
1093 Ga0207645_10000538
1094 Ga0207643_10000035
1095 Ga0207684_10003395
1096 Ga0207707_10032345
1097 Ga0207707_10072923
1098 Ga0207707_10091109
1099 Ga0207695_10068916
1100 Ga0207671_10007789
1101 Ga0207671_10078469
1102 Ga0207671_10107971
1103 Ga0207693_10003819
1104 Ga0207693_10014157
1105 Ga0207693_10038334
1106 Ga0207663_10007219
1107 Ga0207663_10018925
1108 Ga0207663_10033317
1109 Ga0207663_10235025
1110 Ga0207663_10467073
1111 Ga0207660_10002466
1112 Ga0207660_10009921
1113 Ga0207662_10001196
1114 Ga0207662_10028942
1115 Ga0207657_10003229
1116 Ga0207657_10005139
1117 Ga0207657_10031263
1118 Ga0207649_10000412
1119 Ga0207649_10081125
1120 Ga0207652_10021544
1121 Ga0207652_10207941
1122 Ga0207646_10371971
1123 Ga0207681_10000553
1124 Ga0207681_10490773
1125 Ga0207694_10009714
1126 Ga0207694_10090437
1127 Ga0207694_10526840
1128 Ga0207650_10005710
1129 Ga0207659_10000091
1130 Ga0207687_10000161
1131 Ga0207687_10010301
1132 Ga0207700_10005167
1133 Ga0207700_10052187
1134 Ga0207700_10264082
1135 Ga0207700_10475458
1136 Ga0207664_10067292
1137 Ga0207664_10465830
1138 Ga0207644_10002790
1139 Ga0207644_10011541
1140 Ga0207690_10002912
1141 Ga0207690_10024199
1142 Ga0207690_10125811
1143 Ga0207706_10027574
1144 Ga0207706_10068037
1145 Ga0207686_10001075
1146 Ga0207686_10008756
1147 Ga0207686_10122799
1148 Ga0207709_10000575
1149 Ga0207670_10000182
1150 Ga0207669_10000082
1151 Ga0207704_10000604
1152 Ga0207704_10120109
1153 Ga0207665_10004294
1154 Ga0207665_10006035
1155 Ga0207665_10336138
1156 Ga0207691_10000336
1157 Ga0207691_10127418
1158 Ga0207711_10012924
1159 Ga0207711_10015124
1160 Ga0207711_10281434
1161 Ga0207689_10002022
1162 Ga0207661_10001715
1163 Ga0207661_10059660
1164 Ga0207679_10000035
1165 Ga0207679_10034926
1166 Ga0207679_10125845
1167 Ga0207679_10536679
1168 Ga0207667_10008094
1169 Ga0207667_10025683
1170 Ga0207667_10099832
1171 Ga0207667_10515412
1172 Ga0207651_10002513
1173 Ga0207712_10000429
1174 Ga0207712_10073978
1175 Ga0207668_10000149
1176 Ga0207668_10500743
1177 Ga0207640_10008008
1178 Ga0207640_10035961
1179 Ga0207658_10003056
1180 Ga0207658_10056414
1181 Ga0207658_10105228
1182 Ga0207658_10130044
1183 Ga0207677_10003478
1184 Ga0207703_10004085
1185 Ga0207703_10236497
1186 Ga0207703_10391373
1187 Ga0207639_10002878
1188 Ga0207678_10001400
1189 Ga0207678_10012249
1190 Ga0207678_10099921
1191 Ga0207708_10000896
1192 Ga0207702_10002760
1193 Ga0207641_10008796
1194 Ga0207641_10050146
1195 Ga0207641_10088031
1196 Ga0207648_10008471
1197 Ga0207648_10056972
1198 Ga0207648_10261405
1199 Ga0207676_10000979
1200 Ga0207676_10159117
1201 Ga0207674_10006130
1202 Ga0207674_10151601
1203 Ga0207675_100001667
1204 Ga0207675_100118496
1205 Ga0207675_100533160
1206 Ga0207683_10000457
1207 Ga0207683_10006130
1208 Ga0207683_10013806
1209 Ga0207698_10149178
1210 Ga0209984_1004399
1211 Ga0209179_1022594
1212 Ga0209588_1014590
1213 Ga0209971_1004021
1214 Ga0209966_1000836
1215 Ga0209974_10003856
1216 Ga0207428_10000075
1217 Ga0207428_10001163
1218 Ga0207428_10002495
1219 Ga0268266_10116185
1220 Ga0268266_10240167
1221 Ga0268265_10001635
1222 Ga0268264_10000813
1223 Ga0268264_10089113
1224 Ga0265342_10001792
1225 Ga0373930_0009915
1226 Ga0373930_0010916
1227 Ga0373948_0000943
1228 Ga0373959_0008280
1229 Ga0373938_0000151
1230 Ga0373929_0000167
1231 Ga0373929_0006898
1232 Ga0373929_0013103
1233 Ga0373934_0008237
1234 Ga0373940_0013026
1235 Ga0373940_0016673
1236 Ga0373944_0011315
1237 Ga0373944_0018674
1238 Ga0373949_0002205
1239 Ga0373951_0001108
1240 Ga0373952_0005537
1241 Ga0373923_0003873
1242 Ga0373923_0009787
1243 Ga0373932_0001743
1244 Ga0373936_0000458
1245 Ga0373936_0003274
1246 Ga0373936_0030845
1247 Ga0373939_0004697
1248 Ga0373941_0000235
1249 Ga0373941_0001296
1250 Ga0373941_0007755
1251 Ga0373945_0036035
1252 Ga0373945_0061497
1253 Ga0373953_0000434
1254 Ga0373954_0006934
1255 Ga0373954_0031342
1256 Ga0373956_0005231
1257 Ga0373957_0031602
1258 Ga0373957_0087160
1259 Ga0373960_0001471
1260 Ga0373960_0016391
1261 Ga0373943_0009521
1262 Ga0373943_0016632
1263 Ga0373943_0115201
1264 Ga0373943_0280982
1265 Ga0373946_0005518
1266 Ga0373946_0007236
1267 Ga0373946_0014747
1268 Ga0373955_0006525
1269 Ga0373955_0007396
1270 Ga0373942_0011444
1271 Ga0373961_0000465
1272 Ga0373961_0004288
1273 Ga0373961_0059474
1274 Ga0373962_0000735
1275 Ga0373962_0009420
1276 Ga0373924_0000181
1277 Ga0373924_0004865
1278 Ga0373931_0000398
1279 Ga0373931_0042107
1280 Ga0373931_0063424
1281 Ga0373935_0000332
1282 Ga0373927_0004623
1283 Ga0373927_0019391
1284 Ga0373927_0022495
1285 Ga0373933_0001128
1286 Ga0373933_0007464
1287 Ga0373933_0033137
1288 Ga0373947_0000414
1289 Ga0373947_0001411
1290 Ga0373947_0035619
1291 Ga0373937_0000256
1292 Ga0373937_0021412
1293 Ga0373925_0000087
1294 Ga0373925_0048049
1295 Ga0395900_0052170
1296 Ga0395898_0005267
1297 Ga0395898_0333468
1298 Ga0395905_0494342
1299 Ga0436364_0376058
1300 Ga0395901_0025919
1301 Ga0395901_0051386
1302 Ga0395901_0093925
1303 Ga0436365_0168259
1304 Ga0436365_1032543
1305 Ga0436361_0493839
1306 Ga0439453_0006336
1307 Ga0439448_0025287
1308 Ga0439450_028226
1309 Ga0439455_0003554
1310 Ga0439463_048146
1311 Ga0451577_0037092
1312 Ga0466963_0000255
1313 Ga0466963_0125865
1314 Ga0466971_0058777
1315 Ga0466971_0064934
1316 Ga0466957_0003978
1317 Ga0466958_0084321
1318 Ga0466967_0026440
1319 Ga0466967_0799341
1320 Ga0495617_018692
1321 Ga0495592_0000001
1322 Ga0495592_0064320
1323 Ga0495592_0112911
1324 Ga0495603_0000816
1325 Ga0495603_0073531
1326 Ga0495629_0000140
1327 Ga0495629_0010438
1328 Ga0495651_0000078
1329 Ga0495651_0005725
1330 Ga0495653_0000015
1331 Ga0495653_0001195
1332 Ga0495580_0017077
1333 Ga0495639_0002630
1334 Ga0495639_0214425
1335 Ga0495662_0000522
1336 Ga0495662_0085402
1337 Ga0495664_0000001
1338 Ga0495664_0009802
1339 Ga0495584_0035132
1340 Ga0495584_0062275
1341 Ga0495584_0136719
1342 Ga0495585_0002257
1343 Ga0495607_0063641
1344 Ga0495608_0000066
1345 Ga0495608_0018106
1346 Ga0495618_0000021
1347 Ga0495618_0026750
1348 Ga0495628_0000005
1349 Ga0495630_0000254
1350 Ga0495630_0044578
1351 Ga0495630_0053123
1352 Ga0495637_0060385
1353 Ga0495663_0013685
1354 Ga0495652_0000001
1355 Ga0495652_0021598
1356 Ga0495652_0098567
1357 Ga0495665_0013635
1358 Ga0495665_0093956
1359 Ga0495665_0217787
1360 Ga0495640_0000006
1361 Ga0495640_0010546
1362 Ga0495586_0021471
1363 Ga0495587_0000012
1364 Ga0495645_0000041
1365 Ga0495645_0117648
1366 Ga0495622_0006473
1367 Ga0495622_0126949
1368 Ga0495633_0128891
1369 Ga0495667_0000001
1370 Ga0495667_0027192
1371 Ga0495656_0002411
1372 Ga0495634_0001073
1373 Ga0495634_0010311
1374 Ga0495634_0087639
1375 Ga0495611_0001798
1376 Ga0495635_0000007
1377 Ga0495635_0027867
1378 Ga0495659_0015536
1379 Ga0495661_0055503
1380 Ga0495657_0000047
1381 Ga0495599_0000002
1382 Ga0495599_0085279
1383 Ga0495623_0000023
1384 Ga0495623_0135747
1385 Ga0495646_0000024
1386 Ga0495646_0085815
1387 Ga0495647_0024678
1388 Ga0495647_0032805
1389 Ga0495658_0000602
1390 Ga0495658_0165875
1391 Ga0495613_0009103
1392 Ga0495613_0058975
1393 Ga0495613_0069645
1394 Ga0495624_0091065
1395 Ga0495600_0000013
1396 Ga0495600_0003864
1397 Ga0495600_0022090
1398 Ga0495581_0049093
1399 Ga0495581_0051060
1400 Ga0495581_0051638
1401 Ga0495581_0067994
1402 Ga0495604_0000007
1403 Ga0495604_0118361
1404 Ga0495674_0000001
1405 Ga0495674_0029383
1406 Ga0495674_0165306
1407 Ga0495676_0040351
1408 Ga0495676_0071724
1409 Ga0495676_0244698
1410 Ga0495680_0001670
1411 Ga0495680_0045981
1412 Ga0495680_0054664
1413 Ga0495675_0000014
1414 Ga0495675_0050645
1415 Ga0495677_0115177
1416 Ga0495684_0000027
1417 Ga0495684_0003742
1418 Ga0495684_0037841
1419 Ga0495684_0232585
1420 Ga0495593_0000253
1421 Ga0495593_0027098
1422 Ga0495602_0000004
1423 Ga0495602_0091194
1424 Ga0495614_0024493
1425 Ga0496100_0001438
1426 Ga0496100_0022753
1427 Ga0496100_0025104
1428 Ga0496100_0037961
1429 Ga0496101_0001028
1430 Ga0496101_0048823
1431 Ga0496102_0002331
1432 Ga0496102_0024720
1433 Ga0496103_0008234
1434 Ga0496103_0012139
1435 Ga0496103_0023961
1436 Ga0496104_0082845
1437 Ga0496104_0101294
1438 Ga0496105_0001448
1439 Ga0496105_0010412
1440 Ga0496105_0117203
1441 Ga0496105_0125964
1442 Ga0496106_0006122
1443 Ga0496106_0049085
1444 Ga0496106_0164915
1445 Ga0496106_0198288
1446 Ga0496107_0000338
1447 Ga0496107_0013441
1448 Ga0496107_0022527
1449 Ga0496107_0155608
1450 Ga0496108_0007499
1451 Ga0496108_0030031
1452 Ga0496108_0040592
1453 Ga0496108_0051504
1454 Ga0496108_0078759
1455 Ga0496108_0501088
1456 Ga0496109_0012676
1457 Ga0496109_0013537
1458 Ga0496109_0015251
1459 Ga0496109_0367280
1460 Ga0496110_0067643
1461 Ga0496110_0179869
1462 Ga0496110_0538510
1463 Ga0496111_0090277
1464 Ga0496111_0272115
1465 Ga0496112_0009699
1466 Ga0496112_0201864
1467 Ga0496112_0238200
1468 Ga0496112_0599583
1469 Ga0496113_0002225
1470 Ga0496113_0022009
1471 Ga0496113_0034579
1472 Ga0496113_0066585
1473 Ga0496113_0198052
1474 Ga0496114_0002900
1475 Ga0496114_0031113
1476 Ga0496114_0052118
1477 Ga0496114_0142494
1478 Ga0496115_0002388
1479 Ga0496115_0012838
1480 Ga0496115_0016818
1481 Ga0496115_0093287
1482 Ga0501032_0020708
1483 Ga0501032_0021514
1484 Ga0501033_0043473
1485 Ga0501033_0075931
1486 Ga0501034_0000439
1487 Ga0501034_0000810
1488 Ga0501034_0014998
1489 Ga0501034_0029054
1490 Ga0501034_0084171
1491 Ga0501034_0084856
1492 Ga0501034_0085960
1493 Ga0501034_0162196
1494 Ga0501034_0321792
1495 Ga0501036_0005548
1496 Ga0501036_0057010
1497 Ga0501036_0214100
1498 Ga0501036_0248059
1499 Ga0501037_0004371
1500 Ga0501037_0008008
1501 Ga0501037_0043089
1502 Ga0501037_0055560
1503 Ga0501038_0068526
1504 Ga0501038_0144624
1505 Ga0501038_0156468
1506 Ga0501038_0226321
1507 Ga0501039_0025664
1508 Ga0501039_0083513
1509 Ga0501043_0010261
1510 Ga0501043_0028689
1511 Ga0501043_0076117
1512 Ga0501043_0212660
1513 Ga0501043_0245281
1514 Ga0501046_0144407
1515 Ga0501046_0173526
1516 Ga0501047_0000073
1517 Ga0501047_0030765
1518 Ga0501047_0169779
1519 Ga0501047_0301254
1520 Ga0501048_0000391
1521 Ga0501048_0107868
1522 Ga0501048_0166733
1523 Ga0501067_0018876
1524 Ga0501067_0026794
1525 Ga0501067_0062154
1526 Ga0501068_0028094
1527 Ga0501069_0074898
1528 Ga0501069_0080778
1529 Ga0501070_0036364
1530 Ga0501070_0070884
1531 Ga0501070_0099219
1532 Ga0501070_0107418
1533 Ga0501070_0121305
1534 Ga0501070_0193618
1535 Ga0501070_0236972
1536 Ga0501071_0187505
1537 Ga0501072_0007381
1538 Ga0501072_0028692
1539 Ga0501072_0365318
1540 Ga0501073_0010362
1541 Ga0501073_0041506
1542 Ga0501073_0047948
1543 Ga0501073_0078028
1544 Ga0501073_0133542
1545 Ga0501073_0256425
1546 Ga0501074_0037466
1547 Ga0501074_0074614
1548 Ga0501074_0100751
1549 Ga0501079_0036026
1550 Ga0501080_0006835
1551 Ga0501080_0029315
1552 Ga0501080_0090041
1553 Ga0501080_0131989
1554 Ga0501080_0160220
1555 Ga0501080_0218525
1556 Ga0501083_0000139
1557 Ga0501083_0055944
1558 Ga0501083_0110965
1559 Ga0501083_0132895
1560 Ga0501035_0001020
1561 Ga0501035_0092572
1562 Ga0501035_0096114
1563 Ga0501035_0111324
1564 Ga0501035_0412901
1565 Ga0501044_0005518
1566 Ga0501044_0037733
1567 Ga0501044_0267967
1568 Ga0501045_0077542
1569 Ga0501045_0078420
1570 nmdc:mga05p37_129606_c1
1571 nmdc:mga05p37_15207_c1
1572 nmdc:mga05p37_18481_c1
1573 nmdc:mga05p37_235544_c1
1574 nmdc:mga05p37_53778_c1
1575 nmdc:mga05p37_79680_c1
1576 nmdc:mga09592_355495_c1
1577 nmdc:mga09592_48564_c1
1578 nmdc:mga09592_5221_c1
1579 nmdc:mga0qj67_33781_c1
1580 nmdc:mga0qj67_347350_c1
1581 nmdc:mga0qj67_5138_c1
1582 nmdc:mga06r32_163736_c1
1583 nmdc:mga06r32_1670_c1
1584 nmdc:mga06r32_85486_c1
1585 nmdc:mga08y16_15015_c1
1586 nmdc:mga08y16_20578_c1
1587 nmdc:mga08y16_643734_c1
1588 nmdc:mga08y16_6877_c1
1589 nmdc:mga0n895_107079_c1
1590 nmdc:mga0n895_1271_c1
1591 nmdc:mga0n895_12797_c1
1592 nmdc:mga0n895_148321_c1
1593 nmdc:mga0n895_29981_c1
1594 nmdc:mga0n895_482666_c1
1595 nmdc:mga0n895_515895_c1
1596 nmdc:mga0n895_92515_c1
1597 nmdc:mga0n895_9812_c1
1598 nmdc:mga0rr50_39133_c1
1599 nmdc:mga0rr50_5080_c1
1600 nmdc:mga0rr50_70636_c1
1601 nmdc:mga08x19_197067_c1
1602 nmdc:mga08x19_81078_c1
1603 nmdc:mga0a205_16609_c1
1604 nmdc:mga0a205_419881_c1
1605 Ga0495601_0000006
1606 Ga0495601_0031224
1607 Ga0495601_0048428
1608 Ga0495601_0054932
1609 Ga0495612_0000004
1610 Ga0495612_0005181
1611 Ga0495612_0038945
1612 Ga0495595_0000006
1613 Ga0495595_0002169
1614 Ga0495619_0000011
1615 Ga0495619_0000384
1616 Ga0495619_0012696
1617 Ga0500566_0142359
1618 Ga0500652_000006
1619 Ga0500616_0037070
1620 Ga0500616_0040910
1621 Ga0501084_0143159
1622 Ga0501084_0301680
1623 Ga0501084_0394778
1624 Ga0501082_0041891
1625 Ga0501082_0050070
1626 Ga0501082_0350369
1627 Ga0466962_0097220
1628 Ga0530510_0225736

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

98

209

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z7a-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8592 24 282
3cl6-assembly1.cif.gz_A crystal structure of puue allantoinase 0.8575 14 286
3rxz-assembly1.cif.gz_B crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis 0.8508 8 288
3s6o-assembly1.cif.gz_D crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei 0.8348 16 282
3rxz-assembly1.cif.gz_B crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis 0.817 8 288
ID Description Score Start End Superfamily
af_O13842_2_320_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8467 12 282 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8338 8 288 3.20.20.370
1z7aC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8181 24 282 3.20.20.370
3qbuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7978 26 286 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7977 8 288 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A537NL26-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.9798 65 287 GO:0005975
GO:0016810
AF-W4M0J2-F1-model_v4 NodB homology domain-containing protein 0.9733 78 284 GO:0005975
GO:0016810
AF-H0THA1-F1-model_v4 Polysaccharide deacetylase 0.972 160 290 GO:0005975
AF-A0A537NL26-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.9712 65 287 GO:0005975
GO:0016810
AF-A0A2V7EC11-F1-model_v4 Polysaccharide deacetylase 0.9695 125 287 GO:0005975

Map