F482000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 814 | 389 | 1628 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300049590|Ga0501074_0013395|Ga0501074_0013395_2297_3271 |
| Length | 324 |
| Sequence | MPGLVPGIHALAANGVDGRVKPGHDAEGKRVQMPMHPRERLPYSPIEGRPPLKFPDGVRLVIWPVLALEEWDMARPMARMVISPPQGQPMQPDHPNWSWHEYGMRVGFWRLRKVLQRLNIAPTVTLNARVCETYPQVAQACVDLGWELNAHGYDQVPMHKLDDQRAVIDKSMDIIETFGGKRPRGWFGPGLTQTFDTLDYLSEAGVEYIGDWVLDDEPVTLKTTHNPVVALPYNFEIHDIVMMALQHHPSDVWHARAMDQFNWLYKEAAERPKVMALACHPYLSGVPHRIGHVERTFEELLSKDGVVAWDGSKILDWYLKAKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 21 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 266 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 267 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 268 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 269 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 270 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.74 |
| Nodule | 0 |
| Rhizoplane | 7 |
| Rhizosphere | 91.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501074_0013395 | 3300049590 | Bacteria | 5961 |
| 2 | 2214884090 | 2209111006 | Bacteria | 7476 |
| 3 | ARSoilYngRDRAFT_c00124 | 3300000042 | Bacteria | 13179 |
| 4 | ARcpr5yngRDRAFT_c000127 | 3300000043 | Bacteria | 11898 |
| 5 | ARSoilOldRDRAFT_c000125 | 3300000044 | Bacteria | 13694 |
| 6 | ARCol0yngRDRAFT_1000457 | 3300000652 | Bacteria | 4957 |
| 7 | JGI24032J14994_100889 | 3300001430 | Bacteria | 1464 |
| 8 | JGI24746J21847_1003010 | 3300001977 | Bacteria | 2651 |
| 9 | JGI24739J22299_10000496 | 3300001989 | Bacteria | 13922 |
| 10 | JGI24739J22299_10025357 | 3300001989 | Bacteria | 2085 |
| 11 | JGI24737J22298_10000886 | 3300001990 | Bacteria | 10683 |
| 12 | JGI24750J21931_1001502 | 3300002070 | Bacteria | 2882 |
| 13 | JGI24745J21846_1002381 | 3300002073 | Bacteria | 1919 |
| 14 | JGI24738J21930_10009478 | 3300002075 | Bacteria | 2190 |
| 15 | JGI24749J21850_1001896 | 3300002076 | Bacteria | 2953 |
| 16 | JGI24035J26624_1006618 | 3300002126 | Bacteria | 1121 |
| 17 | JGI24034J26672_10009416 | 3300002239 | Bacteria | 1441 |
| 18 | JGI24742J22300_10000526 | 3300002244 | Bacteria | 5718 |
| 19 | JGI25404J52841_10002280 | 3300003659 | Bacteria | 3610 |
| 20 | JGI25405J52794_10003226 | 3300003911 | Bacteria | 2845 |
| 21 | Ga0065717_1002697 | 3300005276 | Bacteria | 1691 |
| 22 | Ga0065716_1001902 | 3300005277 | Bacteria | 2809 |
| 23 | Ga0065704_10146850 | 3300005289 | Bacteria | 1464 |
| 24 | Ga0065712_10088653 | 3300005290 | Bacteria | 2509 |
| 25 | Ga0065715_10095851 | 3300005293 | Bacteria | 3992 |
| 26 | Ga0065715_10103296 | 3300005293 | Bacteria | 3044 |
| 27 | Ga0070658_10004719 | 3300005327 | Bacteria | 11081 |
| 28 | Ga0070676_10003793 | 3300005328 | Bacteria | 7927 |
| 29 | Ga0070683_100000419 | 3300005329 | Bacteria | 29332 |
| 30 | Ga0070683_100080648 | 3300005329 | Bacteria | 3046 |
| 31 | Ga0070683_100112482 | 3300005329 | Bacteria | 2569 |
| 32 | Ga0070683_100306447 | 3300005329 | Bacteria | 1511 |
| 33 | Ga0070690_100040215 | 3300005330 | Bacteria | 2956 |
| 34 | Ga0070690_100176812 | 3300005330 | Bacteria | 1473 |
| 35 | Ga0070670_100004223 | 3300005331 | Bacteria | 12019 |
| 36 | Ga0070670_100151986 | 3300005331 | Bacteria | 2004 |
| 37 | Ga0070677_10000623 | 3300005333 | Bacteria | 11914 |
| 38 | Ga0068869_100001088 | 3300005334 | Bacteria | 15856 |
| 39 | Ga0070666_10005030 | 3300005335 | Bacteria | 8087 |
| 40 | Ga0070680_100003470 | 3300005336 | Bacteria | 11772 |
| 41 | Ga0070680_100013953 | 3300005336 | Bacteria | 6271 |
| 42 | Ga0070680_100200094 | 3300005336 | Bacteria | 1684 |
| 43 | Ga0070680_100350779 | 3300005336 | Bacteria | 1255 |
| 44 | Ga0070682_100003573 | 3300005337 | Bacteria | 8606 |
| 45 | Ga0068868_100004854 | 3300005338 | Bacteria | 9443 |
| 46 | Ga0070660_100001074 | 3300005339 | Bacteria | 18362 |
| 47 | Ga0070660_100001863 | 3300005339 | Bacteria | 14518 |
| 48 | Ga0070660_100215838 | 3300005339 | Bacteria | 1558 |
| 49 | Ga0070689_100010277 | 3300005340 | Bacteria | 6669 |
| 50 | Ga0070689_100049301 | 3300005340 | Bacteria | 3250 |
| 51 | Ga0070689_100108844 | 3300005340 | Unclassified | 2202 |
| 52 | Ga0070689_100372045 | 3300005340 | Bacteria | 1203 |
| 53 | Ga0070691_10101810 | 3300005341 | Bacteria | 1427 |
| 54 | Ga0070687_100001557 | 3300005343 | Bacteria | 8144 |
| 55 | Ga0070661_100000894 | 3300005344 | Bacteria | 21404 |
| 56 | Ga0070668_100063434 | 3300005347 | Bacteria | 2864 |
| 57 | Ga0070668_100273659 | 3300005347 | Bacteria | 1408 |
| 58 | Ga0070669_100003330 | 3300005353 | Bacteria | 11549 |
| 59 | Ga0070669_100234799 | 3300005353 | Bacteria | 1455 |
| 60 | Ga0070675_100006928 | 3300005354 | Bacteria | 8704 |
| 61 | Ga0070671_100226112 | 3300005355 | Bacteria | 1588 |
| 62 | Ga0070674_100001693 | 3300005356 | Bacteria | 11933 |
| 63 | Ga0070673_100001300 | 3300005364 | Bacteria | 14539 |
| 64 | Ga0070688_100000384 | 3300005365 | Bacteria | 22439 |
| 65 | Ga0070688_100056498 | 3300005365 | Bacteria | 2465 |
| 66 | Ga0070659_100003102 | 3300005366 | Bacteria | 11820 |
| 67 | Ga0070659_100046844 | 3300005366 | Bacteria | 3390 |
| 68 | Ga0070667_100011097 | 3300005367 | Bacteria | 7454 |
| 69 | Ga0070667_100069921 | 3300005367 | Bacteria | 2988 |
| 70 | Ga0070667_100188414 | 3300005367 | Bacteria | 1827 |
| 71 | Ga0070703_10038998 | 3300005406 | Bacteria | 1471 |
| 72 | Ga0070709_10013109 | 3300005434 | Bacteria | 4654 |
| 73 | Ga0070709_10020886 | 3300005434 | Bacteria | 3809 |
| 74 | Ga0070714_100046839 | 3300005435 | Bacteria | 3670 |
| 75 | Ga0070714_100252961 | 3300005435 | Bacteria | 1630 |
| 76 | Ga0070714_100548327 | 3300005435 | Bacteria | 1107 |
| 77 | Ga0070713_100003935 | 3300005436 | Bacteria | 9865 |
| 78 | Ga0070713_100006430 | 3300005436 | Bacteria | 8146 |
| 79 | Ga0070710_10006745 | 3300005437 | Bacteria | 5534 |
| 80 | Ga0070701_10000053 | 3300005438 | Bacteria | 29673 |
| 81 | Ga0070711_100044157 | 3300005439 | Bacteria | 3023 |
| 82 | Ga0070711_100074528 | 3300005439 | Bacteria | 2400 |
| 83 | Ga0070711_100188635 | 3300005439 | Bacteria | 1583 |
| 84 | Ga0070705_100025013 | 3300005440 | Bacteria | 3231 |
| 85 | Ga0070700_100000995 | 3300005441 | Bacteria | 13976 |
| 86 | Ga0070694_100004798 | 3300005444 | Bacteria | 8139 |
| 87 | Ga0070694_100500789 | 3300005444 | Bacteria | 967 |
| 88 | Ga0070708_100142584 | 3300005445 | Bacteria | 2223 |
| 89 | Ga0070708_100335278 | 3300005445 | Unclassified | 1425 |
| 90 | Ga0070663_100005062 | 3300005455 | Bacteria | 7787 |
| 91 | Ga0070663_100083500 | 3300005455 | Bacteria | 2352 |
| 92 | Ga0070663_100190608 | 3300005455 | Bacteria | 1595 |
| 93 | Ga0070663_100218673 | 3300005455 | Bacteria | 1495 |
| 94 | Ga0070678_100011901 | 3300005456 | Bacteria | 5385 |
| 95 | Ga0070678_100089594 | 3300005456 | Bacteria | 2355 |
| 96 | Ga0070662_100001392 | 3300005457 | Bacteria | 14897 |
| 97 | Ga0070662_100167618 | 3300005457 | Bacteria | 1722 |
| 98 | Ga0070681_10010566 | 3300005458 | Bacteria | 9118 |
| 99 | Ga0070681_10157101 | 3300005458 | Bacteria | 2198 |
| 100 | Ga0068867_100007589 | 3300005459 | Bacteria | 7676 |
| 101 | Ga0068867_100088580 | 3300005459 | Bacteria | 2346 |
| 102 | Ga0070685_10001493 | 3300005466 | Bacteria | 12316 |
| 103 | Ga0070706_100004167 | 3300005467 | Bacteria | 14057 |
| 104 | Ga0070707_100449188 | 3300005468 | Bacteria | 1250 |
| 105 | Ga0070698_100339980 | 3300005471 | Bacteria | 1432 |
| 106 | Ga0070699_100000829 | 3300005518 | Bacteria | 28653 |
| 107 | Ga0070679_100021813 | 3300005530 | Bacteria | 6255 |
| 108 | Ga0070679_100062401 | 3300005530 | Bacteria | 3715 |
| 109 | Ga0070679_100236204 | 3300005530 | Bacteria | 1787 |
| 110 | Ga0070679_100642765 | 3300005530 | Bacteria | 1004 |
| 111 | Ga0070684_100001048 | 3300005535 | Bacteria | 19748 |
| 112 | Ga0070684_100294099 | 3300005535 | Bacteria | 1489 |
| 113 | Ga0068853_100000976 | 3300005539 | Bacteria | 20134 |
| 114 | Ga0070672_100000458 | 3300005543 | Bacteria | 23647 |
| 115 | Ga0070686_100001811 | 3300005544 | Bacteria | 11922 |
| 116 | Ga0070695_100000550 | 3300005545 | Bacteria | 19844 |
| 117 | Ga0070696_100055945 | 3300005546 | Bacteria | 2751 |
| 118 | Ga0070696_100115324 | 3300005546 | Bacteria | 1938 |
| 119 | Ga0070696_100159818 | 3300005546 | Bacteria | 1659 |
| 120 | Ga0070696_100198223 | 3300005546 | Bacteria | 1498 |
| 121 | Ga0070693_100040580 | 3300005547 | Bacteria | 2613 |
| 122 | Ga0070665_100077915 | 3300005548 | Bacteria | 3321 |
| 123 | Ga0070665_100202705 | 3300005548 | Bacteria | 1984 |
| 124 | Ga0070704_100007431 | 3300005549 | Bacteria | 6526 |
| 125 | Ga0070704_100099683 | 3300005549 | Bacteria | 2185 |
| 126 | Ga0070704_100522181 | 3300005549 | Bacteria | 1034 |
| 127 | Ga0068855_100005184 | 3300005563 | Bacteria | 15895 |
| 128 | Ga0068855_100015368 | 3300005563 | Bacteria | 9215 |
| 129 | Ga0068855_100581964 | 3300005563 | Bacteria | 1209 |
| 130 | Ga0070664_100001280 | 3300005564 | Bacteria | 20134 |
| 131 | Ga0070664_100032243 | 3300005564 | Bacteria | 4382 |
| 132 | Ga0070664_100128279 | 3300005564 | Bacteria | 2226 |
| 133 | Ga0070664_100581263 | 3300005564 | Bacteria | 1038 |
| 134 | Ga0068857_100000630 | 3300005577 | Bacteria | 25882 |
| 135 | Ga0068854_100000802 | 3300005578 | Bacteria | 18733 |
| 136 | Ga0068856_100001005 | 3300005614 | Bacteria | 30012 |
| 137 | Ga0068856_100130400 | 3300005614 | Bacteria | 2518 |
| 138 | Ga0070702_100004228 | 3300005615 | Bacteria | 6535 |
| 139 | Ga0068852_100060331 | 3300005616 | Bacteria | 3292 |
| 140 | Ga0068852_100129000 | 3300005616 | Bacteria | 2326 |
| 141 | Ga0068852_100195391 | 3300005616 | Bacteria | 1911 |
| 142 | Ga0068859_100251889 | 3300005617 | Bacteria | 1856 |
| 143 | Ga0068864_100000140 | 3300005618 | Bacteria | 69827 |
| 144 | Ga0068864_100204338 | 3300005618 | Bacteria | 1816 |
| 145 | Ga0068861_100001121 | 3300005719 | Bacteria | 16605 |
| 146 | Ga0068863_100000425 | 3300005841 | Bacteria | 42737 |
| 147 | Ga0068863_100133417 | 3300005841 | Bacteria | 2372 |
| 148 | Ga0068863_100190754 | 3300005841 | Bacteria | 1969 |
| 149 | Ga0068863_100484232 | 3300005841 | Bacteria | 1217 |
| 150 | Ga0068858_100004894 | 3300005842 | Bacteria | 13135 |
| 151 | Ga0068858_100043093 | 3300005842 | Bacteria | 4184 |
| 152 | Ga0068858_100065262 | 3300005842 | Bacteria | 3368 |
| 153 | Ga0068858_100145563 | 3300005842 | Bacteria | 2225 |
| 154 | Ga0068860_100002221 | 3300005843 | Bacteria | 20432 |
| 155 | Ga0068860_100832392 | 3300005843 | Bacteria | 937 |
| 156 | Ga0068862_100001418 | 3300005844 | Bacteria | 22202 |
| 157 | Ga0081455_10000091 | 3300005937 | Bacteria | 97617 |
| 158 | Ga0081455_10006350 | 3300005937 | Bacteria | 12691 |
| 159 | Ga0081455_10007779 | 3300005937 | Bacteria | 11235 |
| 160 | Ga0081455_10057711 | 3300005937 | Bacteria | 3289 |
| 161 | Ga0081540_1000068 | 3300005983 | Bacteria | 112697 |
| 162 | Ga0081540_1011418 | 3300005983 | Bacteria | 5937 |
| 163 | Ga0081540_1050880 | 3300005983 | Bacteria | 2053 |
| 164 | Ga0070717_10003725 | 3300006028 | Bacteria | 10947 |
| 165 | Ga0070717_10041544 | 3300006028 | Bacteria | 3748 |
| 166 | Ga0075365_10144773 | 3300006038 | Bacteria | 1651 |
| 167 | Ga0070715_10002493 | 3300006163 | Bacteria | 5667 |
| 168 | Ga0070716_100010029 | 3300006173 | Bacteria | 4738 |
| 169 | Ga0070712_100100082 | 3300006175 | Bacteria | 2141 |
| 170 | Ga0075369_10006378 | 3300006186 | Bacteria | 4459 |
| 171 | Ga0075427_10001272 | 3300006194 | Bacteria | 3220 |
| 172 | Ga0097621_100001542 | 3300006237 | Bacteria | 15764 |
| 173 | Ga0097621_100006138 | 3300006237 | Bacteria | 8510 |
| 174 | Ga0097621_100055513 | 3300006237 | Bacteria | 3235 |
| 175 | Ga0097621_100207309 | 3300006237 | Bacteria | 1704 |
| 176 | Ga0068871_100000938 | 3300006358 | Bacteria | 19471 |
| 177 | Ga0068871_100057854 | 3300006358 | Bacteria | 3155 |
| 178 | Ga0068871_100069536 | 3300006358 | Bacteria | 2892 |
| 179 | Ga0075428_100144863 | 3300006844 | Bacteria | 2582 |
| 180 | Ga0075430_100017069 | 3300006846 | Bacteria | 6183 |
| 181 | Ga0075430_100018342 | 3300006846 | Bacteria | 5956 |
| 182 | Ga0075430_100132135 | 3300006846 | Bacteria | 2080 |
| 183 | Ga0075431_100014631 | 3300006847 | Bacteria | 7938 |
| 184 | Ga0075431_100024210 | 3300006847 | Bacteria | 6218 |
| 185 | Ga0075431_100121078 | 3300006847 | Bacteria | 2700 |
| 186 | Ga0075431_100216345 | 3300006847 | Bacteria | 1955 |
| 187 | Ga0075431_100235803 | 3300006847 | Bacteria | 1863 |
| 188 | Ga0075433_10110347 | 3300006852 | Bacteria | 2440 |
| 189 | Ga0075433_10181970 | 3300006852 | Bacteria | 1870 |
| 190 | Ga0075434_100008958 | 3300006871 | Bacteria | 9320 |
| 191 | Ga0075434_100016992 | 3300006871 | Bacteria | 7001 |
| 192 | Ga0075434_100082865 | 3300006871 | Bacteria | 3205 |
| 193 | Ga0075434_100178784 | 3300006871 | Bacteria | 2141 |
| 194 | Ga0075434_100253886 | 3300006871 | Bacteria | 1777 |
| 195 | Ga0075434_100402587 | 3300006871 | Bacteria | 1390 |
| 196 | Ga0068865_100002772 | 3300006881 | Bacteria | 10413 |
| 197 | Ga0075436_100021379 | 3300006914 | Bacteria | 4442 |
| 198 | Ga0097620_100251864 | 3300006931 | Bacteria | 1856 |
| 199 | Ga0075435_100011643 | 3300007076 | Bacteria | 6483 |
| 200 | Ga0075435_100049443 | 3300007076 | Bacteria | 3382 |
| 201 | Ga0075435_100141600 | 3300007076 | Bacteria | 2018 |
| 202 | Ga0075435_100157945 | 3300007076 | Bacteria | 1909 |
| 203 | Ga0099794_10010006 | 3300007265 | Bacteria | 4014 |
| 204 | Ga0105244_10079447 | 3300009036 | Bacteria | 1626 |
| 205 | Ga0105240_10410677 | 3300009093 | Bacteria | 1523 |
| 206 | Ga0111539_10013242 | 3300009094 | Bacteria | 10308 |
| 207 | Ga0111539_10068122 | 3300009094 | Bacteria | 4202 |
| 208 | Ga0111539_10132394 | 3300009094 | Bacteria | 2920 |
| 209 | Ga0111539_10148458 | 3300009094 | Bacteria | 2744 |
| 210 | Ga0111539_10938521 | 3300009094 | Bacteria | 1006 |
| 211 | Ga0105245_10004587 | 3300009098 | Bacteria | 12202 |
| 212 | Ga0105245_10007019 | 3300009098 | Bacteria | 9882 |
| 213 | Ga0105245_10014701 | 3300009098 | Bacteria | 6815 |
| 214 | Ga0105247_10007542 | 3300009101 | Bacteria | 6664 |
| 215 | Ga0105247_10013219 | 3300009101 | Bacteria | 4951 |
| 216 | Ga0114129_10018126 | 3300009147 | Bacteria | 10027 |
| 217 | Ga0114129_10045452 | 3300009147 | Bacteria | 6173 |
| 218 | Ga0114129_10111386 | 3300009147 | Bacteria | 3777 |
| 219 | Ga0114129_10199475 | 3300009147 | Bacteria | 2711 |
| 220 | Ga0105243_10014317 | 3300009148 | Bacteria | 6001 |
| 221 | Ga0105242_10002741 | 3300009176 | Bacteria | 13782 |
| 222 | Ga0105242_10065486 | 3300009176 | Bacteria | 2998 |
| 223 | Ga0105242_10374314 | 3300009176 | Bacteria | 1322 |
| 224 | Ga0105248_10008864 | 3300009177 | Bacteria | 11055 |
| 225 | Ga0105248_10047096 | 3300009177 | Bacteria | 4834 |
| 226 | Ga0105248_10053904 | 3300009177 | Bacteria | 4511 |
| 227 | Ga0105248_10113465 | 3300009177 | Bacteria | 3056 |
| 228 | Ga0105237_10103613 | 3300009545 | Bacteria | 2837 |
| 229 | Ga0105237_10128242 | 3300009545 | Bacteria | 2531 |
| 230 | Ga0105238_10124446 | 3300009551 | Bacteria | 2558 |
| 231 | Ga0105238_10126675 | 3300009551 | Bacteria | 2532 |
| 232 | Ga0105249_10014469 | 3300009553 | Bacteria | 6974 |
| 233 | Ga0099796_10001585 | 3300010159 | Bacteria | 4664 |
| 234 | Ga0105239_10193263 | 3300010375 | Bacteria | 2278 |
| 235 | Ga0105246_10000599 | 3300011119 | Bacteria | 19996 |
| 236 | Ga0157336_1000226 | 3300012477 | Bacteria | 2474 |
| 237 | Ga0157371_10027149 | 3300013102 | Bacteria | 4155 |
| 238 | Ga0157371_10181661 | 3300013102 | Bacteria | 1504 |
| 239 | Ga0157370_10365303 | 3300013104 | Bacteria | 1330 |
| 240 | Ga0157369_10364446 | 3300013105 | Bacteria | 1500 |
| 241 | Ga0157374_10090125 | 3300013296 | Bacteria | 2923 |
| 242 | Ga0157374_10277257 | 3300013296 | Bacteria | 1655 |
| 243 | Ga0157378_10268385 | 3300013297 | Bacteria | 1640 |
| 244 | Ga0163162_10022422 | 3300013306 | Bacteria | 6221 |
| 245 | Ga0163162_10029973 | 3300013306 | Bacteria | 5387 |
| 246 | Ga0163162_10241226 | 3300013306 | Bacteria | 1938 |
| 247 | Ga0163162_10349766 | 3300013306 | Unclassified | 1611 |
| 248 | Ga0163162_10605011 | 3300013306 | Bacteria | 1222 |
| 249 | Ga0157372_10081649 | 3300013307 | Bacteria | 3659 |
| 250 | Ga0157375_10001131 | 3300013308 | Bacteria | 23092 |
| 251 | Ga0157375_10002488 | 3300013308 | Bacteria | 15965 |
| 252 | Ga0163163_10019116 | 3300014325 | Bacteria | 6428 |
| 253 | Ga0163163_10022743 | 3300014325 | Bacteria | 5940 |
| 254 | Ga0163163_10158680 | 3300014325 | Bacteria | 2307 |
| 255 | Ga0157380_10000894 | 3300014326 | Bacteria | 18734 |
| 256 | Ga0157380_10217025 | 3300014326 | Bacteria | 1709 |
| 257 | Ga0157377_10000696 | 3300014745 | Bacteria | 13852 |
| 258 | Ga0157377_10090537 | 3300014745 | Bacteria | 1806 |
| 259 | Ga0157379_10005316 | 3300014968 | Bacteria | 11062 |
| 260 | Ga0157379_10062283 | 3300014968 | Bacteria | 3337 |
| 261 | Ga0157376_10008132 | 3300014969 | Bacteria | 7540 |
| 262 | Ga0157376_10224250 | 3300014969 | Bacteria | 1743 |
| 263 | Ga0157376_10225265 | 3300014969 | Bacteria | 1739 |
| 264 | Ga0163161_10010626 | 3300017792 | Bacteria | 6374 |
| 265 | Ga0213876_10038132 | 3300021384 | Bacteria | 2535 |
| 266 | Ga0207666_1000052 | 3300025271 | Bacteria | 20908 |
| 267 | Ga0207697_10000169 | 3300025315 | Bacteria | 33307 |
| 268 | Ga0207655_1076877 | 3300025728 | Bacteria | 1219 |
| 269 | Ga0207653_10001090 | 3300025885 | Bacteria | 8908 |
| 270 | Ga0207682_10000859 | 3300025893 | Bacteria | 14091 |
| 271 | Ga0207692_10035165 | 3300025898 | Bacteria | 2433 |
| 272 | Ga0207692_10081781 | 3300025898 | Bacteria | 1729 |
| 273 | Ga0207642_10001773 | 3300025899 | Bacteria | 6672 |
| 274 | Ga0207688_10000024 | 3300025901 | Bacteria | 48792 |
| 275 | Ga0207680_10002348 | 3300025903 | Bacteria | 8799 |
| 276 | Ga0207699_10001996 | 3300025906 | Bacteria | 9644 |
| 277 | Ga0207699_10171286 | 3300025906 | Bacteria | 1452 |
| 278 | Ga0207699_10236634 | 3300025906 | Bacteria | 1253 |
| 279 | Ga0207645_10000538 | 3300025907 | Bacteria | 31527 |
| 280 | Ga0207643_10000035 | 3300025908 | Bacteria | 90905 |
| 281 | Ga0207684_10003395 | 3300025910 | Bacteria | 15592 |
| 282 | Ga0207707_10032345 | 3300025912 | Bacteria | 4578 |
| 283 | Ga0207707_10072923 | 3300025912 | Bacteria | 2993 |
| 284 | Ga0207707_10091109 | 3300025912 | Bacteria | 2665 |
| 285 | Ga0207695_10068916 | 3300025913 | Bacteria | 3623 |
| 286 | Ga0207671_10007789 | 3300025914 | Bacteria | 9222 |
| 287 | Ga0207671_10078469 | 3300025914 | Bacteria | 2473 |
| 288 | Ga0207671_10107971 | 3300025914 | Bacteria | 2115 |
| 289 | Ga0207693_10003819 | 3300025915 | Bacteria | 12829 |
| 290 | Ga0207693_10014157 | 3300025915 | Bacteria | 6424 |
| 291 | Ga0207693_10038334 | 3300025915 | Bacteria | 3775 |
| 292 | Ga0207663_10007219 | 3300025916 | Bacteria | 5750 |
| 293 | Ga0207663_10018925 | 3300025916 | Bacteria | 3868 |
| 294 | Ga0207663_10033317 | 3300025916 | Bacteria | 3068 |
| 295 | Ga0207663_10235025 | 3300025916 | Bacteria | 1341 |
| 296 | Ga0207663_10467073 | 3300025916 | Bacteria | 975 |
| 297 | Ga0207660_10002466 | 3300025917 | Bacteria | 12145 |
| 298 | Ga0207660_10009921 | 3300025917 | Bacteria | 6168 |
| 299 | Ga0207662_10001196 | 3300025918 | Bacteria | 12377 |
| 300 | Ga0207662_10028942 | 3300025918 | Bacteria | 3207 |
| 301 | Ga0207657_10003229 | 3300025919 | Bacteria | 17451 |
| 302 | Ga0207657_10005139 | 3300025919 | Bacteria | 13716 |
| 303 | Ga0207657_10031263 | 3300025919 | Bacteria | 4826 |
| 304 | Ga0207649_10000412 | 3300025920 | Bacteria | 31594 |
| 305 | Ga0207649_10081125 | 3300025920 | Bacteria | 2100 |
| 306 | Ga0207652_10021544 | 3300025921 | Bacteria | 5319 |
| 307 | Ga0207652_10207941 | 3300025921 | Bacteria | 1762 |
| 308 | Ga0207646_10371971 | 3300025922 | Bacteria | 1291 |
| 309 | Ga0207681_10000553 | 3300025923 | Bacteria | 25812 |
| 310 | Ga0207681_10490773 | 3300025923 | Bacteria | 1004 |
| 311 | Ga0207694_10009714 | 3300025924 | Bacteria | 7257 |
| 312 | Ga0207694_10090437 | 3300025924 | Bacteria | 2415 |
| 313 | Ga0207694_10526840 | 3300025924 | Bacteria | 990 |
| 314 | Ga0207650_10005710 | 3300025925 | Bacteria | 8492 |
| 315 | Ga0207659_10000091 | 3300025926 | Bacteria | 53079 |
| 316 | Ga0207687_10000161 | 3300025927 | Bacteria | 45255 |
| 317 | Ga0207687_10010301 | 3300025927 | Bacteria | 6108 |
| 318 | Ga0207700_10005167 | 3300025928 | Bacteria | 7772 |
| 319 | Ga0207700_10052187 | 3300025928 | Bacteria | 3056 |
| 320 | Ga0207700_10264082 | 3300025928 | Bacteria | 1475 |
| 321 | Ga0207700_10475458 | 3300025928 | Bacteria | 1104 |
| 322 | Ga0207664_10067292 | 3300025929 | Bacteria | 2874 |
| 323 | Ga0207664_10465830 | 3300025929 | Bacteria | 1129 |
| 324 | Ga0207644_10002790 | 3300025931 | Bacteria | 11252 |
| 325 | Ga0207644_10011541 | 3300025931 | Bacteria | 5848 |
| 326 | Ga0207690_10002912 | 3300025932 | Bacteria | 10313 |
| 327 | Ga0207690_10024199 | 3300025932 | Bacteria | 3801 |
| 328 | Ga0207690_10125811 | 3300025932 | Bacteria | 1869 |
| 329 | Ga0207706_10027574 | 3300025933 | Bacteria | 5078 |
| 330 | Ga0207706_10068037 | 3300025933 | Bacteria | 3135 |
| 331 | Ga0207686_10001075 | 3300025934 | Bacteria | 16031 |
| 332 | Ga0207686_10008756 | 3300025934 | Bacteria | 5467 |
| 333 | Ga0207686_10122799 | 3300025934 | Bacteria | 1770 |
| 334 | Ga0207709_10000575 | 3300025935 | Bacteria | 30869 |
| 335 | Ga0207670_10000182 | 3300025936 | Bacteria | 41877 |
| 336 | Ga0207669_10000082 | 3300025937 | Bacteria | 48083 |
| 337 | Ga0207704_10000604 | 3300025938 | Bacteria | 15864 |
| 338 | Ga0207704_10120109 | 3300025938 | Bacteria | 1796 |
| 339 | Ga0207665_10004294 | 3300025939 | Bacteria | 9475 |
| 340 | Ga0207665_10006035 | 3300025939 | Bacteria | 8048 |
| 341 | Ga0207665_10336138 | 3300025939 | Bacteria | 1137 |
| 342 | Ga0207691_10000336 | 3300025940 | Bacteria | 47166 |
| 343 | Ga0207691_10127418 | 3300025940 | Bacteria | 2251 |
| 344 | Ga0207711_10012924 | 3300025941 | Bacteria | 6935 |
| 345 | Ga0207711_10015124 | 3300025941 | Bacteria | 6409 |
| 346 | Ga0207711_10281434 | 3300025941 | Bacteria | 1532 |
| 347 | Ga0207689_10002022 | 3300025942 | Bacteria | 19169 |
| 348 | Ga0207661_10001715 | 3300025944 | Bacteria | 14983 |
| 349 | Ga0207661_10059660 | 3300025944 | Bacteria | 3075 |
| 350 | Ga0207679_10000035 | 3300025945 | Bacteria | 144173 |
| 351 | Ga0207679_10034926 | 3300025945 | Bacteria | 3553 |
| 352 | Ga0207679_10125845 | 3300025945 | Bacteria | 2048 |
| 353 | Ga0207679_10536679 | 3300025945 | Bacteria | 1048 |
| 354 | Ga0207667_10008094 | 3300025949 | Bacteria | 12534 |
| 355 | Ga0207667_10025683 | 3300025949 | Bacteria | 6445 |
| 356 | Ga0207667_10099832 | 3300025949 | Bacteria | 2995 |
| 357 | Ga0207667_10515412 | 3300025949 | Bacteria | 1212 |
| 358 | Ga0207651_10002513 | 3300025960 | Bacteria | 8759 |
| 359 | Ga0207712_10000429 | 3300025961 | Bacteria | 35843 |
| 360 | Ga0207712_10073978 | 3300025961 | Bacteria | 2459 |
| 361 | Ga0207668_10000149 | 3300025972 | Bacteria | 48188 |
| 362 | Ga0207668_10500743 | 3300025972 | Bacteria | 1045 |
| 363 | Ga0207640_10008008 | 3300025981 | Bacteria | 5838 |
| 364 | Ga0207640_10035961 | 3300025981 | Bacteria | 3105 |
| 365 | Ga0207658_10003056 | 3300025986 | Bacteria | 11974 |
| 366 | Ga0207658_10056414 | 3300025986 | Bacteria | 2915 |
| 367 | Ga0207658_10105228 | 3300025986 | Bacteria | 2219 |
| 368 | Ga0207658_10130044 | 3300025986 | Bacteria | 2021 |
| 369 | Ga0207677_10003478 | 3300026023 | Bacteria | 8351 |
| 370 | Ga0207703_10004085 | 3300026035 | Bacteria | 12041 |
| 371 | Ga0207703_10236497 | 3300026035 | Bacteria | 1640 |
| 372 | Ga0207703_10391373 | 3300026035 | Bacteria | 1288 |
| 373 | Ga0207639_10002878 | 3300026041 | Bacteria | 11561 |
| 374 | Ga0207678_10001400 | 3300026067 | Bacteria | 22181 |
| 375 | Ga0207678_10012249 | 3300026067 | Bacteria | 7531 |
| 376 | Ga0207678_10099921 | 3300026067 | Bacteria | 2478 |
| 377 | Ga0207708_10000896 | 3300026075 | Bacteria | 22353 |
| 378 | Ga0207702_10002760 | 3300026078 | Bacteria | 16441 |
| 379 | Ga0207641_10008796 | 3300026088 | Bacteria | 8340 |
| 380 | Ga0207641_10050146 | 3300026088 | Bacteria | 3530 |
| 381 | Ga0207641_10088031 | 3300026088 | Bacteria | 2711 |
| 382 | Ga0207648_10008471 | 3300026089 | Bacteria | 9953 |
| 383 | Ga0207648_10056972 | 3300026089 | Bacteria | 3410 |
| 384 | Ga0207648_10261405 | 3300026089 | Bacteria | 1544 |
| 385 | Ga0207676_10000979 | 3300026095 | Bacteria | 22022 |
| 386 | Ga0207676_10159117 | 3300026095 | Bacteria | 1954 |
| 387 | Ga0207674_10006130 | 3300026116 | Bacteria | 14213 |
| 388 | Ga0207674_10151601 | 3300026116 | Bacteria | 2275 |
| 389 | Ga0207675_100001667 | 3300026118 | Bacteria | 22216 |
| 390 | Ga0207675_100118496 | 3300026118 | Bacteria | 2503 |
| 391 | Ga0207675_100533160 | 3300026118 | Bacteria | 1172 |
| 392 | Ga0207683_10000457 | 3300026121 | Bacteria | 37951 |
| 393 | Ga0207683_10006130 | 3300026121 | Bacteria | 10299 |
| 394 | Ga0207683_10013806 | 3300026121 | Bacteria | 6888 |
| 395 | Ga0207698_10149178 | 3300026142 | Bacteria | 2027 |
| 396 | Ga0209984_1004399 | 3300027424 | Bacteria | 1659 |
| 397 | Ga0209179_1022594 | 3300027512 | Bacteria | 1236 |
| 398 | Ga0209588_1014590 | 3300027671 | Bacteria | 2407 |
| 399 | Ga0209971_1004021 | 3300027682 | Bacteria | 3476 |
| 400 | Ga0209966_1000836 | 3300027695 | Bacteria | 6020 |
| 401 | Ga0209974_10003856 | 3300027876 | Bacteria | 5372 |
| 402 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 403 | Ga0207428_10001163 | 3300027907 | Bacteria | 28365 |
| 404 | Ga0207428_10002495 | 3300027907 | Bacteria | 18379 |
| 405 | Ga0268266_10116185 | 3300028379 | Bacteria | 2376 |
| 406 | Ga0268266_10240167 | 3300028379 | Bacteria | 1672 |
| 407 | Ga0268265_10001635 | 3300028380 | Bacteria | 18413 |
| 408 | Ga0268264_10000813 | 3300028381 | Bacteria | 33664 |
| 409 | Ga0268264_10089113 | 3300028381 | Bacteria | 2656 |
| 410 | Ga0265342_10001792 | 3300031712 | Bacteria | 19528 |
| 411 | Ga0373930_0009915 | 3300034816 | Bacteria | 1693 |
| 412 | Ga0373930_0010916 | 3300034816 | Bacteria | 1631 |
| 413 | Ga0373948_0000943 | 3300034817 | Bacteria | 3901 |
| 414 | Ga0373959_0008280 | 3300034820 | Bacteria | 1767 |
| 415 | Ga0373938_0000151 | 3300034957 | Bacteria | 10052 |
| 416 | Ga0373929_0000167 | 3300035085 | Bacteria | 11504 |
| 417 | Ga0373929_0006898 | 3300035085 | Bacteria | 2063 |
| 418 | Ga0373929_0013103 | 3300035085 | Bacteria | 1585 |
| 419 | Ga0373934_0008237 | 3300035086 | Bacteria | 3882 |
| 420 | Ga0373940_0013026 | 3300035088 | Bacteria | 2002 |
| 421 | Ga0373940_0016673 | 3300035088 | Bacteria | 1822 |
| 422 | Ga0373944_0011315 | 3300035089 | Bacteria | 2443 |
| 423 | Ga0373944_0018674 | 3300035089 | Bacteria | 1982 |
| 424 | Ga0373949_0002205 | 3300035090 | Bacteria | 5098 |
| 425 | Ga0373951_0001108 | 3300035091 | Bacteria | 7160 |
| 426 | Ga0373952_0005537 | 3300035092 | Bacteria | 2311 |
| 427 | Ga0373923_0003873 | 3300035111 | Bacteria | 4877 |
| 428 | Ga0373923_0009787 | 3300035111 | Bacteria | 3467 |
| 429 | Ga0373932_0001743 | 3300035112 | Bacteria | 5906 |
| 430 | Ga0373936_0000458 | 3300035113 | Bacteria | 13726 |
| 431 | Ga0373936_0003274 | 3300035113 | Bacteria | 6069 |
| 432 | Ga0373936_0030845 | 3300035113 | Bacteria | 2115 |
| 433 | Ga0373939_0004697 | 3300035114 | Bacteria | 3238 |
| 434 | Ga0373941_0000235 | 3300035115 | Bacteria | 10656 |
| 435 | Ga0373941_0001296 | 3300035115 | Bacteria | 5265 |
| 436 | Ga0373941_0007755 | 3300035115 | Bacteria | 2639 |
| 437 | Ga0373945_0036035 | 3300035116 | Bacteria | 1771 |
| 438 | Ga0373945_0061497 | 3300035116 | Bacteria | 1402 |
| 439 | Ga0373953_0000434 | 3300035117 | Bacteria | 11439 |
| 440 | Ga0373954_0006934 | 3300035118 | Bacteria | 4945 |
| 441 | Ga0373954_0031342 | 3300035118 | Bacteria | 2454 |
| 442 | Ga0373956_0005231 | 3300035119 | Bacteria | 5197 |
| 443 | Ga0373957_0031602 | 3300035120 | Bacteria | 1946 |
| 444 | Ga0373957_0087160 | 3300035120 | Bacteria | 1237 |
| 445 | Ga0373960_0001471 | 3300035121 | Bacteria | 5219 |
| 446 | Ga0373960_0016391 | 3300035121 | Bacteria | 1905 |
| 447 | Ga0373943_0009521 | 3300035170 | Bacteria | 4354 |
| 448 | Ga0373943_0016632 | 3300035170 | Bacteria | 3356 |
| 449 | Ga0373943_0115201 | 3300035170 | Bacteria | 1422 |
| 450 | Ga0373943_0280982 | 3300035170 | Bacteria | 941 |
| 451 | Ga0373946_0005518 | 3300035171 | Bacteria | 4563 |
| 452 | Ga0373946_0007236 | 3300035171 | Bacteria | 4050 |
| 453 | Ga0373946_0014747 | 3300035171 | Bacteria | 2952 |
| 454 | Ga0373955_0006525 | 3300035172 | Bacteria | 5320 |
| 455 | Ga0373955_0007396 | 3300035172 | Bacteria | 5048 |
| 456 | Ga0373942_0011444 | 3300035207 | Bacteria | 2104 |
| 457 | Ga0373961_0000465 | 3300035241 | Bacteria | 16011 |
| 458 | Ga0373961_0004288 | 3300035241 | Bacteria | 3452 |
| 459 | Ga0373961_0059474 | 3300035241 | Bacteria | 1155 |
| 460 | Ga0373962_0000735 | 3300035242 | Bacteria | 7414 |
| 461 | Ga0373962_0009420 | 3300035242 | Bacteria | 2420 |
| 462 | Ga0373924_0000181 | 3300035410 | Bacteria | 18683 |
| 463 | Ga0373924_0004865 | 3300035410 | Bacteria | 4719 |
| 464 | Ga0373931_0000398 | 3300035691 | Bacteria | 17831 |
| 465 | Ga0373931_0042107 | 3300035691 | Bacteria | 2400 |
| 466 | Ga0373931_0063424 | 3300035691 | Bacteria | 1997 |
| 467 | Ga0373935_0000332 | 3300035692 | Bacteria | 23823 |
| 468 | Ga0373927_0004623 | 3300035695 | Bacteria | 9597 |
| 469 | Ga0373927_0019391 | 3300035695 | Bacteria | 4460 |
| 470 | Ga0373927_0022495 | 3300035695 | Bacteria | 4129 |
| 471 | Ga0373933_0001128 | 3300035724 | Bacteria | 15860 |
| 472 | Ga0373933_0007464 | 3300035724 | Bacteria | 5968 |
| 473 | Ga0373933_0033137 | 3300035724 | Bacteria | 3003 |
| 474 | Ga0373947_0000414 | 3300035725 | Bacteria | 24229 |
| 475 | Ga0373947_0001411 | 3300035725 | Bacteria | 14804 |
| 476 | Ga0373947_0035619 | 3300035725 | Bacteria | 2947 |
| 477 | Ga0373937_0000256 | 3300036401 | Bacteria | 51768 |
| 478 | Ga0373937_0021412 | 3300036401 | Bacteria | 5804 |
| 479 | Ga0373925_0000087 | 3300037068 | Bacteria | 99043 |
| 480 | Ga0373925_0048049 | 3300037068 | Bacteria | 3178 |
| 481 | Ga0395900_0052170 | 3300037418 | Bacteria | 4210 |
| 482 | Ga0395898_0005267 | 3300037466 | Bacteria | 13987 |
| 483 | Ga0395898_0333468 | 3300037466 | Bacteria | 1446 |
| 484 | Ga0395905_0494342 | 3300037471 | Bacteria | 1123 |
| 485 | Ga0436364_0376058 | 3300037853 | Bacteria | 1456 |
| 486 | Ga0395901_0025919 | 3300038443 | Bacteria | 6020 |
| 487 | Ga0395901_0051386 | 3300038443 | Bacteria | 4286 |
| 488 | Ga0395901_0093925 | 3300038443 | Bacteria | 3141 |
| 489 | Ga0436365_0168259 | 3300039437 | Bacteria | 6780 |
| 490 | Ga0436365_1032543 | 3300039437 | Bacteria | 1329 |
| 491 | Ga0436361_0493839 | 3300039447 | Bacteria | 12715 |
| 492 | Ga0439453_0006336 | 3300041408 | Bacteria | 1839 |
| 493 | Ga0439448_0025287 | 3300042005 | Bacteria | 1862 |
| 494 | Ga0439450_028226 | 3300042008 | Bacteria | 1247 |
| 495 | Ga0439455_0003554 | 3300042012 | Bacteria | 2995 |
| 496 | Ga0439463_048146 | 3300042016 | Bacteria | 1086 |
| 497 | Ga0451577_0037092 | 3300042876 | Bacteria | 4389 |
| 498 | Ga0466963_0000255 | 3300044694 | Bacteria | 23380 |
| 499 | Ga0466963_0125865 | 3300044694 | Bacteria | 1767 |
| 500 | Ga0466971_0058777 | 3300044719 | Bacteria | 1736 |
| 501 | Ga0466971_0064934 | 3300044719 | Bacteria | 1652 |
| 502 | Ga0466957_0003978 | 3300044842 | Bacteria | 8171 |
| 503 | Ga0466958_0084321 | 3300045836 | Bacteria | 1959 |
| 504 | Ga0466967_0026440 | 3300045976 | Bacteria | 4807 |
| 505 | Ga0466967_0799341 | 3300045976 | Bacteria | 936 |
| 506 | Ga0495617_018692 | 3300046452 | Bacteria | 2344 |
| 507 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 508 | Ga0495592_0064320 | 3300046454 | Bacteria | 2688 |
| 509 | Ga0495592_0112911 | 3300046454 | Bacteria | 1920 |
| 510 | Ga0495603_0000816 | 3300046455 | Bacteria | 17875 |
| 511 | Ga0495603_0073531 | 3300046455 | Bacteria | 2008 |
| 512 | Ga0495629_0000140 | 3300046459 | Bacteria | 63496 |
| 513 | Ga0495629_0010438 | 3300046459 | Bacteria | 6756 |
| 514 | Ga0495651_0000078 | 3300046462 | Bacteria | 71749 |
| 515 | Ga0495651_0005725 | 3300046462 | Bacteria | 9471 |
| 516 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 517 | Ga0495653_0001195 | 3300046463 | Bacteria | 20126 |
| 518 | Ga0495580_0017077 | 3300046472 | Bacteria | 5435 |
| 519 | Ga0495639_0002630 | 3300046475 | Bacteria | 7822 |
| 520 | Ga0495639_0214425 | 3300046475 | Bacteria | 945 |
| 521 | Ga0495662_0000522 | 3300046476 | Bacteria | 17560 |
| 522 | Ga0495662_0085402 | 3300046476 | Bacteria | 1537 |
| 523 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 524 | Ga0495664_0009802 | 3300046477 | Bacteria | 5370 |
| 525 | Ga0495584_0035132 | 3300046491 | Bacteria | 2534 |
| 526 | Ga0495584_0062275 | 3300046491 | Bacteria | 1875 |
| 527 | Ga0495584_0136719 | 3300046491 | Bacteria | 1244 |
| 528 | Ga0495585_0002257 | 3300046492 | Bacteria | 13934 |
| 529 | Ga0495607_0063641 | 3300046501 | Bacteria | 2086 |
| 530 | Ga0495608_0000066 | 3300046511 | Bacteria | 81664 |
| 531 | Ga0495608_0018106 | 3300046511 | Bacteria | 4864 |
| 532 | Ga0495618_0000021 | 3300046514 | Bacteria | 129750 |
| 533 | Ga0495618_0026750 | 3300046514 | Bacteria | 3588 |
| 534 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 535 | Ga0495630_0000254 | 3300046517 | Bacteria | 43049 |
| 536 | Ga0495630_0044578 | 3300046517 | Bacteria | 3314 |
| 537 | Ga0495630_0053123 | 3300046517 | Bacteria | 3033 |
| 538 | Ga0495637_0060385 | 3300046520 | Bacteria | 1557 |
| 539 | Ga0495663_0013685 | 3300046525 | Bacteria | 2269 |
| 540 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 541 | Ga0495652_0021598 | 3300046529 | Bacteria | 5720 |
| 542 | Ga0495652_0098567 | 3300046529 | Bacteria | 2375 |
| 543 | Ga0495665_0013635 | 3300046531 | Bacteria | 4393 |
| 544 | Ga0495665_0093956 | 3300046531 | Bacteria | 1575 |
| 545 | Ga0495665_0217787 | 3300046531 | Bacteria | 987 |
| 546 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 547 | Ga0495640_0010546 | 3300046533 | Bacteria | 7131 |
| 548 | Ga0495586_0021471 | 3300046535 | Bacteria | 3442 |
| 549 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 550 | Ga0495645_0000041 | 3300046543 | Bacteria | 92278 |
| 551 | Ga0495645_0117648 | 3300046543 | Bacteria | 1874 |
| 552 | Ga0495622_0006473 | 3300046557 | Bacteria | 5432 |
| 553 | Ga0495622_0126949 | 3300046557 | Bacteria | 1163 |
| 554 | Ga0495633_0128891 | 3300046558 | Bacteria | 1170 |
| 555 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 556 | Ga0495667_0027192 | 3300046559 | Bacteria | 3856 |
| 557 | Ga0495656_0002411 | 3300046615 | Bacteria | 6200 |
| 558 | Ga0495634_0001073 | 3300046642 | Bacteria | 25523 |
| 559 | Ga0495634_0010311 | 3300046642 | Bacteria | 6848 |
| 560 | Ga0495634_0087639 | 3300046642 | Bacteria | 2026 |
| 561 | Ga0495611_0001798 | 3300046648 | Bacteria | 10289 |
| 562 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 563 | Ga0495635_0027867 | 3300046663 | Bacteria | 3928 |
| 564 | Ga0495659_0015536 | 3300046664 | Bacteria | 2504 |
| 565 | Ga0495661_0055503 | 3300046665 | Bacteria | 2374 |
| 566 | Ga0495657_0000047 | 3300046675 | Bacteria | 104362 |
| 567 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 568 | Ga0495599_0085279 | 3300046678 | Bacteria | 1972 |
| 569 | Ga0495623_0000023 | 3300046679 | Bacteria | 96650 |
| 570 | Ga0495623_0135747 | 3300046679 | Bacteria | 1468 |
| 571 | Ga0495646_0000024 | 3300046680 | Bacteria | 107836 |
| 572 | Ga0495646_0085815 | 3300046680 | Bacteria | 1826 |
| 573 | Ga0495647_0024678 | 3300046681 | Bacteria | 2190 |
| 574 | Ga0495647_0032805 | 3300046681 | Bacteria | 1937 |
| 575 | Ga0495658_0000602 | 3300046683 | Bacteria | 19729 |
| 576 | Ga0495658_0165875 | 3300046683 | Bacteria | 1364 |
| 577 | Ga0495613_0009103 | 3300046689 | Bacteria | 7363 |
| 578 | Ga0495613_0058975 | 3300046689 | Bacteria | 2815 |
| 579 | Ga0495613_0069645 | 3300046689 | Bacteria | 2564 |
| 580 | Ga0495624_0091065 | 3300046690 | Bacteria | 1881 |
| 581 | Ga0495600_0000013 | 3300046809 | Bacteria | 119404 |
| 582 | Ga0495600_0003864 | 3300046809 | Bacteria | 8889 |
| 583 | Ga0495600_0022090 | 3300046809 | Bacteria | 4083 |
| 584 | Ga0495581_0049093 | 3300047315 | Bacteria | 2436 |
| 585 | Ga0495581_0051060 | 3300047315 | Bacteria | 2388 |
| 586 | Ga0495581_0051638 | 3300047315 | Bacteria | 2374 |
| 587 | Ga0495581_0067994 | 3300047315 | Bacteria | 2060 |
| 588 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 589 | Ga0495604_0118361 | 3300047317 | Bacteria | 1920 |
| 590 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 591 | Ga0495674_0029383 | 3300047319 | Bacteria | 5006 |
| 592 | Ga0495674_0165306 | 3300047319 | Bacteria | 1849 |
| 593 | Ga0495676_0040351 | 3300047321 | Bacteria | 3852 |
| 594 | Ga0495676_0071724 | 3300047321 | Bacteria | 2662 |
| 595 | Ga0495676_0244698 | 3300047321 | Bacteria | 1226 |
| 596 | Ga0495680_0001670 | 3300047322 | Bacteria | 23595 |
| 597 | Ga0495680_0045981 | 3300047322 | Bacteria | 3444 |
| 598 | Ga0495680_0054664 | 3300047322 | Bacteria | 3099 |
| 599 | Ga0495675_0000014 | 3300047444 | Bacteria | 137646 |
| 600 | Ga0495675_0050645 | 3300047444 | Bacteria | 2639 |
| 601 | Ga0495677_0115177 | 3300047445 | Bacteria | 1023 |
| 602 | Ga0495684_0000027 | 3300047471 | Bacteria | 124367 |
| 603 | Ga0495684_0003742 | 3300047471 | Bacteria | 11861 |
| 604 | Ga0495684_0037841 | 3300047471 | Bacteria | 3701 |
| 605 | Ga0495684_0232585 | 3300047471 | Bacteria | 1347 |
| 606 | Ga0495593_0000253 | 3300047673 | Bacteria | 28885 |
| 607 | Ga0495593_0027098 | 3300047673 | Bacteria | 3157 |
| 608 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 609 | Ga0495602_0091194 | 3300048088 | Bacteria | 2528 |
| 610 | Ga0495614_0024493 | 3300048089 | Bacteria | 2605 |
| 611 | Ga0496100_0001438 | 3300048903 | Bacteria | 11653 |
| 612 | Ga0496100_0022753 | 3300048903 | Bacteria | 3797 |
| 613 | Ga0496100_0025104 | 3300048903 | Bacteria | 3641 |
| 614 | Ga0496100_0037961 | 3300048903 | Bacteria | 3049 |
| 615 | Ga0496101_0001028 | 3300048904 | Bacteria | 16457 |
| 616 | Ga0496101_0048823 | 3300048904 | Bacteria | 3042 |
| 617 | Ga0496102_0002331 | 3300048905 | Bacteria | 16208 |
| 618 | Ga0496102_0024720 | 3300048905 | Bacteria | 5342 |
| 619 | Ga0496103_0008234 | 3300048906 | Bacteria | 6188 |
| 620 | Ga0496103_0012139 | 3300048906 | Bacteria | 5117 |
| 621 | Ga0496103_0023961 | 3300048906 | Bacteria | 3682 |
| 622 | Ga0496104_0082845 | 3300048907 | Bacteria | 3059 |
| 623 | Ga0496104_0101294 | 3300048907 | Bacteria | 2757 |
| 624 | Ga0496105_0001448 | 3300048908 | Bacteria | 16699 |
| 625 | Ga0496105_0010412 | 3300048908 | Bacteria | 7315 |
| 626 | Ga0496105_0117203 | 3300048908 | Bacteria | 2196 |
| 627 | Ga0496105_0125964 | 3300048908 | Bacteria | 2111 |
| 628 | Ga0496106_0006122 | 3300048909 | Bacteria | 8899 |
| 629 | Ga0496106_0049085 | 3300048909 | Bacteria | 3179 |
| 630 | Ga0496106_0164915 | 3300048909 | Bacteria | 1753 |
| 631 | Ga0496106_0198288 | 3300048909 | Bacteria | 1597 |
| 632 | Ga0496107_0000338 | 3300048910 | Bacteria | 25395 |
| 633 | Ga0496107_0013441 | 3300048910 | Bacteria | 5721 |
| 634 | Ga0496107_0022527 | 3300048910 | Bacteria | 4452 |
| 635 | Ga0496107_0155608 | 3300048910 | Bacteria | 1692 |
| 636 | Ga0496108_0007499 | 3300048911 | Bacteria | 8844 |
| 637 | Ga0496108_0030031 | 3300048911 | Bacteria | 4505 |
| 638 | Ga0496108_0040592 | 3300048911 | Bacteria | 3881 |
| 639 | Ga0496108_0051504 | 3300048911 | Bacteria | 3449 |
| 640 | Ga0496108_0078759 | 3300048911 | Bacteria | 2790 |
| 641 | Ga0496108_0501088 | 3300048911 | Bacteria | 1060 |
| 642 | Ga0496109_0012676 | 3300048912 | Bacteria | 7285 |
| 643 | Ga0496109_0013537 | 3300048912 | Bacteria | 7081 |
| 644 | Ga0496109_0015251 | 3300048912 | Bacteria | 6690 |
| 645 | Ga0496109_0367280 | 3300048912 | Unclassified | 1359 |
| 646 | Ga0496110_0067643 | 3300048913 | Bacteria | 3161 |
| 647 | Ga0496110_0179869 | 3300048913 | Bacteria | 1920 |
| 648 | Ga0496110_0538510 | 3300048913 | Bacteria | 1061 |
| 649 | Ga0496111_0090277 | 3300048914 | Bacteria | 2245 |
| 650 | Ga0496111_0272115 | 3300048914 | Bacteria | 1256 |
| 651 | Ga0496112_0009699 | 3300048915 | Bacteria | 8691 |
| 652 | Ga0496112_0201864 | 3300048915 | Bacteria | 1947 |
| 653 | Ga0496112_0238200 | 3300048915 | Bacteria | 1773 |
| 654 | Ga0496112_0599583 | 3300048915 | Bacteria | 1033 |
| 655 | Ga0496113_0002225 | 3300048916 | Bacteria | 11196 |
| 656 | Ga0496113_0022009 | 3300048916 | Bacteria | 4503 |
| 657 | Ga0496113_0034579 | 3300048916 | Bacteria | 3688 |
| 658 | Ga0496113_0066585 | 3300048916 | Bacteria | 2728 |
| 659 | Ga0496113_0198052 | 3300048916 | Bacteria | 1596 |
| 660 | Ga0496114_0002900 | 3300048917 | Bacteria | 13140 |
| 661 | Ga0496114_0031113 | 3300048917 | Bacteria | 4390 |
| 662 | Ga0496114_0052118 | 3300048917 | Bacteria | 3408 |
| 663 | Ga0496114_0142494 | 3300048917 | Bacteria | 2076 |
| 664 | Ga0496115_0002388 | 3300048918 | Bacteria | 13461 |
| 665 | Ga0496115_0012838 | 3300048918 | Bacteria | 6316 |
| 666 | Ga0496115_0016818 | 3300048918 | Bacteria | 5576 |
| 667 | Ga0496115_0093287 | 3300048918 | Bacteria | 2461 |
| 668 | Ga0501032_0020708 | 3300049569 | Bacteria | 4578 |
| 669 | Ga0501032_0021514 | 3300049569 | Bacteria | 4482 |
| 670 | Ga0501033_0043473 | 3300049570 | Bacteria | 3346 |
| 671 | Ga0501033_0075931 | 3300049570 | Bacteria | 2466 |
| 672 | Ga0501034_0000439 | 3300049571 | Bacteria | 68932 |
| 673 | Ga0501034_0000810 | 3300049571 | Bacteria | 46526 |
| 674 | Ga0501034_0014998 | 3300049571 | Bacteria | 7971 |
| 675 | Ga0501034_0029054 | 3300049571 | Bacteria | 5621 |
| 676 | Ga0501034_0084171 | 3300049571 | Bacteria | 3182 |
| 677 | Ga0501034_0084856 | 3300049571 | Bacteria | 3168 |
| 678 | Ga0501034_0085960 | 3300049571 | Bacteria | 3146 |
| 679 | Ga0501034_0162196 | 3300049571 | Bacteria | 2206 |
| 680 | Ga0501034_0321792 | 3300049571 | Bacteria | 1479 |
| 681 | Ga0501036_0005548 | 3300049572 | Bacteria | 10230 |
| 682 | Ga0501036_0057010 | 3300049572 | Bacteria | 3309 |
| 683 | Ga0501036_0214100 | 3300049572 | Bacteria | 1618 |
| 684 | Ga0501036_0248059 | 3300049572 | Bacteria | 1492 |
| 685 | Ga0501037_0004371 | 3300049573 | Bacteria | 10260 |
| 686 | Ga0501037_0008008 | 3300049573 | Bacteria | 7742 |
| 687 | Ga0501037_0043089 | 3300049573 | Bacteria | 3316 |
| 688 | Ga0501037_0055560 | 3300049573 | Bacteria | 2894 |
| 689 | Ga0501038_0068526 | 3300049574 | Bacteria | 3015 |
| 690 | Ga0501038_0144624 | 3300049574 | Bacteria | 1942 |
| 691 | Ga0501038_0156468 | 3300049574 | Bacteria | 1855 |
| 692 | Ga0501038_0226321 | 3300049574 | Bacteria | 1490 |
| 693 | Ga0501039_0025664 | 3300049575 | Bacteria | 4529 |
| 694 | Ga0501039_0083513 | 3300049575 | Bacteria | 2487 |
| 695 | Ga0501043_0010261 | 3300049579 | Bacteria | 7339 |
| 696 | Ga0501043_0028689 | 3300049579 | Bacteria | 4368 |
| 697 | Ga0501043_0076117 | 3300049579 | Bacteria | 2636 |
| 698 | Ga0501043_0212660 | 3300049579 | Bacteria | 1498 |
| 699 | Ga0501043_0245281 | 3300049579 | Bacteria | 1381 |
| 700 | Ga0501046_0144407 | 3300049580 | Bacteria | 1798 |
| 701 | Ga0501046_0173526 | 3300049580 | Bacteria | 1616 |
| 702 | Ga0501047_0000073 | 3300049581 | Bacteria | 125990 |
| 703 | Ga0501047_0030765 | 3300049581 | Bacteria | 5174 |
| 704 | Ga0501047_0169779 | 3300049581 | Bacteria | 2050 |
| 705 | Ga0501047_0301254 | 3300049581 | Bacteria | 1445 |
| 706 | Ga0501048_0000391 | 3300049582 | Bacteria | 30448 |
| 707 | Ga0501048_0107868 | 3300049582 | Bacteria | 1966 |
| 708 | Ga0501048_0166733 | 3300049582 | Bacteria | 1560 |
| 709 | Ga0501067_0018876 | 3300049583 | Bacteria | 3815 |
| 710 | Ga0501067_0026794 | 3300049583 | Bacteria | 3192 |
| 711 | Ga0501067_0062154 | 3300049583 | Bacteria | 2067 |
| 712 | Ga0501068_0028094 | 3300049584 | Bacteria | 3324 |
| 713 | Ga0501069_0074898 | 3300049585 | Bacteria | 1900 |
| 714 | Ga0501069_0080778 | 3300049585 | Bacteria | 1831 |
| 715 | Ga0501070_0036364 | 3300049586 | Bacteria | 4112 |
| 716 | Ga0501070_0070884 | 3300049586 | Bacteria | 2885 |
| 717 | Ga0501070_0099219 | 3300049586 | Bacteria | 2409 |
| 718 | Ga0501070_0107418 | 3300049586 | Bacteria | 2306 |
| 719 | Ga0501070_0121305 | 3300049586 | Bacteria | 2160 |
| 720 | Ga0501070_0193618 | 3300049586 | Bacteria | 1670 |
| 721 | Ga0501070_0236972 | 3300049586 | Bacteria | 1494 |
| 722 | Ga0501071_0187505 | 3300049587 | Bacteria | 1550 |
| 723 | Ga0501072_0007381 | 3300049588 | Bacteria | 8340 |
| 724 | Ga0501072_0028692 | 3300049588 | Bacteria | 4344 |
| 725 | Ga0501072_0365318 | 3300049588 | Bacteria | 1145 |
| 726 | Ga0501073_0010362 | 3300049589 | Bacteria | 6838 |
| 727 | Ga0501073_0041506 | 3300049589 | Bacteria | 3251 |
| 728 | Ga0501073_0047948 | 3300049589 | Bacteria | 3000 |
| 729 | Ga0501073_0078028 | 3300049589 | Bacteria | 2304 |
| 730 | Ga0501073_0133542 | 3300049589 | Bacteria | 1720 |
| 731 | Ga0501073_0256425 | 3300049589 | Bacteria | 1207 |
| 732 | Ga0501074_0037466 | 3300049590 | Bacteria | 3515 |
| 733 | Ga0501074_0074614 | 3300049590 | Bacteria | 2435 |
| 734 | Ga0501074_0100751 | 3300049590 | Bacteria | 2067 |
| 735 | Ga0501079_0036026 | 3300049741 | Bacteria | 3810 |
| 736 | Ga0501080_0006835 | 3300049742 | Bacteria | 10289 |
| 737 | Ga0501080_0029315 | 3300049742 | Bacteria | 5122 |
| 738 | Ga0501080_0090041 | 3300049742 | Bacteria | 2850 |
| 739 | Ga0501080_0131989 | 3300049742 | Bacteria | 2312 |
| 740 | Ga0501080_0160220 | 3300049742 | Bacteria | 2078 |
| 741 | Ga0501080_0218525 | 3300049742 | Bacteria | 1744 |
| 742 | Ga0501083_0000139 | 3300049744 | Bacteria | 49384 |
| 743 | Ga0501083_0055944 | 3300049744 | Bacteria | 2644 |
| 744 | Ga0501083_0110965 | 3300049744 | Bacteria | 1803 |
| 745 | Ga0501083_0132895 | 3300049744 | Bacteria | 1631 |
| 746 | Ga0501035_0001020 | 3300049822 | Bacteria | 29508 |
| 747 | Ga0501035_0092572 | 3300049822 | Bacteria | 2660 |
| 748 | Ga0501035_0096114 | 3300049822 | Bacteria | 2603 |
| 749 | Ga0501035_0111324 | 3300049822 | Bacteria | 2399 |
| 750 | Ga0501035_0412901 | 3300049822 | Bacteria | 1121 |
| 751 | Ga0501044_0005518 | 3300049823 | Bacteria | 14043 |
| 752 | Ga0501044_0037733 | 3300049823 | Bacteria | 5049 |
| 753 | Ga0501044_0267967 | 3300049823 | Bacteria | 1644 |
| 754 | Ga0501045_0077542 | 3300049824 | Bacteria | 2449 |
| 755 | Ga0501045_0078420 | 3300049824 | Bacteria | 2435 |
| 756 | nmdc:mga05p37_129606_c1 | 3300050507 | Bacteria | 3095 |
| 757 | nmdc:mga05p37_15207_c1 | 3300050507 | Bacteria | 9243 |
| 758 | nmdc:mga05p37_18481_c1 | 3300050507 | Bacteria | 8421 |
| 759 | nmdc:mga05p37_235544_c1 | 3300050507 | Bacteria | 2204 |
| 760 | nmdc:mga05p37_53778_c1 | 3300050507 | Bacteria | 4952 |
| 761 | nmdc:mga05p37_79680_c1 | 3300050507 | Bacteria | 4033 |
| 762 | nmdc:mga09592_355495_c1 | 3300050508 | Bacteria | 1268 |
| 763 | nmdc:mga09592_48564_c1 | 3300050508 | Bacteria | 3578 |
| 764 | nmdc:mga09592_5221_c1 | 3300050508 | Bacteria | 10552 |
| 765 | nmdc:mga0qj67_33781_c1 | 3300050509 | Bacteria | 3993 |
| 766 | nmdc:mga0qj67_347350_c1 | 3300050509 | Bacteria | 1200 |
| 767 | nmdc:mga0qj67_5138_c1 | 3300050509 | Bacteria | 9536 |
| 768 | nmdc:mga06r32_163736_c1 | 3300050510 | Bacteria | 2207 |
| 769 | nmdc:mga06r32_1670_c1 | 3300050510 | Bacteria | 20024 |
| 770 | nmdc:mga06r32_85486_c1 | 3300050510 | Bacteria | 3076 |
| 771 | nmdc:mga08y16_15015_c1 | 3300050511 | Bacteria | 8147 |
| 772 | nmdc:mga08y16_20578_c1 | 3300050511 | Bacteria | 6965 |
| 773 | nmdc:mga08y16_643734_c1 | 3300050511 | Bacteria | 1065 |
| 774 | nmdc:mga08y16_6877_c1 | 3300050511 | Bacteria | 11928 |
| 775 | nmdc:mga0n895_107079_c1 | 3300050512 | Bacteria | 2809 |
| 776 | nmdc:mga0n895_1271_c1 | 3300050512 | Bacteria | 18631 |
| 777 | nmdc:mga0n895_12797_c1 | 3300050512 | Bacteria | 7536 |
| 778 | nmdc:mga0n895_148321_c1 | 3300050512 | Bacteria | 2375 |
| 779 | nmdc:mga0n895_29981_c1 | 3300050512 | Bacteria | 5194 |
| 780 | nmdc:mga0n895_482666_c1 | 3300050512 | Bacteria | 1250 |
| 781 | nmdc:mga0n895_515895_c1 | 3300050512 | Unclassified | 1203 |
| 782 | nmdc:mga0n895_92515_c1 | 3300050512 | Bacteria | 3027 |
| 783 | nmdc:mga0n895_9812_c1 | 3300050512 | Bacteria | 8413 |
| 784 | nmdc:mga0rr50_39133_c1 | 3300050513 | Bacteria | 3438 |
| 785 | nmdc:mga0rr50_5080_c1 | 3300050513 | Bacteria | 7805 |
| 786 | nmdc:mga0rr50_70636_c1 | 3300050513 | Bacteria | 2661 |
| 787 | nmdc:mga08x19_197067_c1 | 3300050514 | Bacteria | 1379 |
| 788 | nmdc:mga08x19_81078_c1 | 3300050514 | Bacteria | 2130 |
| 789 | nmdc:mga0a205_16609_c1 | 3300050515 | Bacteria | 6894 |
| 790 | nmdc:mga0a205_419881_c1 | 3300050515 | Bacteria | 1200 |
| 791 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 792 | Ga0495601_0031224 | 3300053077 | Bacteria | 3310 |
| 793 | Ga0495601_0048428 | 3300053077 | Bacteria | 2676 |
| 794 | Ga0495601_0054932 | 3300053077 | Bacteria | 2520 |
| 795 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 796 | Ga0495612_0005181 | 3300053078 | Bacteria | 5386 |
| 797 | Ga0495612_0038945 | 3300053078 | Bacteria | 1932 |
| 798 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 799 | Ga0495595_0002169 | 3300053084 | Bacteria | 7628 |
| 800 | Ga0495619_0000011 | 3300053085 | Bacteria | 287128 |
| 801 | Ga0495619_0000384 | 3300053085 | Bacteria | 30338 |
| 802 | Ga0495619_0012696 | 3300053085 | Bacteria | 5302 |
| 803 | Ga0500566_0142359 | 3300053094 | Bacteria | 1271 |
| 804 | Ga0500652_000006 | 3300053131 | Bacteria | 167437 |
| 805 | Ga0500616_0037070 | 3300053153 | Bacteria | 2641 |
| 806 | Ga0500616_0040910 | 3300053153 | Bacteria | 2490 |
| 807 | Ga0501084_0143159 | 3300054114 | Bacteria | 2013 |
| 808 | Ga0501084_0301680 | 3300054114 | Bacteria | 1353 |
| 809 | Ga0501084_0394778 | 3300054114 | Bacteria | 1169 |
| 810 | Ga0501082_0041891 | 3300060353 | Bacteria | 3948 |
| 811 | Ga0501082_0050070 | 3300060353 | Bacteria | 3602 |
| 812 | Ga0501082_0350369 | 3300060353 | Bacteria | 1287 |
| 813 | Ga0466962_0097220 | 3300061719 | Bacteria | 1412 |
| 814 | Ga0530510_0225736 | 3300061734 | Bacteria | 1393 |
| 815 | Ga0501074_0013395 | |||
| 816 | 2214884090 | |||
| 817 | ARSoilYngRDRAFT_c00124 | |||
| 818 | ARcpr5yngRDRAFT_c000127 | |||
| 819 | ARSoilOldRDRAFT_c000125 | |||
| 820 | ARCol0yngRDRAFT_1000457 | |||
| 821 | JGI24032J14994_100889 | |||
| 822 | JGI24746J21847_1003010 | |||
| 823 | JGI24739J22299_10000496 | |||
| 824 | JGI24739J22299_10025357 | |||
| 825 | JGI24737J22298_10000886 | |||
| 826 | JGI24750J21931_1001502 | |||
| 827 | JGI24745J21846_1002381 | |||
| 828 | JGI24738J21930_10009478 | |||
| 829 | JGI24749J21850_1001896 | |||
| 830 | JGI24035J26624_1006618 | |||
| 831 | JGI24034J26672_10009416 | |||
| 832 | JGI24742J22300_10000526 | |||
| 833 | JGI25404J52841_10002280 | |||
| 834 | JGI25405J52794_10003226 | |||
| 835 | Ga0065717_1002697 | |||
| 836 | Ga0065716_1001902 | |||
| 837 | Ga0065704_10146850 | |||
| 838 | Ga0065712_10088653 | |||
| 839 | Ga0065715_10095851 | |||
| 840 | Ga0065715_10103296 | |||
| 841 | Ga0070658_10004719 | |||
| 842 | Ga0070676_10003793 | |||
| 843 | Ga0070683_100000419 | |||
| 844 | Ga0070683_100080648 | |||
| 845 | Ga0070683_100112482 | |||
| 846 | Ga0070683_100306447 | |||
| 847 | Ga0070690_100040215 | |||
| 848 | Ga0070690_100176812 | |||
| 849 | Ga0070670_100004223 | |||
| 850 | Ga0070670_100151986 | |||
| 851 | Ga0070677_10000623 | |||
| 852 | Ga0068869_100001088 | |||
| 853 | Ga0070666_10005030 | |||
| 854 | Ga0070680_100003470 | |||
| 855 | Ga0070680_100013953 | |||
| 856 | Ga0070680_100200094 | |||
| 857 | Ga0070680_100350779 | |||
| 858 | Ga0070682_100003573 | |||
| 859 | Ga0068868_100004854 | |||
| 860 | Ga0070660_100001074 | |||
| 861 | Ga0070660_100001863 | |||
| 862 | Ga0070660_100215838 | |||
| 863 | Ga0070689_100010277 | |||
| 864 | Ga0070689_100049301 | |||
| 865 | Ga0070689_100108844 | |||
| 866 | Ga0070689_100372045 | |||
| 867 | Ga0070691_10101810 | |||
| 868 | Ga0070687_100001557 | |||
| 869 | Ga0070661_100000894 | |||
| 870 | Ga0070668_100063434 | |||
| 871 | Ga0070668_100273659 | |||
| 872 | Ga0070669_100003330 | |||
| 873 | Ga0070669_100234799 | |||
| 874 | Ga0070675_100006928 | |||
| 875 | Ga0070671_100226112 | |||
| 876 | Ga0070674_100001693 | |||
| 877 | Ga0070673_100001300 | |||
| 878 | Ga0070688_100000384 | |||
| 879 | Ga0070688_100056498 | |||
| 880 | Ga0070659_100003102 | |||
| 881 | Ga0070659_100046844 | |||
| 882 | Ga0070667_100011097 | |||
| 883 | Ga0070667_100069921 | |||
| 884 | Ga0070667_100188414 | |||
| 885 | Ga0070703_10038998 | |||
| 886 | Ga0070709_10013109 | |||
| 887 | Ga0070709_10020886 | |||
| 888 | Ga0070714_100046839 | |||
| 889 | Ga0070714_100252961 | |||
| 890 | Ga0070714_100548327 | |||
| 891 | Ga0070713_100003935 | |||
| 892 | Ga0070713_100006430 | |||
| 893 | Ga0070710_10006745 | |||
| 894 | Ga0070701_10000053 | |||
| 895 | Ga0070711_100044157 | |||
| 896 | Ga0070711_100074528 | |||
| 897 | Ga0070711_100188635 | |||
| 898 | Ga0070705_100025013 | |||
| 899 | Ga0070700_100000995 | |||
| 900 | Ga0070694_100004798 | |||
| 901 | Ga0070694_100500789 | |||
| 902 | Ga0070708_100142584 | |||
| 903 | Ga0070708_100335278 | |||
| 904 | Ga0070663_100005062 | |||
| 905 | Ga0070663_100083500 | |||
| 906 | Ga0070663_100190608 | |||
| 907 | Ga0070663_100218673 | |||
| 908 | Ga0070678_100011901 | |||
| 909 | Ga0070678_100089594 | |||
| 910 | Ga0070662_100001392 | |||
| 911 | Ga0070662_100167618 | |||
| 912 | Ga0070681_10010566 | |||
| 913 | Ga0070681_10157101 | |||
| 914 | Ga0068867_100007589 | |||
| 915 | Ga0068867_100088580 | |||
| 916 | Ga0070685_10001493 | |||
| 917 | Ga0070706_100004167 | |||
| 918 | Ga0070707_100449188 | |||
| 919 | Ga0070698_100339980 | |||
| 920 | Ga0070699_100000829 | |||
| 921 | Ga0070679_100021813 | |||
| 922 | Ga0070679_100062401 | |||
| 923 | Ga0070679_100236204 | |||
| 924 | Ga0070679_100642765 | |||
| 925 | Ga0070684_100001048 | |||
| 926 | Ga0070684_100294099 | |||
| 927 | Ga0068853_100000976 | |||
| 928 | Ga0070672_100000458 | |||
| 929 | Ga0070686_100001811 | |||
| 930 | Ga0070695_100000550 | |||
| 931 | Ga0070696_100055945 | |||
| 932 | Ga0070696_100115324 | |||
| 933 | Ga0070696_100159818 | |||
| 934 | Ga0070696_100198223 | |||
| 935 | Ga0070693_100040580 | |||
| 936 | Ga0070665_100077915 | |||
| 937 | Ga0070665_100202705 | |||
| 938 | Ga0070704_100007431 | |||
| 939 | Ga0070704_100099683 | |||
| 940 | Ga0070704_100522181 | |||
| 941 | Ga0068855_100005184 | |||
| 942 | Ga0068855_100015368 | |||
| 943 | Ga0068855_100581964 | |||
| 944 | Ga0070664_100001280 | |||
| 945 | Ga0070664_100032243 | |||
| 946 | Ga0070664_100128279 | |||
| 947 | Ga0070664_100581263 | |||
| 948 | Ga0068857_100000630 | |||
| 949 | Ga0068854_100000802 | |||
| 950 | Ga0068856_100001005 | |||
| 951 | Ga0068856_100130400 | |||
| 952 | Ga0070702_100004228 | |||
| 953 | Ga0068852_100060331 | |||
| 954 | Ga0068852_100129000 | |||
| 955 | Ga0068852_100195391 | |||
| 956 | Ga0068859_100251889 | |||
| 957 | Ga0068864_100000140 | |||
| 958 | Ga0068864_100204338 | |||
| 959 | Ga0068861_100001121 | |||
| 960 | Ga0068863_100000425 | |||
| 961 | Ga0068863_100133417 | |||
| 962 | Ga0068863_100190754 | |||
| 963 | Ga0068863_100484232 | |||
| 964 | Ga0068858_100004894 | |||
| 965 | Ga0068858_100043093 | |||
| 966 | Ga0068858_100065262 | |||
| 967 | Ga0068858_100145563 | |||
| 968 | Ga0068860_100002221 | |||
| 969 | Ga0068860_100832392 | |||
| 970 | Ga0068862_100001418 | |||
| 971 | Ga0081455_10000091 | |||
| 972 | Ga0081455_10006350 | |||
| 973 | Ga0081455_10007779 | |||
| 974 | Ga0081455_10057711 | |||
| 975 | Ga0081540_1000068 | |||
| 976 | Ga0081540_1011418 | |||
| 977 | Ga0081540_1050880 | |||
| 978 | Ga0070717_10003725 | |||
| 979 | Ga0070717_10041544 | |||
| 980 | Ga0075365_10144773 | |||
| 981 | Ga0070715_10002493 | |||
| 982 | Ga0070716_100010029 | |||
| 983 | Ga0070712_100100082 | |||
| 984 | Ga0075369_10006378 | |||
| 985 | Ga0075427_10001272 | |||
| 986 | Ga0097621_100001542 | |||
| 987 | Ga0097621_100006138 | |||
| 988 | Ga0097621_100055513 | |||
| 989 | Ga0097621_100207309 | |||
| 990 | Ga0068871_100000938 | |||
| 991 | Ga0068871_100057854 | |||
| 992 | Ga0068871_100069536 | |||
| 993 | Ga0075428_100144863 | |||
| 994 | Ga0075430_100017069 | |||
| 995 | Ga0075430_100018342 | |||
| 996 | Ga0075430_100132135 | |||
| 997 | Ga0075431_100014631 | |||
| 998 | Ga0075431_100024210 | |||
| 999 | Ga0075431_100121078 | |||
| 1000 | Ga0075431_100216345 | |||
| 1001 | Ga0075431_100235803 | |||
| 1002 | Ga0075433_10110347 | |||
| 1003 | Ga0075433_10181970 | |||
| 1004 | Ga0075434_100008958 | |||
| 1005 | Ga0075434_100016992 | |||
| 1006 | Ga0075434_100082865 | |||
| 1007 | Ga0075434_100178784 | |||
| 1008 | Ga0075434_100253886 | |||
| 1009 | Ga0075434_100402587 | |||
| 1010 | Ga0068865_100002772 | |||
| 1011 | Ga0075436_100021379 | |||
| 1012 | Ga0097620_100251864 | |||
| 1013 | Ga0075435_100011643 | |||
| 1014 | Ga0075435_100049443 | |||
| 1015 | Ga0075435_100141600 | |||
| 1016 | Ga0075435_100157945 | |||
| 1017 | Ga0099794_10010006 | |||
| 1018 | Ga0105244_10079447 | |||
| 1019 | Ga0105240_10410677 | |||
| 1020 | Ga0111539_10013242 | |||
| 1021 | Ga0111539_10068122 | |||
| 1022 | Ga0111539_10132394 | |||
| 1023 | Ga0111539_10148458 | |||
| 1024 | Ga0111539_10938521 | |||
| 1025 | Ga0105245_10004587 | |||
| 1026 | Ga0105245_10007019 | |||
| 1027 | Ga0105245_10014701 | |||
| 1028 | Ga0105247_10007542 | |||
| 1029 | Ga0105247_10013219 | |||
| 1030 | Ga0114129_10018126 | |||
| 1031 | Ga0114129_10045452 | |||
| 1032 | Ga0114129_10111386 | |||
| 1033 | Ga0114129_10199475 | |||
| 1034 | Ga0105243_10014317 | |||
| 1035 | Ga0105242_10002741 | |||
| 1036 | Ga0105242_10065486 | |||
| 1037 | Ga0105242_10374314 | |||
| 1038 | Ga0105248_10008864 | |||
| 1039 | Ga0105248_10047096 | |||
| 1040 | Ga0105248_10053904 | |||
| 1041 | Ga0105248_10113465 | |||
| 1042 | Ga0105237_10103613 | |||
| 1043 | Ga0105237_10128242 | |||
| 1044 | Ga0105238_10124446 | |||
| 1045 | Ga0105238_10126675 | |||
| 1046 | Ga0105249_10014469 | |||
| 1047 | Ga0099796_10001585 | |||
| 1048 | Ga0105239_10193263 | |||
| 1049 | Ga0105246_10000599 | |||
| 1050 | Ga0157336_1000226 | |||
| 1051 | Ga0157371_10027149 | |||
| 1052 | Ga0157371_10181661 | |||
| 1053 | Ga0157370_10365303 | |||
| 1054 | Ga0157369_10364446 | |||
| 1055 | Ga0157374_10090125 | |||
| 1056 | Ga0157374_10277257 | |||
| 1057 | Ga0157378_10268385 | |||
| 1058 | Ga0163162_10022422 | |||
| 1059 | Ga0163162_10029973 | |||
| 1060 | Ga0163162_10241226 | |||
| 1061 | Ga0163162_10349766 | |||
| 1062 | Ga0163162_10605011 | |||
| 1063 | Ga0157372_10081649 | |||
| 1064 | Ga0157375_10001131 | |||
| 1065 | Ga0157375_10002488 | |||
| 1066 | Ga0163163_10019116 | |||
| 1067 | Ga0163163_10022743 | |||
| 1068 | Ga0163163_10158680 | |||
| 1069 | Ga0157380_10000894 | |||
| 1070 | Ga0157380_10217025 | |||
| 1071 | Ga0157377_10000696 | |||
| 1072 | Ga0157377_10090537 | |||
| 1073 | Ga0157379_10005316 | |||
| 1074 | Ga0157379_10062283 | |||
| 1075 | Ga0157376_10008132 | |||
| 1076 | Ga0157376_10224250 | |||
| 1077 | Ga0157376_10225265 | |||
| 1078 | Ga0163161_10010626 | |||
| 1079 | Ga0213876_10038132 | |||
| 1080 | Ga0207666_1000052 | |||
| 1081 | Ga0207697_10000169 | |||
| 1082 | Ga0207655_1076877 | |||
| 1083 | Ga0207653_10001090 | |||
| 1084 | Ga0207682_10000859 | |||
| 1085 | Ga0207692_10035165 | |||
| 1086 | Ga0207692_10081781 | |||
| 1087 | Ga0207642_10001773 | |||
| 1088 | Ga0207688_10000024 | |||
| 1089 | Ga0207680_10002348 | |||
| 1090 | Ga0207699_10001996 | |||
| 1091 | Ga0207699_10171286 | |||
| 1092 | Ga0207699_10236634 | |||
| 1093 | Ga0207645_10000538 | |||
| 1094 | Ga0207643_10000035 | |||
| 1095 | Ga0207684_10003395 | |||
| 1096 | Ga0207707_10032345 | |||
| 1097 | Ga0207707_10072923 | |||
| 1098 | Ga0207707_10091109 | |||
| 1099 | Ga0207695_10068916 | |||
| 1100 | Ga0207671_10007789 | |||
| 1101 | Ga0207671_10078469 | |||
| 1102 | Ga0207671_10107971 | |||
| 1103 | Ga0207693_10003819 | |||
| 1104 | Ga0207693_10014157 | |||
| 1105 | Ga0207693_10038334 | |||
| 1106 | Ga0207663_10007219 | |||
| 1107 | Ga0207663_10018925 | |||
| 1108 | Ga0207663_10033317 | |||
| 1109 | Ga0207663_10235025 | |||
| 1110 | Ga0207663_10467073 | |||
| 1111 | Ga0207660_10002466 | |||
| 1112 | Ga0207660_10009921 | |||
| 1113 | Ga0207662_10001196 | |||
| 1114 | Ga0207662_10028942 | |||
| 1115 | Ga0207657_10003229 | |||
| 1116 | Ga0207657_10005139 | |||
| 1117 | Ga0207657_10031263 | |||
| 1118 | Ga0207649_10000412 | |||
| 1119 | Ga0207649_10081125 | |||
| 1120 | Ga0207652_10021544 | |||
| 1121 | Ga0207652_10207941 | |||
| 1122 | Ga0207646_10371971 | |||
| 1123 | Ga0207681_10000553 | |||
| 1124 | Ga0207681_10490773 | |||
| 1125 | Ga0207694_10009714 | |||
| 1126 | Ga0207694_10090437 | |||
| 1127 | Ga0207694_10526840 | |||
| 1128 | Ga0207650_10005710 | |||
| 1129 | Ga0207659_10000091 | |||
| 1130 | Ga0207687_10000161 | |||
| 1131 | Ga0207687_10010301 | |||
| 1132 | Ga0207700_10005167 | |||
| 1133 | Ga0207700_10052187 | |||
| 1134 | Ga0207700_10264082 | |||
| 1135 | Ga0207700_10475458 | |||
| 1136 | Ga0207664_10067292 | |||
| 1137 | Ga0207664_10465830 | |||
| 1138 | Ga0207644_10002790 | |||
| 1139 | Ga0207644_10011541 | |||
| 1140 | Ga0207690_10002912 | |||
| 1141 | Ga0207690_10024199 | |||
| 1142 | Ga0207690_10125811 | |||
| 1143 | Ga0207706_10027574 | |||
| 1144 | Ga0207706_10068037 | |||
| 1145 | Ga0207686_10001075 | |||
| 1146 | Ga0207686_10008756 | |||
| 1147 | Ga0207686_10122799 | |||
| 1148 | Ga0207709_10000575 | |||
| 1149 | Ga0207670_10000182 | |||
| 1150 | Ga0207669_10000082 | |||
| 1151 | Ga0207704_10000604 | |||
| 1152 | Ga0207704_10120109 | |||
| 1153 | Ga0207665_10004294 | |||
| 1154 | Ga0207665_10006035 | |||
| 1155 | Ga0207665_10336138 | |||
| 1156 | Ga0207691_10000336 | |||
| 1157 | Ga0207691_10127418 | |||
| 1158 | Ga0207711_10012924 | |||
| 1159 | Ga0207711_10015124 | |||
| 1160 | Ga0207711_10281434 | |||
| 1161 | Ga0207689_10002022 | |||
| 1162 | Ga0207661_10001715 | |||
| 1163 | Ga0207661_10059660 | |||
| 1164 | Ga0207679_10000035 | |||
| 1165 | Ga0207679_10034926 | |||
| 1166 | Ga0207679_10125845 | |||
| 1167 | Ga0207679_10536679 | |||
| 1168 | Ga0207667_10008094 | |||
| 1169 | Ga0207667_10025683 | |||
| 1170 | Ga0207667_10099832 | |||
| 1171 | Ga0207667_10515412 | |||
| 1172 | Ga0207651_10002513 | |||
| 1173 | Ga0207712_10000429 | |||
| 1174 | Ga0207712_10073978 | |||
| 1175 | Ga0207668_10000149 | |||
| 1176 | Ga0207668_10500743 | |||
| 1177 | Ga0207640_10008008 | |||
| 1178 | Ga0207640_10035961 | |||
| 1179 | Ga0207658_10003056 | |||
| 1180 | Ga0207658_10056414 | |||
| 1181 | Ga0207658_10105228 | |||
| 1182 | Ga0207658_10130044 | |||
| 1183 | Ga0207677_10003478 | |||
| 1184 | Ga0207703_10004085 | |||
| 1185 | Ga0207703_10236497 | |||
| 1186 | Ga0207703_10391373 | |||
| 1187 | Ga0207639_10002878 | |||
| 1188 | Ga0207678_10001400 | |||
| 1189 | Ga0207678_10012249 | |||
| 1190 | Ga0207678_10099921 | |||
| 1191 | Ga0207708_10000896 | |||
| 1192 | Ga0207702_10002760 | |||
| 1193 | Ga0207641_10008796 | |||
| 1194 | Ga0207641_10050146 | |||
| 1195 | Ga0207641_10088031 | |||
| 1196 | Ga0207648_10008471 | |||
| 1197 | Ga0207648_10056972 | |||
| 1198 | Ga0207648_10261405 | |||
| 1199 | Ga0207676_10000979 | |||
| 1200 | Ga0207676_10159117 | |||
| 1201 | Ga0207674_10006130 | |||
| 1202 | Ga0207674_10151601 | |||
| 1203 | Ga0207675_100001667 | |||
| 1204 | Ga0207675_100118496 | |||
| 1205 | Ga0207675_100533160 | |||
| 1206 | Ga0207683_10000457 | |||
| 1207 | Ga0207683_10006130 | |||
| 1208 | Ga0207683_10013806 | |||
| 1209 | Ga0207698_10149178 | |||
| 1210 | Ga0209984_1004399 | |||
| 1211 | Ga0209179_1022594 | |||
| 1212 | Ga0209588_1014590 | |||
| 1213 | Ga0209971_1004021 | |||
| 1214 | Ga0209966_1000836 | |||
| 1215 | Ga0209974_10003856 | |||
| 1216 | Ga0207428_10000075 | |||
| 1217 | Ga0207428_10001163 | |||
| 1218 | Ga0207428_10002495 | |||
| 1219 | Ga0268266_10116185 | |||
| 1220 | Ga0268266_10240167 | |||
| 1221 | Ga0268265_10001635 | |||
| 1222 | Ga0268264_10000813 | |||
| 1223 | Ga0268264_10089113 | |||
| 1224 | Ga0265342_10001792 | |||
| 1225 | Ga0373930_0009915 | |||
| 1226 | Ga0373930_0010916 | |||
| 1227 | Ga0373948_0000943 | |||
| 1228 | Ga0373959_0008280 | |||
| 1229 | Ga0373938_0000151 | |||
| 1230 | Ga0373929_0000167 | |||
| 1231 | Ga0373929_0006898 | |||
| 1232 | Ga0373929_0013103 | |||
| 1233 | Ga0373934_0008237 | |||
| 1234 | Ga0373940_0013026 | |||
| 1235 | Ga0373940_0016673 | |||
| 1236 | Ga0373944_0011315 | |||
| 1237 | Ga0373944_0018674 | |||
| 1238 | Ga0373949_0002205 | |||
| 1239 | Ga0373951_0001108 | |||
| 1240 | Ga0373952_0005537 | |||
| 1241 | Ga0373923_0003873 | |||
| 1242 | Ga0373923_0009787 | |||
| 1243 | Ga0373932_0001743 | |||
| 1244 | Ga0373936_0000458 | |||
| 1245 | Ga0373936_0003274 | |||
| 1246 | Ga0373936_0030845 | |||
| 1247 | Ga0373939_0004697 | |||
| 1248 | Ga0373941_0000235 | |||
| 1249 | Ga0373941_0001296 | |||
| 1250 | Ga0373941_0007755 | |||
| 1251 | Ga0373945_0036035 | |||
| 1252 | Ga0373945_0061497 | |||
| 1253 | Ga0373953_0000434 | |||
| 1254 | Ga0373954_0006934 | |||
| 1255 | Ga0373954_0031342 | |||
| 1256 | Ga0373956_0005231 | |||
| 1257 | Ga0373957_0031602 | |||
| 1258 | Ga0373957_0087160 | |||
| 1259 | Ga0373960_0001471 | |||
| 1260 | Ga0373960_0016391 | |||
| 1261 | Ga0373943_0009521 | |||
| 1262 | Ga0373943_0016632 | |||
| 1263 | Ga0373943_0115201 | |||
| 1264 | Ga0373943_0280982 | |||
| 1265 | Ga0373946_0005518 | |||
| 1266 | Ga0373946_0007236 | |||
| 1267 | Ga0373946_0014747 | |||
| 1268 | Ga0373955_0006525 | |||
| 1269 | Ga0373955_0007396 | |||
| 1270 | Ga0373942_0011444 | |||
| 1271 | Ga0373961_0000465 | |||
| 1272 | Ga0373961_0004288 | |||
| 1273 | Ga0373961_0059474 | |||
| 1274 | Ga0373962_0000735 | |||
| 1275 | Ga0373962_0009420 | |||
| 1276 | Ga0373924_0000181 | |||
| 1277 | Ga0373924_0004865 | |||
| 1278 | Ga0373931_0000398 | |||
| 1279 | Ga0373931_0042107 | |||
| 1280 | Ga0373931_0063424 | |||
| 1281 | Ga0373935_0000332 | |||
| 1282 | Ga0373927_0004623 | |||
| 1283 | Ga0373927_0019391 | |||
| 1284 | Ga0373927_0022495 | |||
| 1285 | Ga0373933_0001128 | |||
| 1286 | Ga0373933_0007464 | |||
| 1287 | Ga0373933_0033137 | |||
| 1288 | Ga0373947_0000414 | |||
| 1289 | Ga0373947_0001411 | |||
| 1290 | Ga0373947_0035619 | |||
| 1291 | Ga0373937_0000256 | |||
| 1292 | Ga0373937_0021412 | |||
| 1293 | Ga0373925_0000087 | |||
| 1294 | Ga0373925_0048049 | |||
| 1295 | Ga0395900_0052170 | |||
| 1296 | Ga0395898_0005267 | |||
| 1297 | Ga0395898_0333468 | |||
| 1298 | Ga0395905_0494342 | |||
| 1299 | Ga0436364_0376058 | |||
| 1300 | Ga0395901_0025919 | |||
| 1301 | Ga0395901_0051386 | |||
| 1302 | Ga0395901_0093925 | |||
| 1303 | Ga0436365_0168259 | |||
| 1304 | Ga0436365_1032543 | |||
| 1305 | Ga0436361_0493839 | |||
| 1306 | Ga0439453_0006336 | |||
| 1307 | Ga0439448_0025287 | |||
| 1308 | Ga0439450_028226 | |||
| 1309 | Ga0439455_0003554 | |||
| 1310 | Ga0439463_048146 | |||
| 1311 | Ga0451577_0037092 | |||
| 1312 | Ga0466963_0000255 | |||
| 1313 | Ga0466963_0125865 | |||
| 1314 | Ga0466971_0058777 | |||
| 1315 | Ga0466971_0064934 | |||
| 1316 | Ga0466957_0003978 | |||
| 1317 | Ga0466958_0084321 | |||
| 1318 | Ga0466967_0026440 | |||
| 1319 | Ga0466967_0799341 | |||
| 1320 | Ga0495617_018692 | |||
| 1321 | Ga0495592_0000001 | |||
| 1322 | Ga0495592_0064320 | |||
| 1323 | Ga0495592_0112911 | |||
| 1324 | Ga0495603_0000816 | |||
| 1325 | Ga0495603_0073531 | |||
| 1326 | Ga0495629_0000140 | |||
| 1327 | Ga0495629_0010438 | |||
| 1328 | Ga0495651_0000078 | |||
| 1329 | Ga0495651_0005725 | |||
| 1330 | Ga0495653_0000015 | |||
| 1331 | Ga0495653_0001195 | |||
| 1332 | Ga0495580_0017077 | |||
| 1333 | Ga0495639_0002630 | |||
| 1334 | Ga0495639_0214425 | |||
| 1335 | Ga0495662_0000522 | |||
| 1336 | Ga0495662_0085402 | |||
| 1337 | Ga0495664_0000001 | |||
| 1338 | Ga0495664_0009802 | |||
| 1339 | Ga0495584_0035132 | |||
| 1340 | Ga0495584_0062275 | |||
| 1341 | Ga0495584_0136719 | |||
| 1342 | Ga0495585_0002257 | |||
| 1343 | Ga0495607_0063641 | |||
| 1344 | Ga0495608_0000066 | |||
| 1345 | Ga0495608_0018106 | |||
| 1346 | Ga0495618_0000021 | |||
| 1347 | Ga0495618_0026750 | |||
| 1348 | Ga0495628_0000005 | |||
| 1349 | Ga0495630_0000254 | |||
| 1350 | Ga0495630_0044578 | |||
| 1351 | Ga0495630_0053123 | |||
| 1352 | Ga0495637_0060385 | |||
| 1353 | Ga0495663_0013685 | |||
| 1354 | Ga0495652_0000001 | |||
| 1355 | Ga0495652_0021598 | |||
| 1356 | Ga0495652_0098567 | |||
| 1357 | Ga0495665_0013635 | |||
| 1358 | Ga0495665_0093956 | |||
| 1359 | Ga0495665_0217787 | |||
| 1360 | Ga0495640_0000006 | |||
| 1361 | Ga0495640_0010546 | |||
| 1362 | Ga0495586_0021471 | |||
| 1363 | Ga0495587_0000012 | |||
| 1364 | Ga0495645_0000041 | |||
| 1365 | Ga0495645_0117648 | |||
| 1366 | Ga0495622_0006473 | |||
| 1367 | Ga0495622_0126949 | |||
| 1368 | Ga0495633_0128891 | |||
| 1369 | Ga0495667_0000001 | |||
| 1370 | Ga0495667_0027192 | |||
| 1371 | Ga0495656_0002411 | |||
| 1372 | Ga0495634_0001073 | |||
| 1373 | Ga0495634_0010311 | |||
| 1374 | Ga0495634_0087639 | |||
| 1375 | Ga0495611_0001798 | |||
| 1376 | Ga0495635_0000007 | |||
| 1377 | Ga0495635_0027867 | |||
| 1378 | Ga0495659_0015536 | |||
| 1379 | Ga0495661_0055503 | |||
| 1380 | Ga0495657_0000047 | |||
| 1381 | Ga0495599_0000002 | |||
| 1382 | Ga0495599_0085279 | |||
| 1383 | Ga0495623_0000023 | |||
| 1384 | Ga0495623_0135747 | |||
| 1385 | Ga0495646_0000024 | |||
| 1386 | Ga0495646_0085815 | |||
| 1387 | Ga0495647_0024678 | |||
| 1388 | Ga0495647_0032805 | |||
| 1389 | Ga0495658_0000602 | |||
| 1390 | Ga0495658_0165875 | |||
| 1391 | Ga0495613_0009103 | |||
| 1392 | Ga0495613_0058975 | |||
| 1393 | Ga0495613_0069645 | |||
| 1394 | Ga0495624_0091065 | |||
| 1395 | Ga0495600_0000013 | |||
| 1396 | Ga0495600_0003864 | |||
| 1397 | Ga0495600_0022090 | |||
| 1398 | Ga0495581_0049093 | |||
| 1399 | Ga0495581_0051060 | |||
| 1400 | Ga0495581_0051638 | |||
| 1401 | Ga0495581_0067994 | |||
| 1402 | Ga0495604_0000007 | |||
| 1403 | Ga0495604_0118361 | |||
| 1404 | Ga0495674_0000001 | |||
| 1405 | Ga0495674_0029383 | |||
| 1406 | Ga0495674_0165306 | |||
| 1407 | Ga0495676_0040351 | |||
| 1408 | Ga0495676_0071724 | |||
| 1409 | Ga0495676_0244698 | |||
| 1410 | Ga0495680_0001670 | |||
| 1411 | Ga0495680_0045981 | |||
| 1412 | Ga0495680_0054664 | |||
| 1413 | Ga0495675_0000014 | |||
| 1414 | Ga0495675_0050645 | |||
| 1415 | Ga0495677_0115177 | |||
| 1416 | Ga0495684_0000027 | |||
| 1417 | Ga0495684_0003742 | |||
| 1418 | Ga0495684_0037841 | |||
| 1419 | Ga0495684_0232585 | |||
| 1420 | Ga0495593_0000253 | |||
| 1421 | Ga0495593_0027098 | |||
| 1422 | Ga0495602_0000004 | |||
| 1423 | Ga0495602_0091194 | |||
| 1424 | Ga0495614_0024493 | |||
| 1425 | Ga0496100_0001438 | |||
| 1426 | Ga0496100_0022753 | |||
| 1427 | Ga0496100_0025104 | |||
| 1428 | Ga0496100_0037961 | |||
| 1429 | Ga0496101_0001028 | |||
| 1430 | Ga0496101_0048823 | |||
| 1431 | Ga0496102_0002331 | |||
| 1432 | Ga0496102_0024720 | |||
| 1433 | Ga0496103_0008234 | |||
| 1434 | Ga0496103_0012139 | |||
| 1435 | Ga0496103_0023961 | |||
| 1436 | Ga0496104_0082845 | |||
| 1437 | Ga0496104_0101294 | |||
| 1438 | Ga0496105_0001448 | |||
| 1439 | Ga0496105_0010412 | |||
| 1440 | Ga0496105_0117203 | |||
| 1441 | Ga0496105_0125964 | |||
| 1442 | Ga0496106_0006122 | |||
| 1443 | Ga0496106_0049085 | |||
| 1444 | Ga0496106_0164915 | |||
| 1445 | Ga0496106_0198288 | |||
| 1446 | Ga0496107_0000338 | |||
| 1447 | Ga0496107_0013441 | |||
| 1448 | Ga0496107_0022527 | |||
| 1449 | Ga0496107_0155608 | |||
| 1450 | Ga0496108_0007499 | |||
| 1451 | Ga0496108_0030031 | |||
| 1452 | Ga0496108_0040592 | |||
| 1453 | Ga0496108_0051504 | |||
| 1454 | Ga0496108_0078759 | |||
| 1455 | Ga0496108_0501088 | |||
| 1456 | Ga0496109_0012676 | |||
| 1457 | Ga0496109_0013537 | |||
| 1458 | Ga0496109_0015251 | |||
| 1459 | Ga0496109_0367280 | |||
| 1460 | Ga0496110_0067643 | |||
| 1461 | Ga0496110_0179869 | |||
| 1462 | Ga0496110_0538510 | |||
| 1463 | Ga0496111_0090277 | |||
| 1464 | Ga0496111_0272115 | |||
| 1465 | Ga0496112_0009699 | |||
| 1466 | Ga0496112_0201864 | |||
| 1467 | Ga0496112_0238200 | |||
| 1468 | Ga0496112_0599583 | |||
| 1469 | Ga0496113_0002225 | |||
| 1470 | Ga0496113_0022009 | |||
| 1471 | Ga0496113_0034579 | |||
| 1472 | Ga0496113_0066585 | |||
| 1473 | Ga0496113_0198052 | |||
| 1474 | Ga0496114_0002900 | |||
| 1475 | Ga0496114_0031113 | |||
| 1476 | Ga0496114_0052118 | |||
| 1477 | Ga0496114_0142494 | |||
| 1478 | Ga0496115_0002388 | |||
| 1479 | Ga0496115_0012838 | |||
| 1480 | Ga0496115_0016818 | |||
| 1481 | Ga0496115_0093287 | |||
| 1482 | Ga0501032_0020708 | |||
| 1483 | Ga0501032_0021514 | |||
| 1484 | Ga0501033_0043473 | |||
| 1485 | Ga0501033_0075931 | |||
| 1486 | Ga0501034_0000439 | |||
| 1487 | Ga0501034_0000810 | |||
| 1488 | Ga0501034_0014998 | |||
| 1489 | Ga0501034_0029054 | |||
| 1490 | Ga0501034_0084171 | |||
| 1491 | Ga0501034_0084856 | |||
| 1492 | Ga0501034_0085960 | |||
| 1493 | Ga0501034_0162196 | |||
| 1494 | Ga0501034_0321792 | |||
| 1495 | Ga0501036_0005548 | |||
| 1496 | Ga0501036_0057010 | |||
| 1497 | Ga0501036_0214100 | |||
| 1498 | Ga0501036_0248059 | |||
| 1499 | Ga0501037_0004371 | |||
| 1500 | Ga0501037_0008008 | |||
| 1501 | Ga0501037_0043089 | |||
| 1502 | Ga0501037_0055560 | |||
| 1503 | Ga0501038_0068526 | |||
| 1504 | Ga0501038_0144624 | |||
| 1505 | Ga0501038_0156468 | |||
| 1506 | Ga0501038_0226321 | |||
| 1507 | Ga0501039_0025664 | |||
| 1508 | Ga0501039_0083513 | |||
| 1509 | Ga0501043_0010261 | |||
| 1510 | Ga0501043_0028689 | |||
| 1511 | Ga0501043_0076117 | |||
| 1512 | Ga0501043_0212660 | |||
| 1513 | Ga0501043_0245281 | |||
| 1514 | Ga0501046_0144407 | |||
| 1515 | Ga0501046_0173526 | |||
| 1516 | Ga0501047_0000073 | |||
| 1517 | Ga0501047_0030765 | |||
| 1518 | Ga0501047_0169779 | |||
| 1519 | Ga0501047_0301254 | |||
| 1520 | Ga0501048_0000391 | |||
| 1521 | Ga0501048_0107868 | |||
| 1522 | Ga0501048_0166733 | |||
| 1523 | Ga0501067_0018876 | |||
| 1524 | Ga0501067_0026794 | |||
| 1525 | Ga0501067_0062154 | |||
| 1526 | Ga0501068_0028094 | |||
| 1527 | Ga0501069_0074898 | |||
| 1528 | Ga0501069_0080778 | |||
| 1529 | Ga0501070_0036364 | |||
| 1530 | Ga0501070_0070884 | |||
| 1531 | Ga0501070_0099219 | |||
| 1532 | Ga0501070_0107418 | |||
| 1533 | Ga0501070_0121305 | |||
| 1534 | Ga0501070_0193618 | |||
| 1535 | Ga0501070_0236972 | |||
| 1536 | Ga0501071_0187505 | |||
| 1537 | Ga0501072_0007381 | |||
| 1538 | Ga0501072_0028692 | |||
| 1539 | Ga0501072_0365318 | |||
| 1540 | Ga0501073_0010362 | |||
| 1541 | Ga0501073_0041506 | |||
| 1542 | Ga0501073_0047948 | |||
| 1543 | Ga0501073_0078028 | |||
| 1544 | Ga0501073_0133542 | |||
| 1545 | Ga0501073_0256425 | |||
| 1546 | Ga0501074_0037466 | |||
| 1547 | Ga0501074_0074614 | |||
| 1548 | Ga0501074_0100751 | |||
| 1549 | Ga0501079_0036026 | |||
| 1550 | Ga0501080_0006835 | |||
| 1551 | Ga0501080_0029315 | |||
| 1552 | Ga0501080_0090041 | |||
| 1553 | Ga0501080_0131989 | |||
| 1554 | Ga0501080_0160220 | |||
| 1555 | Ga0501080_0218525 | |||
| 1556 | Ga0501083_0000139 | |||
| 1557 | Ga0501083_0055944 | |||
| 1558 | Ga0501083_0110965 | |||
| 1559 | Ga0501083_0132895 | |||
| 1560 | Ga0501035_0001020 | |||
| 1561 | Ga0501035_0092572 | |||
| 1562 | Ga0501035_0096114 | |||
| 1563 | Ga0501035_0111324 | |||
| 1564 | Ga0501035_0412901 | |||
| 1565 | Ga0501044_0005518 | |||
| 1566 | Ga0501044_0037733 | |||
| 1567 | Ga0501044_0267967 | |||
| 1568 | Ga0501045_0077542 | |||
| 1569 | Ga0501045_0078420 | |||
| 1570 | nmdc:mga05p37_129606_c1 | |||
| 1571 | nmdc:mga05p37_15207_c1 | |||
| 1572 | nmdc:mga05p37_18481_c1 | |||
| 1573 | nmdc:mga05p37_235544_c1 | |||
| 1574 | nmdc:mga05p37_53778_c1 | |||
| 1575 | nmdc:mga05p37_79680_c1 | |||
| 1576 | nmdc:mga09592_355495_c1 | |||
| 1577 | nmdc:mga09592_48564_c1 | |||
| 1578 | nmdc:mga09592_5221_c1 | |||
| 1579 | nmdc:mga0qj67_33781_c1 | |||
| 1580 | nmdc:mga0qj67_347350_c1 | |||
| 1581 | nmdc:mga0qj67_5138_c1 | |||
| 1582 | nmdc:mga06r32_163736_c1 | |||
| 1583 | nmdc:mga06r32_1670_c1 | |||
| 1584 | nmdc:mga06r32_85486_c1 | |||
| 1585 | nmdc:mga08y16_15015_c1 | |||
| 1586 | nmdc:mga08y16_20578_c1 | |||
| 1587 | nmdc:mga08y16_643734_c1 | |||
| 1588 | nmdc:mga08y16_6877_c1 | |||
| 1589 | nmdc:mga0n895_107079_c1 | |||
| 1590 | nmdc:mga0n895_1271_c1 | |||
| 1591 | nmdc:mga0n895_12797_c1 | |||
| 1592 | nmdc:mga0n895_148321_c1 | |||
| 1593 | nmdc:mga0n895_29981_c1 | |||
| 1594 | nmdc:mga0n895_482666_c1 | |||
| 1595 | nmdc:mga0n895_515895_c1 | |||
| 1596 | nmdc:mga0n895_92515_c1 | |||
| 1597 | nmdc:mga0n895_9812_c1 | |||
| 1598 | nmdc:mga0rr50_39133_c1 | |||
| 1599 | nmdc:mga0rr50_5080_c1 | |||
| 1600 | nmdc:mga0rr50_70636_c1 | |||
| 1601 | nmdc:mga08x19_197067_c1 | |||
| 1602 | nmdc:mga08x19_81078_c1 | |||
| 1603 | nmdc:mga0a205_16609_c1 | |||
| 1604 | nmdc:mga0a205_419881_c1 | |||
| 1605 | Ga0495601_0000006 | |||
| 1606 | Ga0495601_0031224 | |||
| 1607 | Ga0495601_0048428 | |||
| 1608 | Ga0495601_0054932 | |||
| 1609 | Ga0495612_0000004 | |||
| 1610 | Ga0495612_0005181 | |||
| 1611 | Ga0495612_0038945 | |||
| 1612 | Ga0495595_0000006 | |||
| 1613 | Ga0495595_0002169 | |||
| 1614 | Ga0495619_0000011 | |||
| 1615 | Ga0495619_0000384 | |||
| 1616 | Ga0495619_0012696 | |||
| 1617 | Ga0500566_0142359 | |||
| 1618 | Ga0500652_000006 | |||
| 1619 | Ga0500616_0037070 | |||
| 1620 | Ga0500616_0040910 | |||
| 1621 | Ga0501084_0143159 | |||
| 1622 | Ga0501084_0301680 | |||
| 1623 | Ga0501084_0394778 | |||
| 1624 | Ga0501082_0041891 | |||
| 1625 | Ga0501082_0050070 | |||
| 1626 | Ga0501082_0350369 | |||
| 1627 | Ga0466962_0097220 | |||
| 1628 | Ga0530510_0225736 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z7a-assembly1.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8592 | 24 | 282 |
| 3cl6-assembly1.cif.gz_A | crystal structure of puue allantoinase | 0.8575 | 14 | 286 |
| 3rxz-assembly1.cif.gz_B | crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis | 0.8508 | 8 | 288 |
| 3s6o-assembly1.cif.gz_D | crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei | 0.8348 | 16 | 282 |
| 3rxz-assembly1.cif.gz_B | crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis | 0.817 | 8 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O13842_2_320_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8467 | 12 | 282 | 3.20.20.370 |
| 3rxzD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8338 | 8 | 288 | 3.20.20.370 |
| 1z7aC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8181 | 24 | 282 | 3.20.20.370 |
| 3qbuB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7978 | 26 | 286 | 3.20.20.370 |
| 3rxzD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.7977 | 8 | 288 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537NL26-F1-model_v4 | Chitooligosaccharide deacetylase (Nodulation protein B) | 0.9798 | 65 | 287 |
GO:0005975
GO:0016810 |
| AF-W4M0J2-F1-model_v4 | NodB homology domain-containing protein | 0.9733 | 78 | 284 |
GO:0005975
GO:0016810 |
| AF-H0THA1-F1-model_v4 | Polysaccharide deacetylase | 0.972 | 160 | 290 |
GO:0005975
|
| AF-A0A537NL26-F1-model_v4 | Chitooligosaccharide deacetylase (Nodulation protein B) | 0.9712 | 65 | 287 |
GO:0005975
GO:0016810 |
| AF-A0A2V7EC11-F1-model_v4 | Polysaccharide deacetylase | 0.9695 | 125 | 287 |
GO:0005975
|