F482002

General Info

Members Datasets Scaffolds Average Seq Length
814 452 1628 281

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946041624|2946043353
Length 324
Sequence SESEPTSTQETSVSSRRSASRSTTGTEEIHGSLSETKRREPMAPAQVGVLGGGRMGAGIAHAFLLAGSRVSVVERDDESAAAAAHRVGDSIRRSVERDGGLDETEIRSRLDTGTDATAFGECDLVIEAVPEERTLKETALSRAEAAMPAYAILASNTSSISIDDLASRRLRPERFLGLHFFNPVPASALVEVVQGSATSPDVIDSARVWVSALGKTPIVVRDSPGFASSRLGVMLGLEAIRMLEDGVASAADIDAAMTLGYRHPTGPLRTTDIVGLDVRLGIAEELERAFGERFAPPELLRRMVAEGKLGRKSGQGFYEWNEER

Samples

Sample ID Description Type Environment
1 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
304 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
308 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
311 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
335 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
336 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
337 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
338 2558860280 Kutzneria sp. 744 Isolate Unclassified
339 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
340 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
341 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
342 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
343 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
344 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
345 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
346 2643221546 Microbacterium sp. Root53 Isolate Unclassified
347 2643221549 Agromyces sp. Root1464 Isolate Unclassified
348 2643221553 Microbacterium sp. Root553 Isolate Unclassified
349 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
350 2643221572 Leifsonia sp. Root60 Isolate Unclassified
351 2643221575 Microbacterium sp. Root61 Isolate Unclassified
352 2643221576 Nocardioides sp. Root614 Isolate Unclassified
353 2643221590 Nocardioides sp. Root682 Isolate Unclassified
354 2643221597 Microbacterium sp. Root180 Isolate Unclassified
355 2643221604 Nocardioides sp. Root190 Isolate Unclassified
356 2643221616 Leifsonia sp. Root227 Isolate Unclassified
357 2643221617 Nocardioides sp. Root79 Isolate Unclassified
358 2643221619 Agromyces sp. Root81 Isolate Unclassified
359 2643221620 Nocardioides sp. Root240 Isolate Unclassified
360 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
361 2643221630 Microbacterium sp. Root322 Isolate Unclassified
362 2643221649 Leifsonia sp. Root4 Isolate Unclassified
363 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
364 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
365 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
366 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
367 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
368 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
369 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
370 2739367653 Kocuria sp. OV113 Isolate Unclassified
371 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
372 2739367898 Nocardioides sp. CF479 Isolate Unclassified
373 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
374 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
375 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
376 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
377 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
378 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
379 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
380 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
381 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
382 2808606372 Agromyces sp. 23-23 Isolate Unclassified
383 2808606394 Promicromonospora sp. C35 Isolate Unclassified
384 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
385 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
386 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
387 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
388 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
389 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
390 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
391 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
392 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
393 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
394 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
395 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
396 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
397 2857727296 Kocuria sp. R-72562 Isolate Unclassified
398 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
399 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
400 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
401 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
402 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
403 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
404 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
405 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
406 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
407 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
408 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
409 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
410 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
411 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
412 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
413 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
414 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
415 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
416 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
417 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
418 2919069694 Microbacterium sp. 1154 Isolate Unclassified
419 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
420 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
421 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
422 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
423 2920879853 Kocuria salina CV6 Isolate Unclassified
424 2922554459 Rhodococcus sp. 66b Isolate Unclassified
425 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
426 2928153084 Leifsonia sp. 563 Isolate Unclassified
427 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
428 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
429 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
430 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
431 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
432 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
433 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
434 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
435 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
436 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
437 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
438 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
439 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
440 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
441 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
442 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
443 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
444 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
445 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
446 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
447 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
448 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
449 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
450 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
451 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
452 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.31
Metatranscriptomes 3.19
Isolates 14.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 8.85
Nodule 0
Rhizoplane 3.32
Rhizosphere 69.04
Stem 0
Stem Tuber 0.12
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000649 3300002772 Bacteria 14285
2 JGI25165J46597_1000174 3300003214 Bacteria 100372
3 rootL2_10035491 3300003322 Bacteria 16840
4 rootH1_10055294 3300003323 Bacteria 1447
5 Ga0006562J51391_1111915 3300003578 Bacteria 26433
6 Ga0006562J51391_1111917 3300003578 Bacteria 16790
7 Ga0006562J51391_1209490 3300003578 Bacteria 7710
8 Ga0006562J51391_1209491 3300003578 Bacteria 7690
9 Ga0055533_1000001 3300003756 Bacteria 1863437
10 Ga0055525_1000330 3300003759 Bacteria 36101
11 Ga0055542_1000427 3300003762 Bacteria 40635
12 Ga0055529_1000571 3300003763 Bacteria 30068
13 Ga0055540_1011213 3300003792 Bacteria 2911
14 Ga0070658_10009760 3300005327 Bacteria 7709
15 Ga0070658_10105547 3300005327 Bacteria 2330
16 Ga0070683_100147207 3300005329 Bacteria 2232
17 Ga0070683_100274017 3300005329 Bacteria 1605
18 Ga0070683_100331821 3300005329 Bacteria 1448
19 Ga0070670_100287151 3300005331 Bacteria 1437
20 Ga0070670_100293247 3300005331 Bacteria 1422
21 Ga0068868_100096268 3300005338 Bacteria 2391
22 Ga0068868_100268046 3300005338 Bacteria 1442
23 Ga0070660_100054836 3300005339 Bacteria 3079
24 Ga0070660_100267364 3300005339 Bacteria 1397
25 Ga0070668_100000560 3300005347 Bacteria 24850
26 Ga0070668_100044032 3300005347 Bacteria 3423
27 Ga0070659_100000749 3300005366 Bacteria 23637
28 Ga0070667_100049296 3300005367 Bacteria 3546
29 Ga0070685_10033968 3300005466 Bacteria 2870
30 Ga0070679_100158901 3300005530 Bacteria 2235
31 Ga0068853_100001645 3300005539 Bacteria 16333
32 Ga0068853_100199644 3300005539 Bacteria 1820
33 Ga0070672_100202532 3300005543 Bacteria 1660
34 Ga0070665_100076240 3300005548 Bacteria 3360
35 Ga0070665_100115555 3300005548 Bacteria 2686
36 Ga0068855_100005522 3300005563 Bacteria 15431
37 Ga0068855_100167483 3300005563 Bacteria 2490
38 Ga0068855_100318733 3300005563 Bacteria 1719
39 Ga0068857_100001028 3300005577 Bacteria 21558
40 Ga0068857_100049400 3300005577 Bacteria 3732
41 Ga0068854_100001906 3300005578 Bacteria 12696
42 Ga0068856_100193332 3300005614 Bacteria 2048
43 Ga0068852_100003952 3300005616 Bacteria 10419
44 Ga0068852_100012604 3300005616 Bacteria 6426
45 Ga0068852_100035556 3300005616 Bacteria 4157
46 Ga0068852_100151450 3300005616 Bacteria 2157
47 Ga0068864_100042847 3300005618 Bacteria 3874
48 Ga0068864_100210238 3300005618 Bacteria 1791
49 Ga0068851_10000008 3300005834 Bacteria 231006
50 Ga0068863_100057676 3300005841 Bacteria 3675
51 Ga0068858_100000096 3300005842 Bacteria 91762
52 Ga0068858_100011201 3300005842 Bacteria 8475
53 Ga0068860_100168878 3300005843 Bacteria 2112
54 Ga0081455_10008614 3300005937 Bacteria 10581
55 Ga0081540_1010901 3300005983 Bacteria 6104
56 Ga0081539_10006285 3300005985 Bacteria 11482
57 Ga0075365_10000074 3300006038 Bacteria 29323
58 Ga0075365_10001691 3300006038 Bacteria 10208
59 Ga0075365_10095488 3300006038 Bacteria 2030
60 Ga0075365_10346357 3300006038 Bacteria 1047
61 Ga0075363_100062469 3300006048 Bacteria 2008
62 Ga0075364_10009137 3300006051 Bacteria 5937
63 Ga0075364_10053696 3300006051 Bacteria 2634
64 Ga0075364_10110763 3300006051 Bacteria 1832
65 Ga0075364_10120647 3300006051 Bacteria 1755
66 Ga0075364_10182612 3300006051 Bacteria 1420
67 Ga0075364_10235609 3300006051 Bacteria 1243
68 Ga0075432_10008430 3300006058 Bacteria 3517
69 Ga0075367_10014844 3300006178 Bacteria 4220
70 Ga0075370_10074719 3300006353 Bacteria 1942
71 Ga0075370_10097603 3300006353 Bacteria 1699
72 Ga0105240_10099808 3300009093 Bacteria 3533
73 Ga0105240_10424377 3300009093 Bacteria 1493
74 Ga0111539_10258735 3300009094 Bacteria 2026
75 Ga0105245_10071744 3300009098 Bacteria 3145
76 Ga0105245_10117434 3300009098 Bacteria 2481
77 Ga0105245_10502714 3300009098 Bacteria 1228
78 Ga0105243_10060287 3300009148 Bacteria 3031
79 Ga0105243_10442023 3300009148 Bacteria 1218
80 Ga0105241_10006075 3300009174 Bacteria 8905
81 Ga0105241_10020164 3300009174 Bacteria 4925
82 Ga0105248_10000713 3300009177 Bacteria 37644
83 Ga0105248_10036889 3300009177 Bacteria 5467
84 Ga0105237_10000688 3300009545 Bacteria 46838
85 Ga0105237_10147307 3300009545 Bacteria 2349
86 Ga0105237_10153998 3300009545 Bacteria 2295
87 Ga0105238_10006959 3300009551 Bacteria 11300
88 Ga0105238_10017275 3300009551 Bacteria 7329
89 Ga0105238_10055894 3300009551 Bacteria 3960
90 Ga0105238_10067508 3300009551 Bacteria 3577
91 Ga0105249_10155161 3300009553 Bacteria 2207
92 Ga0105239_10113586 3300010375 Bacteria 3003
93 Ga0105239_10190119 3300010375 Bacteria 2298
94 Ga0105239_10735083 3300010375 Bacteria 1129
95 Ga0105246_10113931 3300011119 Bacteria 1991
96 Ga0157370_10006011 3300013104 Bacteria 13505
97 Ga0157369_10110300 3300013105 Bacteria 2925
98 Ga0157369_10143141 3300013105 Bacteria 2529
99 Ga0171462_1001 3300013250 Bacteria 1135406
100 Ga0163162_10099567 3300013306 Bacteria 2998
101 Ga0157375_10282440 3300013308 Bacteria 1823
102 Ga0157375_10324619 3300013308 Bacteria 1704
103 Ga0163163_10149343 3300014325 Bacteria 2381
104 Ga0163163_10592093 3300014325 Bacteria 1172
105 Ga0157380_10006897 3300014326 Bacteria 8033
106 Ga0157380_10467656 3300014326 Bacteria 1216
107 Ga0157380_10809113 3300014326 Bacteria 955
108 Ga0157379_10042903 3300014968 Bacteria 4039
109 Ga0157379_10597026 3300014968 Bacteria 1030
110 Ga0157376_10656637 3300014969 Bacteria 1050
111 Ga0163161_10319712 3300017792 Bacteria 1227
112 Ga0206356_10506699 3300020070 Bacteria 2239
113 Ga0206354_10181118 3300020081 Bacteria 2976
114 Ga0206353_10162159 3300020082 Bacteria 6239
115 Ga0206353_11489331 3300020082 Bacteria 2714
116 Ga0213875_10005353 3300021388 Bacteria 6900
117 Ga0209566_100053 3300025225 Bacteria 224436
118 Ga0209674_100001 3300025226 Bacteria 4013750
119 Ga0209672_100039 3300025228 Bacteria 283064
120 Ga0209147_102885 3300025229 Bacteria 3782
121 Ga0209563_100001 3300025230 Bacteria 4013775
122 Ga0207427_100010 3300025231 Bacteria 648610
123 Ga0209646_1000192 3300025246 Bacteria 75005
124 Ga0209677_100001 3300025253 Bacteria 4013787
125 Ga0209677_100378 3300025253 Bacteria 27274
126 Ga0209148_1000004 3300025254 Bacteria 1844481
127 Ga0209148_1002409 3300025254 Bacteria 6501
128 Ga0209233_1000001 3300025261 Bacteria 2992747
129 Ga0209455_1000377 3300025272 Bacteria 40663
130 Ga0209051_1020243 3300025303 Bacteria 2872
131 Ga0207656_10000005 3300025321 Bacteria 490514
132 Ga0207688_10012150 3300025901 Bacteria 4685
133 Ga0207647_10001411 3300025904 Bacteria 18447
134 Ga0207643_10053036 3300025908 Bacteria 2304
135 Ga0207705_10076475 3300025909 Bacteria 2434
136 Ga0207654_10000001 3300025911 Bacteria 1816198
137 Ga0207654_10029988 3300025911 Bacteria 2982
138 Ga0207695_10009355 3300025913 Bacteria 12117
139 Ga0207695_10019929 3300025913 Bacteria 7703
140 Ga0207671_10000016 3300025914 Bacteria 435413
141 Ga0207671_10001866 3300025914 Bacteria 23478
142 Ga0207671_10114909 3300025914 Bacteria 2052
143 Ga0207657_10023164 3300025919 Bacteria 5788
144 Ga0207657_10227729 3300025919 Bacteria 1491
145 Ga0207652_10136467 3300025921 Bacteria 2191
146 Ga0207652_10342280 3300025921 Bacteria 1350
147 Ga0207681_10103573 3300025923 Bacteria 2057
148 Ga0207694_10000196 3300025924 Bacteria 60714
149 Ga0207694_10285495 3300025924 Bacteria 1356
150 Ga0207650_10299270 3300025925 Bacteria 1313
151 Ga0207687_10042745 3300025927 Bacteria 3120
152 Ga0207690_10002298 3300025932 Bacteria 11651
153 Ga0207709_10022715 3300025935 Bacteria 3561
154 Ga0207691_10268967 3300025940 Bacteria 1468
155 Ga0207711_10135194 3300025941 Bacteria 2214
156 Ga0207661_10017840 3300025944 Bacteria 5261
157 Ga0207661_10140936 3300025944 Bacteria 2075
158 Ga0207661_10194858 3300025944 Bacteria 1778
159 Ga0207667_10001482 3300025949 Bacteria 29458
160 Ga0207667_10397099 3300025949 Bacteria 1404
161 Ga0207712_10239305 3300025961 Bacteria 1461
162 Ga0207668_10000481 3300025972 Bacteria 24975
163 Ga0207668_10208879 3300025972 Bacteria 1560
164 Ga0207640_10233276 3300025981 Bacteria 1417
165 Ga0207677_10029357 3300026023 Bacteria 3494
166 Ga0207677_10245924 3300026023 Bacteria 1450
167 Ga0207703_10001625 3300026035 Bacteria 20245
168 Ga0207639_10040609 3300026041 Bacteria 3474
169 Ga0207639_10103246 3300026041 Bacteria 2309
170 Ga0207678_10628044 3300026067 Bacteria 943
171 Ga0207702_10054536 3300026078 Bacteria 3388
172 Ga0207702_10182105 3300026078 Bacteria 1935
173 Ga0207641_10010811 3300026088 Bacteria 7482
174 Ga0207676_10118215 3300026095 Bacteria 2231
175 Ga0207676_10174425 3300026095 Bacteria 1876
176 Ga0207674_10000405 3300026116 Bacteria 55884
177 Ga0207674_10221300 3300026116 Bacteria 1841
178 Ga0207675_100095849 3300026118 Bacteria 2793
179 Ga0207683_10114464 3300026121 Bacteria 2417
180 Ga0207698_10000078 3300026142 Bacteria 65050
181 Ga0207698_10002196 3300026142 Bacteria 11542
182 Ga0207698_10021148 3300026142 Bacteria 4494
183 Ga0207428_10053527 3300027907 Bacteria 3218
184 Ga0268266_10070008 3300028379 Bacteria 3041
185 Ga0268266_10161904 3300028379 Bacteria 2025
186 Ga0268266_10363727 3300028379 Bacteria 1362
187 Ga0268265_10036705 3300028380 Bacteria 3591
188 Ga0268265_10161472 3300028380 Bacteria 1904
189 Ga0307517_10005202 3300028786 Bacteria 19711
190 Ga0307517_10050934 3300028786 Bacteria 4193
191 Ga0307515_10000189 3300028794 Bacteria 150703
192 Ga0307515_10000436 3300028794 Bacteria 100131
193 Ga0307515_10026558 3300028794 Bacteria 9958
194 Ga0307515_10041387 3300028794 Bacteria 7246
195 Ga0307515_10100480 3300028794 Bacteria 3501
196 Ga0307515_10149291 3300028794 Bacteria 2454
197 Ga0307515_10214310 3300028794 Bacteria 1761
198 Ga0307511_10000194 3300030521 Bacteria 60345
199 Ga0307511_10000824 3300030521 Bacteria 33088
200 Ga0307511_10075469 3300030521 Bacteria 2419
201 Ga0307512_10007529 3300030522 Bacteria 10772
202 Ga0307512_10011457 3300030522 Bacteria 8402
203 Ga0307512_10151248 3300030522 Bacteria 1388
204 Ga0307513_10001658 3300031456 Bacteria 31815
205 Ga0307513_10003959 3300031456 Bacteria 19895
206 Ga0307513_10040155 3300031456 Bacteria 5176
207 Ga0307509_10013932 3300031507 Bacteria 9484
208 Ga0307509_10022228 3300031507 Bacteria 7156
209 Ga0307509_10025555 3300031507 Bacteria 6592
210 Ga0307509_10061064 3300031507 Bacteria 3981
211 Ga0307509_10080593 3300031507 Bacteria 3366
212 Ga0307509_10103294 3300031507 Bacteria 2878
213 Ga0307408_100034128 3300031548 Bacteria 3561
214 Ga0307408_100139192 3300031548 Bacteria 1903
215 Ga0307408_100157919 3300031548 Bacteria 1798
216 Ga0307508_10003658 3300031616 Bacteria 15415
217 Ga0307508_10061681 3300031616 Bacteria 3312
218 Ga0307508_10078310 3300031616 Bacteria 2886
219 Ga0307508_10100940 3300031616 Bacteria 2481
220 Ga0307508_10148644 3300031616 Bacteria 1947
221 Ga0307514_10063841 3300031649 Bacteria 2795
222 Ga0307516_10005460 3300031730 Bacteria 15196
223 Ga0307516_10045235 3300031730 Bacteria 4349
224 Ga0307516_10064212 3300031730 Bacteria 3552
225 Ga0307516_10106039 3300031730 Bacteria 2621
226 Ga0307405_10185122 3300031731 Bacteria 1499
227 Ga0307413_10039100 3300031824 Bacteria 2756
228 Ga0307413_10115553 3300031824 Bacteria 1806
229 Ga0307413_10286025 3300031824 Bacteria 1243
230 Ga0307413_10625090 3300031824 Bacteria 885
231 Ga0307518_10000412 3300031838 Bacteria 32912
232 Ga0307518_10175499 3300031838 Bacteria 1455
233 Ga0307410_10018744 3300031852 Bacteria 4190
234 Ga0307410_10021437 3300031852 Bacteria 3974
235 Ga0307410_10138062 3300031852 Bacteria 1800
236 Ga0307410_10138325 3300031852 Bacteria 1798
237 Ga0307410_10369755 3300031852 Bacteria 1151
238 Ga0307406_10001204 3300031901 Bacteria 14485
239 Ga0307406_10052440 3300031901 Bacteria 2594
240 Ga0307406_10072553 3300031901 Bacteria 2260
241 Ga0307406_10137549 3300031901 Bacteria 1724
242 Ga0307406_10427058 3300031901 Bacteria 1057
243 Ga0307407_10199789 3300031903 Bacteria 1339
244 Ga0307407_10267718 3300031903 Bacteria 1178
245 Ga0307412_10024159 3300031911 Bacteria 3749
246 Ga0307412_10057256 3300031911 Bacteria 2601
247 Ga0307412_10392120 3300031911 Bacteria 1128
248 Ga0307409_100006047 3300031995 Bacteria 7064
249 Ga0307409_100288224 3300031995 Bacteria 1521
250 Ga0307409_100327823 3300031995 Bacteria 1435
251 Ga0307416_100002272 3300032002 Bacteria 10949
252 Ga0307416_100225247 3300032002 Bacteria 1802
253 Ga0307416_100317519 3300032002 Bacteria 1558
254 Ga0307416_100456828 3300032002 Bacteria 1331
255 Ga0307414_10066312 3300032004 Bacteria 2580
256 Ga0307414_10117497 3300032004 Bacteria 2038
257 Ga0307414_10219748 3300032004 Bacteria 1559
258 Ga0307414_10392665 3300032004 Bacteria 1203
259 Ga0307411_10083770 3300032005 Bacteria 2204
260 Ga0307411_10310014 3300032005 Bacteria 1270
261 Ga0307415_100369478 3300032126 Bacteria 1214
262 Ga0307507_10009303 3300033179 Bacteria 13156
263 Ga0307507_10023801 3300033179 Bacteria 6701
264 Ga0307507_10057799 3300033179 Bacteria 3649
265 Ga0307507_10082816 3300033179 Bacteria 2810
266 Ga0307507_10165311 3300033179 Bacteria 1623
267 Ga0307507_10188201 3300033179 Bacteria 1457
268 Ga0307510_10033562 3300033180 Bacteria 5761
269 Ga0307510_10103362 3300033180 Bacteria 2626
270 Ga0307510_10206826 3300033180 Bacteria 1490
271 Ga0316214_1002008 3300033545 Bacteria 2467
272 Ga0373938_0011954 3300034957 Bacteria 1623
273 Ga0373940_0001334 3300035088 Bacteria 4403
274 Ga0373942_0001388 3300035207 Bacteria 6263
275 Ga0373962_0000420 3300035242 Bacteria 9243
276 Ga0395899_0011272 3300037312 Bacteria 6848
277 Ga0395899_0020111 3300037312 Bacteria 5065
278 Ga0395899_0046544 3300037312 Bacteria 3231
279 Ga0395899_0050283 3300037312 Bacteria 3095
280 Ga0395900_0054877 3300037418 Bacteria 4102
281 Ga0395900_0088650 3300037418 Bacteria 3181
282 Ga0395900_0116325 3300037418 Bacteria 2744
283 Ga0395900_0269495 3300037418 Bacteria 1698
284 Ga0395898_0000256 3300037466 Bacteria 130878
285 Ga0395898_0003736 3300037466 Bacteria 16878
286 Ga0395898_0006023 3300037466 Bacteria 13025
287 Ga0395898_0009444 3300037466 Bacteria 10246
288 Ga0395898_0038380 3300037466 Bacteria 4747
289 Ga0395898_0076921 3300037466 Bacteria 3222
290 Ga0395898_0232569 3300037466 Bacteria 1758
291 Ga0395905_0034166 3300037471 Bacteria 4774
292 Ga0395905_0445427 3300037471 Bacteria 1193
293 Ga0436364_0891096 3300037853 Bacteria 17632
294 Ga0395901_0001692 3300038443 Bacteria 22752
295 Ga0395901_0005007 3300038443 Bacteria 13377
296 Ga0395901_0023278 3300038443 Bacteria 6350
297 Ga0395901_0095473 3300038443 Bacteria 3116
298 Ga0395901_0098948 3300038443 Bacteria 3058
299 Ga0395901_0144104 3300038443 Bacteria 2504
300 Ga0395901_0288080 3300038443 Bacteria 1705
301 Ga0395901_0382965 3300038443 Bacteria 1447
302 Ga0395901_0412286 3300038443 Bacteria 1387
303 Ga0439436_0020261 3300041404 Bacteria 1981
304 Ga0451837_0641337 3300041494 Bacteria 1190
305 Ga0439433_0007739 3300041999 Bacteria 2323
306 Ga0439449_0035166 3300042007 Bacteria 1865
307 Ga0439449_0038334 3300042007 Bacteria 1782
308 Ga0439457_002025 3300042014 Bacteria 5949
309 Ga0439458_0051848 3300042157 Bacteria 1014
310 Ga0466969_0009413 3300044656 Bacteria 5178
311 Ga0466969_0044415 3300044656 Bacteria 2210
312 Ga0466969_0152838 3300044656 Bacteria 1063
313 Ga0466972_0023059 3300044658 Bacteria 3098
314 Ga0466972_0057218 3300044658 Bacteria 1873
315 Ga0466965_0004730 3300044683 Bacteria 6068
316 Ga0466965_0024111 3300044683 Bacteria 2942
317 Ga0466965_0105219 3300044683 Bacteria 1446
318 Ga0466966_0017223 3300044684 Bacteria 4777
319 Ga0466966_0060069 3300044684 Bacteria 2400
320 Ga0466966_0103107 3300044684 Bacteria 1763
321 Ga0466961_0018907 3300044693 Bacteria 4432
322 Ga0466961_0105952 3300044693 Bacteria 1770
323 Ga0466963_0050792 3300044694 Bacteria 2745
324 Ga0466968_0001871 3300044735 Bacteria 7614
325 Ga0466968_0005778 3300044735 Bacteria 4641
326 Ga0466970_0036417 3300044765 Bacteria 2606
327 Ga0466970_0044839 3300044765 Bacteria 2354
328 Ga0466970_0062493 3300044765 Bacteria 1996
329 Ga0466970_0236514 3300044765 Bacteria 1021
330 Ga0466957_0020653 3300044842 Bacteria 3876
331 Ga0466960_0023405 3300044901 Bacteria 2774
332 Ga0466960_0024039 3300044901 Bacteria 2744
333 Ga0466960_0031329 3300044901 Bacteria 2453
334 Ga0466960_0044342 3300044901 Bacteria 2120
335 Ga0466960_0173329 3300044901 Bacteria 1165
336 Ga0466959_0005086 3300045049 Bacteria 8941
337 Ga0466959_0019351 3300045049 Bacteria 5006
338 Ga0466959_0274148 3300045049 Bacteria 1159
339 Ga0466958_0052816 3300045836 Bacteria 2464
340 Ga0466958_0069880 3300045836 Bacteria 2148
341 Ga0466958_0170159 3300045836 Bacteria 1379
342 Ga0466967_0000584 3300045976 Bacteria 18008
343 Ga0466967_0014483 3300045976 Bacteria 6145
344 Ga0466967_0081394 3300045976 Bacteria 2925
345 Ga0466967_0289063 3300045976 Bacteria 1574
346 Ga0466967_0372360 3300045976 Bacteria 1385
347 Ga0466967_0603939 3300045976 Bacteria 1083
348 Ga0495627_000352 3300046453 Bacteria 43219
349 Ga0495627_010387 3300046453 Bacteria 3387
350 Ga0495592_0042075 3300046454 Bacteria 3422
351 Ga0495603_0116803 3300046455 Bacteria 1555
352 Ga0495590_0000075 3300046457 Bacteria 68919
353 Ga0495629_0003756 3300046459 Bacteria 11441
354 Ga0495629_0006664 3300046459 Bacteria 8547
355 Ga0495629_0014354 3300046459 Bacteria 5698
356 Ga0495638_0145539 3300046460 Bacteria 1379
357 Ga0495651_0033791 3300046462 Bacteria 3988
358 Ga0495651_0278319 3300046462 Bacteria 1131
359 Ga0495650_0000558 3300046471 Bacteria 52874
360 Ga0495580_0030566 3300046472 Bacteria 3899
361 Ga0495580_0114658 3300046472 Bacteria 1872
362 Ga0495582_0013541 3300046473 Bacteria 4491
363 Ga0495582_0103776 3300046473 Bacteria 1593
364 Ga0495662_0002738 3300046476 Bacteria 8908
365 Ga0495662_0010284 3300046476 Bacteria 4586
366 Ga0495662_0226138 3300046476 Bacteria 922
367 Ga0495664_0003195 3300046477 Bacteria 8897
368 Ga0495585_0103279 3300046492 Bacteria 1522
369 Ga0495594_0031966 3300046499 Bacteria 2855
370 Ga0495594_0136107 3300046499 Bacteria 1392
371 Ga0495594_0138606 3300046499 Bacteria 1379
372 Ga0495607_0069964 3300046501 Bacteria 1962
373 Ga0495583_0022213 3300046506 Bacteria 3243
374 Ga0495583_0074848 3300046506 Bacteria 1481
375 Ga0495606_0004805 3300046507 Bacteria 13280
376 Ga0495608_0004783 3300046511 Bacteria 9684
377 Ga0495610_0063392 3300046512 Bacteria 1750
378 Ga0495616_0013185 3300046513 Bacteria 4670
379 Ga0495618_0118948 3300046514 Bacteria 1692
380 Ga0495620_0001179 3300046515 Bacteria 16001
381 Ga0495620_0004461 3300046515 Bacteria 7885
382 Ga0495620_0018122 3300046515 Bacteria 3492
383 Ga0495628_0044346 3300046516 Bacteria 3539
384 Ga0495628_0091481 3300046516 Bacteria 2354
385 Ga0495630_0111222 3300046517 Bacteria 2075
386 Ga0495631_0032324 3300046518 Bacteria 2360
387 Ga0495632_0074653 3300046519 Bacteria 1624
388 Ga0495666_0036041 3300046526 Bacteria 2409
389 Ga0495652_0030604 3300046529 Bacteria 4719
390 Ga0495652_0066264 3300046529 Bacteria 3031
391 Ga0495652_0268641 3300046529 Bacteria 1255
392 Ga0495654_0128870 3300046530 Bacteria 1138
393 Ga0495665_0012080 3300046531 Bacteria 4675
394 Ga0495665_0037615 3300046531 Bacteria 2582
395 Ga0495640_0024818 3300046533 Bacteria 4355
396 Ga0495640_0045740 3300046533 Bacteria 3037
397 Ga0495640_0260234 3300046533 Bacteria 1084
398 Ga0495586_0038016 3300046535 Bacteria 2584
399 Ga0495587_0003896 3300046536 Bacteria 9901
400 Ga0495587_0009303 3300046536 Bacteria 6303
401 Ga0495598_0015743 3300046537 Bacteria 1916
402 Ga0495621_0030879 3300046539 Bacteria 1834
403 Ga0495597_0023607 3300046542 Bacteria 2844
404 Ga0495645_0028098 3300046543 Bacteria 4086
405 Ga0495645_0032423 3300046543 Bacteria 3811
406 Ga0495645_0169134 3300046543 Bacteria 1505
407 Ga0495622_0007858 3300046557 Bacteria 4949
408 Ga0495667_0000402 3300046559 Bacteria 27723
409 Ga0495667_0029993 3300046559 Bacteria 3657
410 Ga0495667_0200542 3300046559 Bacteria 1277
411 Ga0495656_0020545 3300046615 Bacteria 2563
412 Ga0495656_0069864 3300046615 Bacteria 1557
413 Ga0495656_0125319 3300046615 Bacteria 1217
414 Ga0495656_0152308 3300046615 Bacteria 1118
415 Ga0495668_0000360 3300046616 Bacteria 60235
416 Ga0495668_0014227 3300046616 Bacteria 4671
417 Ga0495668_0229307 3300046616 Bacteria 1017
418 Ga0495634_0009470 3300046642 Bacteria 7183
419 Ga0495634_0151866 3300046642 Bacteria 1464
420 Ga0495611_0095848 3300046648 Bacteria 1373
421 Ga0495625_0022500 3300046660 Bacteria 4832
422 Ga0495625_0025631 3300046660 Bacteria 4469
423 Ga0495625_0254465 3300046660 Bacteria 1139
424 Ga0495635_0070706 3300046663 Bacteria 2392
425 Ga0495635_0180113 3300046663 Bacteria 1436
426 Ga0495635_0219770 3300046663 Bacteria 1285
427 Ga0495635_0242347 3300046663 Bacteria 1216
428 Ga0495588_0021027 3300046674 Bacteria 3212
429 Ga0495657_0000206 3300046675 Bacteria 52948
430 Ga0495657_0041189 3300046675 Bacteria 3163
431 Ga0495657_0141715 3300046675 Bacteria 1498
432 Ga0495646_0007542 3300046680 Bacteria 6913
433 Ga0495646_0057100 3300046680 Bacteria 2338
434 Ga0495613_0000367 3300046689 Bacteria 39278
435 Ga0495613_0001326 3300046689 Bacteria 18918
436 Ga0495624_0071602 3300046690 Bacteria 2157
437 Ga0495624_0261162 3300046690 Bacteria 1046
438 Ga0495670_0189227 3300046691 Bacteria 1088
439 Ga0495671_0016857 3300046692 Bacteria 3894
440 Ga0495589_0027582 3300046794 Bacteria 2871
441 Ga0495600_0014480 3300046809 Bacteria 4969
442 Ga0495600_0045170 3300046809 Bacteria 2874
443 Ga0495600_0071668 3300046809 Bacteria 2263
444 Ga0495660_0081780 3300046810 Bacteria 1692
445 Ga0495581_0004793 3300047315 Bacteria 7819
446 Ga0495581_0011256 3300047315 Bacteria 5173
447 Ga0495581_0016467 3300047315 Bacteria 4297
448 Ga0495581_0022959 3300047315 Bacteria 3613
449 Ga0495581_0072907 3300047315 Bacteria 1987
450 Ga0495581_0103739 3300047315 Bacteria 1652
451 Ga0495581_0113894 3300047315 Bacteria 1573
452 Ga0495581_0285079 3300047315 Bacteria 965
453 Ga0495604_0002982 3300047317 Bacteria 13553
454 Ga0495604_0029703 3300047317 Bacteria 4348
455 Ga0495674_0022245 3300047319 Bacteria 5846
456 Ga0495676_0003572 3300047321 Bacteria 14105
457 Ga0495676_0036943 3300047321 Bacteria 4072
458 Ga0495676_0039869 3300047321 Bacteria 3884
459 Ga0495676_0051383 3300047321 Bacteria 3298
460 Ga0495680_0090308 3300047322 Bacteria 2298
461 Ga0495683_0032612 3300047323 Bacteria 2652
462 Ga0495683_0057043 3300047323 Bacteria 1941
463 Ga0495687_005511 3300047443 Bacteria 8035
464 Ga0495687_012184 3300047443 Bacteria 4562
465 Ga0495687_044913 3300047443 Bacteria 1917
466 Ga0495687_080310 3300047443 Bacteria 1279
467 Ga0495675_0045533 3300047444 Bacteria 2793
468 Ga0495685_057869 3300047447 Bacteria 1309
469 Ga0495673_0092469 3300047469 Bacteria 1234
470 Ga0495681_0000253 3300047470 Bacteria 43616
471 Ga0495684_0301623 3300047471 Bacteria 1150
472 Ga0495686_0092048 3300047472 Bacteria 1840
473 Ga0495686_0282525 3300047472 Bacteria 922
474 Ga0495593_0020878 3300047673 Bacteria 3662
475 Ga0495593_0025064 3300047673 Bacteria 3300
476 Ga0495593_0049420 3300047673 Bacteria 2231
477 Ga0495614_0004541 3300048089 Bacteria 6256
478 Ga0495614_0023141 3300048089 Bacteria 2679
479 Ga0495626_0008479 3300048091 Bacteria 5631
480 Ga0496102_0040056 3300048905 Bacteria 4237
481 Ga0496102_0162700 3300048905 Bacteria 2099
482 Ga0496102_0237422 3300048905 Bacteria 1719
483 Ga0496103_0031930 3300048906 Bacteria 3212
484 Ga0496103_0180870 3300048906 Bacteria 1355
485 Ga0496103_0206905 3300048906 Bacteria 1262
486 Ga0496103_0250639 3300048906 Bacteria 1139
487 Ga0496104_0003058 3300048907 Bacteria 14421
488 Ga0496104_0104230 3300048907 Bacteria 2717
489 Ga0496105_0046766 3300048908 Bacteria 3571
490 Ga0496105_0054451 3300048908 Bacteria 3303
491 Ga0496105_0144649 3300048908 Bacteria 1955
492 Ga0496106_0465515 3300048909 Bacteria 1015
493 Ga0496107_0033172 3300048910 Bacteria 3694
494 Ga0496107_0103815 3300048910 Bacteria 2086
495 Ga0496108_0000100 3300048911 Bacteria 89095
496 Ga0496108_0211814 3300048911 Bacteria 1682
497 Ga0496110_0042786 3300048913 Bacteria 3954
498 Ga0496112_0135018 3300048915 Bacteria 2438
499 Ga0496113_0144758 3300048916 Bacteria 1871
500 Ga0496113_0255062 3300048916 Bacteria 1401
501 Ga0496113_0495337 3300048916 Bacteria 981
502 Ga0496114_0045297 3300048917 Bacteria 3653
503 Ga0496114_0048331 3300048917 Bacteria 3539
504 Ga0496114_0155028 3300048917 Bacteria 1988
505 Ga0496115_0354322 3300048918 Bacteria 1196
506 Ga0496115_0412722 3300048918 Bacteria 1094
507 Ga0496116_0109688 3300048919 Bacteria 1626
508 Ga0496117_0000394 3300048920 Bacteria 74632
509 Ga0496117_0008044 3300048920 Bacteria 10109
510 Ga0496117_0070251 3300048920 Bacteria 2353
511 Ga0496117_0184411 3300048920 Bacteria 1196
512 Ga0496118_0037908 3300048921 Bacteria 3871
513 Ga0496118_0084493 3300048921 Bacteria 2214
514 Ga0496119_0000605 3300048922 Bacteria 48474
515 Ga0496120_0002952 3300048923 Bacteria 16205
516 Ga0496120_0047737 3300048923 Bacteria 2467
517 Ga0496122_0011187 3300048925 Bacteria 9131
518 Ga0496122_0029005 3300048925 Bacteria 4679
519 Ga0496122_0033605 3300048925 Bacteria 4215
520 Ga0496122_0072498 3300048925 Bacteria 2448
521 Ga0496122_0091889 3300048925 Bacteria 2065
522 Ga0496123_0005519 3300048926 Bacteria 12698
523 Ga0496124_0104903 3300048927 Bacteria 2285
524 Ga0496125_0012426 3300048928 Bacteria 8453
525 Ga0496125_0027233 3300048928 Bacteria 5185
526 Ga0496125_0092225 3300048928 Bacteria 2265
527 Ga0496125_0130172 3300048928 Bacteria 1773
528 Ga0496126_0016360 3300048929 Bacteria 7420
529 Ga0496126_0042168 3300048929 Bacteria 4216
530 Ga0496126_0150392 3300048929 Bacteria 1996
531 Ga0496126_0175586 3300048929 Bacteria 1822
532 Ga0501031_0043036 3300049568 Bacteria 2948
533 Ga0501032_0021647 3300049569 Bacteria 4468
534 Ga0501032_0047557 3300049569 Bacteria 2896
535 Ga0501032_0110366 3300049569 Bacteria 1820
536 Ga0501033_0000203 3300049570 Bacteria 56963
537 Ga0501033_0000422 3300049570 Bacteria 40484
538 Ga0501033_0004260 3300049570 Bacteria 11503
539 Ga0501033_0019120 3300049570 Bacteria 5179
540 Ga0501033_0118334 3300049570 Bacteria 1924
541 Ga0501033_0266013 3300049570 Bacteria 1213
542 Ga0501034_0000042 3300049571 Bacteria 229124
543 Ga0501034_0001033 3300049571 Bacteria 39834
544 Ga0501034_0010152 3300049571 Bacteria 9825
545 Ga0501034_0012846 3300049571 Bacteria 8637
546 Ga0501034_0023839 3300049571 Bacteria 6231
547 Ga0501034_0036310 3300049571 Bacteria 4992
548 Ga0501034_0077122 3300049571 Bacteria 3338
549 Ga0501034_0132802 3300049571 Bacteria 2472
550 Ga0501034_0139401 3300049571 Bacteria 2405
551 Ga0501034_0346388 3300049571 Bacteria 1415
552 Ga0501036_0007959 3300049572 Bacteria 8675
553 Ga0501036_0014204 3300049572 Bacteria 6625
554 Ga0501036_0055755 3300049572 Bacteria 3348
555 Ga0501036_0071418 3300049572 Bacteria 2935
556 Ga0501036_0119416 3300049572 Bacteria 2226
557 Ga0501037_0000225 3300049573 Bacteria 49210
558 Ga0501037_0011416 3300049573 Bacteria 6535
559 Ga0501037_0012159 3300049573 Bacteria 6335
560 Ga0501037_0021352 3300049573 Bacteria 4783
561 Ga0501037_0023217 3300049573 Bacteria 4587
562 Ga0501037_0112354 3300049573 Bacteria 1962
563 Ga0501037_0153546 3300049573 Bacteria 1644
564 Ga0501038_0001877 3300049574 Bacteria 19413
565 Ga0501038_0008985 3300049574 Bacteria 9168
566 Ga0501038_0317029 3300049574 Bacteria 1220
567 Ga0501038_0430979 3300049574 Bacteria 1016
568 Ga0501038_0493368 3300049574 Bacteria 937
569 Ga0501038_0575449 3300049574 Bacteria 854
570 Ga0501039_0015717 3300049575 Bacteria 5791
571 Ga0501039_0016214 3300049575 Bacteria 5709
572 Ga0501039_0422712 3300049575 Bacteria 1047
573 Ga0501042_0026205 3300049578 Bacteria 4097
574 Ga0501042_0144767 3300049578 Bacteria 1713
575 Ga0501043_0004371 3300049579 Bacteria 11505
576 Ga0501043_0005999 3300049579 Bacteria 9765
577 Ga0501043_0022390 3300049579 Bacteria 4956
578 Ga0501043_0042724 3300049579 Bacteria 3562
579 Ga0501043_0045475 3300049579 Bacteria 3453
580 Ga0501043_0099302 3300049579 Bacteria 2288
581 Ga0501043_0147350 3300049579 Bacteria 1843
582 Ga0501043_0527595 3300049579 Bacteria 879
583 Ga0501046_0000071 3300049580 Bacteria 107260
584 Ga0501046_0002191 3300049580 Bacteria 18452
585 Ga0501046_0002217 3300049580 Bacteria 18328
586 Ga0501046_0008066 3300049580 Bacteria 9201
587 Ga0501046_0018748 3300049580 Bacteria 5751
588 Ga0501046_0093917 3300049580 Bacteria 2305
589 Ga0501046_0157522 3300049580 Bacteria 1710
590 Ga0501047_0036556 3300049581 Bacteria 4747
591 Ga0501047_0044973 3300049581 Bacteria 4267
592 Ga0501047_0045354 3300049581 Bacteria 4251
593 Ga0501047_0049528 3300049581 Bacteria 4056
594 Ga0501047_0055264 3300049581 Bacteria 3839
595 Ga0501047_0139676 3300049581 Bacteria 2301
596 Ga0501048_0000826 3300049582 Bacteria 22836
597 Ga0501048_0009404 3300049582 Bacteria 7338
598 Ga0501067_0085744 3300049583 Bacteria 1748
599 Ga0501067_0133645 3300049583 Bacteria 1381
600 Ga0501067_0300153 3300049583 Bacteria 894
601 Ga0501070_0000524 3300049586 Bacteria 35215
602 Ga0501070_0000569 3300049586 Bacteria 33672
603 Ga0501070_0001028 3300049586 Bacteria 25074
604 Ga0501070_0003400 3300049586 Bacteria 13815
605 Ga0501070_0048064 3300049586 Bacteria 3545
606 Ga0501070_0141255 3300049586 Bacteria 1988
607 Ga0501070_0192141 3300049586 Bacteria 1678
608 Ga0501070_0230528 3300049586 Bacteria 1517
609 Ga0501070_0298765 3300049586 Bacteria 1312
610 Ga0501071_0008372 3300049587 Bacteria 6834
611 Ga0501072_0031955 3300049588 Bacteria 4121
612 Ga0501072_0273447 3300049588 Bacteria 1344
613 Ga0501073_0020944 3300049589 Bacteria 4716
614 Ga0501073_0035250 3300049589 Bacteria 3558
615 Ga0501073_0172242 3300049589 Bacteria 1498
616 Ga0501074_0016706 3300049590 Bacteria 5326
617 Ga0501077_0155961 3300049593 Bacteria 1449
618 Ga0501080_0000134 3300049742 Bacteria 52384
619 Ga0501080_0076432 3300049742 Bacteria 3114
620 Ga0501080_0096254 3300049742 Bacteria 2748
621 Ga0501083_0059557 3300049744 Bacteria 2554
622 Ga0501035_0011940 3300049822 Bacteria 8039
623 Ga0501035_0013921 3300049822 Bacteria 7422
624 Ga0501035_0031423 3300049822 Bacteria 4836
625 Ga0501035_0342307 3300049822 Bacteria 1253
626 Ga0501044_0032155 3300049823 Bacteria 5516
627 Ga0501044_0035611 3300049823 Bacteria 5211
628 Ga0501044_0052806 3300049823 Bacteria 4184
629 Ga0501044_0106641 3300049823 Bacteria 2813
630 Ga0501044_0166603 3300049823 Bacteria 2177
631 Ga0501044_0281133 3300049823 Bacteria 1598
632 Ga0501045_0009279 3300049824 Bacteria 6881
633 Ga0501045_0084610 3300049824 Bacteria 2340
634 nmdc:mga00v17_144910_c1 3300050491 Bacteria 1524
635 nmdc:mga00v17_1997_c1 3300050491 Bacteria 10521
636 nmdc:mga00v17_403171_c1 3300050491 Bacteria 889
637 nmdc:mga00v17_85220_c1 3300050491 Bacteria 1978
638 nmdc:mga0yw44_30856_c1 3300050492 Bacteria 3112
639 nmdc:mga0yw44_359986_c1 3300050492 Bacteria 980
640 nmdc:mga0yw44_46195_c1 3300050492 Bacteria 2614
641 nmdc:mga0yw44_86862_c1 3300050492 Bacteria 1970
642 nmdc:mga07m45_166704_c1 3300050496 Bacteria 1279
643 nmdc:mga07m45_182575_c1 3300050496 Bacteria 1220
644 nmdc:mga07m45_59229_c1 3300050496 Bacteria 2167
645 nmdc:mga0sz30_1528_c1 3300050516 Bacteria 8242
646 nmdc:mga0sz30_26287_c1 3300050516 Bacteria 2385
647 Ga0500635_0000064 3300053080 Bacteria 70317
648 Ga0500635_0036677 3300053080 Bacteria 1617
649 Ga0495655_0001072 3300053083 Bacteria 4226
650 Ga0495595_0033536 3300053084 Bacteria 2318
651 Ga0495619_0028909 3300053085 Bacteria 3578
652 Ga0500578_0144435 3300053086 Bacteria 1486
653 Ga0500651_0007780 3300053093 Bacteria 6268
654 Ga0500641_0000256 3300053096 Bacteria 19848
655 Ga0500641_0012501 3300053096 Bacteria 3101
656 Ga0500556_0000282 3300053104 Bacteria 39873
657 Ga0500560_000276 3300053107 Bacteria 6448
658 Ga0500562_000728 3300053108 Bacteria 7976
659 Ga0500593_000801 3300053117 Bacteria 11771
660 Ga0500655_005387 3300053133 Bacteria 2309
661 Ga0500559_0000373 3300053136 Bacteria 33009
662 Ga0500559_0007855 3300053136 Bacteria 4710
663 Ga0500568_0003755 3300053139 Bacteria 8317
664 Ga0500573_0002950 3300053140 Bacteria 8678
665 Ga0500573_0024767 3300053140 Bacteria 3451
666 Ga0500573_0187854 3300053140 Bacteria 1106
667 Ga0500590_008902 3300053148 Bacteria 5029
668 Ga0500616_0000010 3300053153 Bacteria 761410
669 Ga0500616_0000089 3300053153 Bacteria 191075
670 Ga0500616_0002518 3300053153 Bacteria 15160
671 Ga0500620_001350 3300053155 Bacteria 4470
672 Ga0500624_001992 3300053157 Bacteria 2894
673 Ga0500645_010320 3300053730 Bacteria 3095
674 Ga0500645_023345 3300053730 Bacteria 1896
675 Ga0501084_0363005 3300054114 Bacteria 1224
676 Ga0590075_047614 3300059424 Bacteria 1099
677 Ga0587084_000001 3300059477 Bacteria 25091
678 Ga0587070_003876 3300059491 Bacteria 1843
679 Ga0587077_000012 3300059493 Bacteria 7540
680 Ga0587085_000135 3300059506 Bacteria 4021
681 Ga0587086_000121 3300059507 Bacteria 4082
682 Ga0587088_000056 3300059508 Bacteria 5596
683 Ga0587090_000385 3300059510 Bacteria 3556
684 Ga0587091_000248 3300059511 Bacteria 4013
685 Ga0587092_000031 3300059512 Bacteria 7735
686 Ga0587094_000035 3300059513 Bacteria 6016
687 Ga0587101_000017 3300059623 Bacteria 7819
688 Ga0587117_006144 3300059627 Bacteria 1328
689 Ga0587127_000551 3300059629 Bacteria 1771
690 Ga0587130_000142 3300059631 Bacteria 3639
691 Ga0587069_000061 3300059642 Bacteria 5440
692 Ga0587100_000016 3300059648 Bacteria 5421
693 Ga0587124_000076 3300059660 Bacteria 3643
694 Ga0587111_0000048 3300060346 Bacteria 7389
695 Ga0501082_0316856 3300060353 Bacteria 1359
696 Ga0530510_0323323 3300061734 Bacteria 1157
697 2946043353 2946041624 Bacteria 4191385
698 2523384334 2523231044 Bacteria 6434991
699 2537899229 2537561592 Bacteria 4348607
700 2559425556 2558860280 Bacteria 11429938
701 2566993830 2565956761 Bacteria 6601618
702 2585297155 2582581312 Bacteria 7308206
703 2585310760 2582581313 Bacteria 10042643
704 2588109082 2585428157 Bacteria 3018951
705 2616696124 2616644814 Bacteria 11555299
706 2623500618 2622736605 Bacteria 4992138
707 2643734962 2643221542 Bacteria 3563959
708 2643753322 2643221546 Bacteria 2910897
709 2643768978 2643221549 Bacteria 4042819
710 2643783427 2643221553 Bacteria 3544260
711 2643851247 2643221567 Bacteria 4163945
712 2643877045 2643221572 Bacteria 3614809
713 2643888358 2643221575 Bacteria 4022601
714 2643892860 2643221576 Bacteria 5214352
715 2643962309 2643221590 Bacteria 5214697
716 2643995000 2643221597 Bacteria 3347721
717 2644031882 2643221604 Bacteria 5014917
718 2644096630 2643221616 Bacteria 4066575
719 2644102809 2643221617 Bacteria 5139111
720 2644112404 2643221619 Bacteria 4158469
721 2644118471 2643221620 Bacteria 5134593
722 2644138118 2643221624 Bacteria 4384879
723 2644173122 2643221630 Bacteria 3601215
724 2644279684 2643221649 Bacteria 3867359
725 2644384100 2643221669 Bacteria 3611286
726 2644491464 2643221687 Bacteria 6500351
727 2644539117 2643221697 Bacteria 3575694
728 2644679333 2643221724 Bacteria 3593515
729 2655033417 2654587600 Bacteria 3911798
730 2730228852 2728369380 Bacteria 3620317
731 2738696292 2738541272 Bacteria 6848551
732 2739603329 2739367653 Bacteria 2780952
733 2739607616 2739367654 Bacteria 6049412
734 2740169542 2739367898 Bacteria 4367674
735 2747954324 2747842429 Bacteria 3914386
736 2753263784 2751185782 Bacteria 11227053
737 2753303322 2751185788 Bacteria 4541048
738 2760623853 2758568621 Bacteria 5967089
739 2774381890 2773857758 Bacteria 3592392
740 2774400400 2773857763 Bacteria 4180068
741 2785338888 2784746763 Bacteria 9783172
742 2804847151 2802429296 Bacteria 7227771
743 2808629854 2808606306 Bacteria 3608896
744 2808900546 2808606372 Bacteria 4649509
745 2809026496 2808606394 Bacteria 6248540
746 2810362858 2808606700 Bacteria 3482157
747 2812354923 2811994879 Bacteria 9313447
748 2812483449 2811994917 Bacteria 7761064
749 2817508119 2816332305 Bacteria 2697803
750 2821268863 2821268502 Bacteria 3750023
751 2833709695 2833709550 Bacteria 4008291
752 2844843168 2844841374 Bacteria 3917147
753 2852633855 2852632344 Bacteria 3463163
754 2852648003 2852646457 Bacteria 3408613
755 2852665727 2852663356 Bacteria 4090475
756 2857479192 2857479173 Bacteria 2469263
757 2857632804 2857632687 Bacteria 2448521
758 2857727161 2857723135 Bacteria 4217853
759 2857727405 2857727296 Bacteria 2745552
760 2857739644 2857737099 Bacteria 3104305
761 2862515615 2862507626 Bacteria 9425308
762 2863407732 2863404153 Bacteria 9672205
763 2866612606 2866612099 Bacteria 7543886
764 2868090310 2868088558 Bacteria 7609351
765 2870804147 2870801768 Bacteria 2710986
766 2870806006 2870804320 Bacteria 2552467
767 2884766153 2884763398 Bacteria 4091164
768 2895662173 2895660088 Bacteria 3782833
769 2897562360 2897561785 Bacteria 3256946
770 2899361575 2899359706 Bacteria 10940472
771 2904511379 2904509784 Bacteria 3520416
772 2904536920 2904535858 Bacteria 6308016
773 2905929399 2905926851 Bacteria 4423176
774 2908679902 2908678064 Bacteria 3482747
775 2908815514 2908811453 Bacteria 5478616
776 2910814430 2910809715 Bacteria 4982797
777 2919038221 2919034639 Bacteria 4763403
778 2919053513 2919051321 Bacteria 4210889
779 2919058657 2919055335 Bacteria 3875751
780 2919072829 2919069694 Bacteria 3622919
781 2919393525 2919391150 Bacteria 4884741
782 2919445129 2919443155 Bacteria 4072969
783 2919448308 2919446982 Bacteria 3994487
784 2919541155 2919538618 Bacteria 4677069
785 2920881380 2920879853 Bacteria 4216831
786 2922555343 2922554459 Bacteria 6683962
787 2928146591 2928142448 Bacteria 5288925
788 2928153305 2928153084 Bacteria 4020257
789 2932427298 2932426870 Bacteria 4547726
790 2935411671 2935409751 Bacteria 4179611
791 2939582743 2939582691 Bacteria 7088898
792 2939659606 2939657138 Bacteria 3740283
793 2939661207 2939660829 Bacteria 3784848
794 2939676851 2939674588 Bacteria 4844420
795 2945960523 2945956166 Bacteria 5110334
796 2945969265 2945968032 Bacteria 4111363
797 2946005808 2946003308 Bacteria 3857229
798 2946025012 2946024296 Bacteria 3508095
799 2946034579 2946033335 Bacteria 3835514
800 2946081700 2946080515 Bacteria 4310960
801 2977232031 2977228692 Bacteria 3450105
802 2977237386 2977236895 Bacteria 3569373
803 2977267378 2977264416 Bacteria 3750737
804 2984544829 2984542743 Bacteria 3569378
805 2984578109 2984576629 Bacteria 4248407
806 2990257623 2990256926 Bacteria 4252839
807 8004025644 8004025490 Bacteria 4327753
808 8004183679 8004182704 Bacteria 3391155
809 8004215425 8004212874 Bacteria 2861420
810 8025414379 8025413630 Bacteria 7014048
811 8055039726 8055037949 Bacteria 3337834
812 8055181567 8055172936 Bacteria 9305943
813 8056582505 8056579771 Bacteria 5840325
814 8057346269 8057345674 Bacteria 4160394
815 JGI25164J39214_1000649
816 JGI25165J46597_1000174
817 rootL2_10035491
818 rootH1_10055294
819 Ga0006562J51391_1111915
820 Ga0006562J51391_1111917
821 Ga0006562J51391_1209490
822 Ga0006562J51391_1209491
823 Ga0055533_1000001
824 Ga0055525_1000330
825 Ga0055542_1000427
826 Ga0055529_1000571
827 Ga0055540_1011213
828 Ga0070658_10009760
829 Ga0070658_10105547
830 Ga0070683_100147207
831 Ga0070683_100274017
832 Ga0070683_100331821
833 Ga0070670_100287151
834 Ga0070670_100293247
835 Ga0068868_100096268
836 Ga0068868_100268046
837 Ga0070660_100054836
838 Ga0070660_100267364
839 Ga0070668_100000560
840 Ga0070668_100044032
841 Ga0070659_100000749
842 Ga0070667_100049296
843 Ga0070685_10033968
844 Ga0070679_100158901
845 Ga0068853_100001645
846 Ga0068853_100199644
847 Ga0070672_100202532
848 Ga0070665_100076240
849 Ga0070665_100115555
850 Ga0068855_100005522
851 Ga0068855_100167483
852 Ga0068855_100318733
853 Ga0068857_100001028
854 Ga0068857_100049400
855 Ga0068854_100001906
856 Ga0068856_100193332
857 Ga0068852_100003952
858 Ga0068852_100012604
859 Ga0068852_100035556
860 Ga0068852_100151450
861 Ga0068864_100042847
862 Ga0068864_100210238
863 Ga0068851_10000008
864 Ga0068863_100057676
865 Ga0068858_100000096
866 Ga0068858_100011201
867 Ga0068860_100168878
868 Ga0081455_10008614
869 Ga0081540_1010901
870 Ga0081539_10006285
871 Ga0075365_10000074
872 Ga0075365_10001691
873 Ga0075365_10095488
874 Ga0075365_10346357
875 Ga0075363_100062469
876 Ga0075364_10009137
877 Ga0075364_10053696
878 Ga0075364_10110763
879 Ga0075364_10120647
880 Ga0075364_10182612
881 Ga0075364_10235609
882 Ga0075432_10008430
883 Ga0075367_10014844
884 Ga0075370_10074719
885 Ga0075370_10097603
886 Ga0105240_10099808
887 Ga0105240_10424377
888 Ga0111539_10258735
889 Ga0105245_10071744
890 Ga0105245_10117434
891 Ga0105245_10502714
892 Ga0105243_10060287
893 Ga0105243_10442023
894 Ga0105241_10006075
895 Ga0105241_10020164
896 Ga0105248_10000713
897 Ga0105248_10036889
898 Ga0105237_10000688
899 Ga0105237_10147307
900 Ga0105237_10153998
901 Ga0105238_10006959
902 Ga0105238_10017275
903 Ga0105238_10055894
904 Ga0105238_10067508
905 Ga0105249_10155161
906 Ga0105239_10113586
907 Ga0105239_10190119
908 Ga0105239_10735083
909 Ga0105246_10113931
910 Ga0157370_10006011
911 Ga0157369_10110300
912 Ga0157369_10143141
913 Ga0171462_1001
914 Ga0163162_10099567
915 Ga0157375_10282440
916 Ga0157375_10324619
917 Ga0163163_10149343
918 Ga0163163_10592093
919 Ga0157380_10006897
920 Ga0157380_10467656
921 Ga0157380_10809113
922 Ga0157379_10042903
923 Ga0157379_10597026
924 Ga0157376_10656637
925 Ga0163161_10319712
926 Ga0206356_10506699
927 Ga0206354_10181118
928 Ga0206353_10162159
929 Ga0206353_11489331
930 Ga0213875_10005353
931 Ga0209566_100053
932 Ga0209674_100001
933 Ga0209672_100039
934 Ga0209147_102885
935 Ga0209563_100001
936 Ga0207427_100010
937 Ga0209646_1000192
938 Ga0209677_100001
939 Ga0209677_100378
940 Ga0209148_1000004
941 Ga0209148_1002409
942 Ga0209233_1000001
943 Ga0209455_1000377
944 Ga0209051_1020243
945 Ga0207656_10000005
946 Ga0207688_10012150
947 Ga0207647_10001411
948 Ga0207643_10053036
949 Ga0207705_10076475
950 Ga0207654_10000001
951 Ga0207654_10029988
952 Ga0207695_10009355
953 Ga0207695_10019929
954 Ga0207671_10000016
955 Ga0207671_10001866
956 Ga0207671_10114909
957 Ga0207657_10023164
958 Ga0207657_10227729
959 Ga0207652_10136467
960 Ga0207652_10342280
961 Ga0207681_10103573
962 Ga0207694_10000196
963 Ga0207694_10285495
964 Ga0207650_10299270
965 Ga0207687_10042745
966 Ga0207690_10002298
967 Ga0207709_10022715
968 Ga0207691_10268967
969 Ga0207711_10135194
970 Ga0207661_10017840
971 Ga0207661_10140936
972 Ga0207661_10194858
973 Ga0207667_10001482
974 Ga0207667_10397099
975 Ga0207712_10239305
976 Ga0207668_10000481
977 Ga0207668_10208879
978 Ga0207640_10233276
979 Ga0207677_10029357
980 Ga0207677_10245924
981 Ga0207703_10001625
982 Ga0207639_10040609
983 Ga0207639_10103246
984 Ga0207678_10628044
985 Ga0207702_10054536
986 Ga0207702_10182105
987 Ga0207641_10010811
988 Ga0207676_10118215
989 Ga0207676_10174425
990 Ga0207674_10000405
991 Ga0207674_10221300
992 Ga0207675_100095849
993 Ga0207683_10114464
994 Ga0207698_10000078
995 Ga0207698_10002196
996 Ga0207698_10021148
997 Ga0207428_10053527
998 Ga0268266_10070008
999 Ga0268266_10161904
1000 Ga0268266_10363727
1001 Ga0268265_10036705
1002 Ga0268265_10161472
1003 Ga0307517_10005202
1004 Ga0307517_10050934
1005 Ga0307515_10000189
1006 Ga0307515_10000436
1007 Ga0307515_10026558
1008 Ga0307515_10041387
1009 Ga0307515_10100480
1010 Ga0307515_10149291
1011 Ga0307515_10214310
1012 Ga0307511_10000194
1013 Ga0307511_10000824
1014 Ga0307511_10075469
1015 Ga0307512_10007529
1016 Ga0307512_10011457
1017 Ga0307512_10151248
1018 Ga0307513_10001658
1019 Ga0307513_10003959
1020 Ga0307513_10040155
1021 Ga0307509_10013932
1022 Ga0307509_10022228
1023 Ga0307509_10025555
1024 Ga0307509_10061064
1025 Ga0307509_10080593
1026 Ga0307509_10103294
1027 Ga0307408_100034128
1028 Ga0307408_100139192
1029 Ga0307408_100157919
1030 Ga0307508_10003658
1031 Ga0307508_10061681
1032 Ga0307508_10078310
1033 Ga0307508_10100940
1034 Ga0307508_10148644
1035 Ga0307514_10063841
1036 Ga0307516_10005460
1037 Ga0307516_10045235
1038 Ga0307516_10064212
1039 Ga0307516_10106039
1040 Ga0307405_10185122
1041 Ga0307413_10039100
1042 Ga0307413_10115553
1043 Ga0307413_10286025
1044 Ga0307413_10625090
1045 Ga0307518_10000412
1046 Ga0307518_10175499
1047 Ga0307410_10018744
1048 Ga0307410_10021437
1049 Ga0307410_10138062
1050 Ga0307410_10138325
1051 Ga0307410_10369755
1052 Ga0307406_10001204
1053 Ga0307406_10052440
1054 Ga0307406_10072553
1055 Ga0307406_10137549
1056 Ga0307406_10427058
1057 Ga0307407_10199789
1058 Ga0307407_10267718
1059 Ga0307412_10024159
1060 Ga0307412_10057256
1061 Ga0307412_10392120
1062 Ga0307409_100006047
1063 Ga0307409_100288224
1064 Ga0307409_100327823
1065 Ga0307416_100002272
1066 Ga0307416_100225247
1067 Ga0307416_100317519
1068 Ga0307416_100456828
1069 Ga0307414_10066312
1070 Ga0307414_10117497
1071 Ga0307414_10219748
1072 Ga0307414_10392665
1073 Ga0307411_10083770
1074 Ga0307411_10310014
1075 Ga0307415_100369478
1076 Ga0307507_10009303
1077 Ga0307507_10023801
1078 Ga0307507_10057799
1079 Ga0307507_10082816
1080 Ga0307507_10165311
1081 Ga0307507_10188201
1082 Ga0307510_10033562
1083 Ga0307510_10103362
1084 Ga0307510_10206826
1085 Ga0316214_1002008
1086 Ga0373938_0011954
1087 Ga0373940_0001334
1088 Ga0373942_0001388
1089 Ga0373962_0000420
1090 Ga0395899_0011272
1091 Ga0395899_0020111
1092 Ga0395899_0046544
1093 Ga0395899_0050283
1094 Ga0395900_0054877
1095 Ga0395900_0088650
1096 Ga0395900_0116325
1097 Ga0395900_0269495
1098 Ga0395898_0000256
1099 Ga0395898_0003736
1100 Ga0395898_0006023
1101 Ga0395898_0009444
1102 Ga0395898_0038380
1103 Ga0395898_0076921
1104 Ga0395898_0232569
1105 Ga0395905_0034166
1106 Ga0395905_0445427
1107 Ga0436364_0891096
1108 Ga0395901_0001692
1109 Ga0395901_0005007
1110 Ga0395901_0023278
1111 Ga0395901_0095473
1112 Ga0395901_0098948
1113 Ga0395901_0144104
1114 Ga0395901_0288080
1115 Ga0395901_0382965
1116 Ga0395901_0412286
1117 Ga0439436_0020261
1118 Ga0451837_0641337
1119 Ga0439433_0007739
1120 Ga0439449_0035166
1121 Ga0439449_0038334
1122 Ga0439457_002025
1123 Ga0439458_0051848
1124 Ga0466969_0009413
1125 Ga0466969_0044415
1126 Ga0466969_0152838
1127 Ga0466972_0023059
1128 Ga0466972_0057218
1129 Ga0466965_0004730
1130 Ga0466965_0024111
1131 Ga0466965_0105219
1132 Ga0466966_0017223
1133 Ga0466966_0060069
1134 Ga0466966_0103107
1135 Ga0466961_0018907
1136 Ga0466961_0105952
1137 Ga0466963_0050792
1138 Ga0466968_0001871
1139 Ga0466968_0005778
1140 Ga0466970_0036417
1141 Ga0466970_0044839
1142 Ga0466970_0062493
1143 Ga0466970_0236514
1144 Ga0466957_0020653
1145 Ga0466960_0023405
1146 Ga0466960_0024039
1147 Ga0466960_0031329
1148 Ga0466960_0044342
1149 Ga0466960_0173329
1150 Ga0466959_0005086
1151 Ga0466959_0019351
1152 Ga0466959_0274148
1153 Ga0466958_0052816
1154 Ga0466958_0069880
1155 Ga0466958_0170159
1156 Ga0466967_0000584
1157 Ga0466967_0014483
1158 Ga0466967_0081394
1159 Ga0466967_0289063
1160 Ga0466967_0372360
1161 Ga0466967_0603939
1162 Ga0495627_000352
1163 Ga0495627_010387
1164 Ga0495592_0042075
1165 Ga0495603_0116803
1166 Ga0495590_0000075
1167 Ga0495629_0003756
1168 Ga0495629_0006664
1169 Ga0495629_0014354
1170 Ga0495638_0145539
1171 Ga0495651_0033791
1172 Ga0495651_0278319
1173 Ga0495650_0000558
1174 Ga0495580_0030566
1175 Ga0495580_0114658
1176 Ga0495582_0013541
1177 Ga0495582_0103776
1178 Ga0495662_0002738
1179 Ga0495662_0010284
1180 Ga0495662_0226138
1181 Ga0495664_0003195
1182 Ga0495585_0103279
1183 Ga0495594_0031966
1184 Ga0495594_0136107
1185 Ga0495594_0138606
1186 Ga0495607_0069964
1187 Ga0495583_0022213
1188 Ga0495583_0074848
1189 Ga0495606_0004805
1190 Ga0495608_0004783
1191 Ga0495610_0063392
1192 Ga0495616_0013185
1193 Ga0495618_0118948
1194 Ga0495620_0001179
1195 Ga0495620_0004461
1196 Ga0495620_0018122
1197 Ga0495628_0044346
1198 Ga0495628_0091481
1199 Ga0495630_0111222
1200 Ga0495631_0032324
1201 Ga0495632_0074653
1202 Ga0495666_0036041
1203 Ga0495652_0030604
1204 Ga0495652_0066264
1205 Ga0495652_0268641
1206 Ga0495654_0128870
1207 Ga0495665_0012080
1208 Ga0495665_0037615
1209 Ga0495640_0024818
1210 Ga0495640_0045740
1211 Ga0495640_0260234
1212 Ga0495586_0038016
1213 Ga0495587_0003896
1214 Ga0495587_0009303
1215 Ga0495598_0015743
1216 Ga0495621_0030879
1217 Ga0495597_0023607
1218 Ga0495645_0028098
1219 Ga0495645_0032423
1220 Ga0495645_0169134
1221 Ga0495622_0007858
1222 Ga0495667_0000402
1223 Ga0495667_0029993
1224 Ga0495667_0200542
1225 Ga0495656_0020545
1226 Ga0495656_0069864
1227 Ga0495656_0125319
1228 Ga0495656_0152308
1229 Ga0495668_0000360
1230 Ga0495668_0014227
1231 Ga0495668_0229307
1232 Ga0495634_0009470
1233 Ga0495634_0151866
1234 Ga0495611_0095848
1235 Ga0495625_0022500
1236 Ga0495625_0025631
1237 Ga0495625_0254465
1238 Ga0495635_0070706
1239 Ga0495635_0180113
1240 Ga0495635_0219770
1241 Ga0495635_0242347
1242 Ga0495588_0021027
1243 Ga0495657_0000206
1244 Ga0495657_0041189
1245 Ga0495657_0141715
1246 Ga0495646_0007542
1247 Ga0495646_0057100
1248 Ga0495613_0000367
1249 Ga0495613_0001326
1250 Ga0495624_0071602
1251 Ga0495624_0261162
1252 Ga0495670_0189227
1253 Ga0495671_0016857
1254 Ga0495589_0027582
1255 Ga0495600_0014480
1256 Ga0495600_0045170
1257 Ga0495600_0071668
1258 Ga0495660_0081780
1259 Ga0495581_0004793
1260 Ga0495581_0011256
1261 Ga0495581_0016467
1262 Ga0495581_0022959
1263 Ga0495581_0072907
1264 Ga0495581_0103739
1265 Ga0495581_0113894
1266 Ga0495581_0285079
1267 Ga0495604_0002982
1268 Ga0495604_0029703
1269 Ga0495674_0022245
1270 Ga0495676_0003572
1271 Ga0495676_0036943
1272 Ga0495676_0039869
1273 Ga0495676_0051383
1274 Ga0495680_0090308
1275 Ga0495683_0032612
1276 Ga0495683_0057043
1277 Ga0495687_005511
1278 Ga0495687_012184
1279 Ga0495687_044913
1280 Ga0495687_080310
1281 Ga0495675_0045533
1282 Ga0495685_057869
1283 Ga0495673_0092469
1284 Ga0495681_0000253
1285 Ga0495684_0301623
1286 Ga0495686_0092048
1287 Ga0495686_0282525
1288 Ga0495593_0020878
1289 Ga0495593_0025064
1290 Ga0495593_0049420
1291 Ga0495614_0004541
1292 Ga0495614_0023141
1293 Ga0495626_0008479
1294 Ga0496102_0040056
1295 Ga0496102_0162700
1296 Ga0496102_0237422
1297 Ga0496103_0031930
1298 Ga0496103_0180870
1299 Ga0496103_0206905
1300 Ga0496103_0250639
1301 Ga0496104_0003058
1302 Ga0496104_0104230
1303 Ga0496105_0046766
1304 Ga0496105_0054451
1305 Ga0496105_0144649
1306 Ga0496106_0465515
1307 Ga0496107_0033172
1308 Ga0496107_0103815
1309 Ga0496108_0000100
1310 Ga0496108_0211814
1311 Ga0496110_0042786
1312 Ga0496112_0135018
1313 Ga0496113_0144758
1314 Ga0496113_0255062
1315 Ga0496113_0495337
1316 Ga0496114_0045297
1317 Ga0496114_0048331
1318 Ga0496114_0155028
1319 Ga0496115_0354322
1320 Ga0496115_0412722
1321 Ga0496116_0109688
1322 Ga0496117_0000394
1323 Ga0496117_0008044
1324 Ga0496117_0070251
1325 Ga0496117_0184411
1326 Ga0496118_0037908
1327 Ga0496118_0084493
1328 Ga0496119_0000605
1329 Ga0496120_0002952
1330 Ga0496120_0047737
1331 Ga0496122_0011187
1332 Ga0496122_0029005
1333 Ga0496122_0033605
1334 Ga0496122_0072498
1335 Ga0496122_0091889
1336 Ga0496123_0005519
1337 Ga0496124_0104903
1338 Ga0496125_0012426
1339 Ga0496125_0027233
1340 Ga0496125_0092225
1341 Ga0496125_0130172
1342 Ga0496126_0016360
1343 Ga0496126_0042168
1344 Ga0496126_0150392
1345 Ga0496126_0175586
1346 Ga0501031_0043036
1347 Ga0501032_0021647
1348 Ga0501032_0047557
1349 Ga0501032_0110366
1350 Ga0501033_0000203
1351 Ga0501033_0000422
1352 Ga0501033_0004260
1353 Ga0501033_0019120
1354 Ga0501033_0118334
1355 Ga0501033_0266013
1356 Ga0501034_0000042
1357 Ga0501034_0001033
1358 Ga0501034_0010152
1359 Ga0501034_0012846
1360 Ga0501034_0023839
1361 Ga0501034_0036310
1362 Ga0501034_0077122
1363 Ga0501034_0132802
1364 Ga0501034_0139401
1365 Ga0501034_0346388
1366 Ga0501036_0007959
1367 Ga0501036_0014204
1368 Ga0501036_0055755
1369 Ga0501036_0071418
1370 Ga0501036_0119416
1371 Ga0501037_0000225
1372 Ga0501037_0011416
1373 Ga0501037_0012159
1374 Ga0501037_0021352
1375 Ga0501037_0023217
1376 Ga0501037_0112354
1377 Ga0501037_0153546
1378 Ga0501038_0001877
1379 Ga0501038_0008985
1380 Ga0501038_0317029
1381 Ga0501038_0430979
1382 Ga0501038_0493368
1383 Ga0501038_0575449
1384 Ga0501039_0015717
1385 Ga0501039_0016214
1386 Ga0501039_0422712
1387 Ga0501042_0026205
1388 Ga0501042_0144767
1389 Ga0501043_0004371
1390 Ga0501043_0005999
1391 Ga0501043_0022390
1392 Ga0501043_0042724
1393 Ga0501043_0045475
1394 Ga0501043_0099302
1395 Ga0501043_0147350
1396 Ga0501043_0527595
1397 Ga0501046_0000071
1398 Ga0501046_0002191
1399 Ga0501046_0002217
1400 Ga0501046_0008066
1401 Ga0501046_0018748
1402 Ga0501046_0093917
1403 Ga0501046_0157522
1404 Ga0501047_0036556
1405 Ga0501047_0044973
1406 Ga0501047_0045354
1407 Ga0501047_0049528
1408 Ga0501047_0055264
1409 Ga0501047_0139676
1410 Ga0501048_0000826
1411 Ga0501048_0009404
1412 Ga0501067_0085744
1413 Ga0501067_0133645
1414 Ga0501067_0300153
1415 Ga0501070_0000524
1416 Ga0501070_0000569
1417 Ga0501070_0001028
1418 Ga0501070_0003400
1419 Ga0501070_0048064
1420 Ga0501070_0141255
1421 Ga0501070_0192141
1422 Ga0501070_0230528
1423 Ga0501070_0298765
1424 Ga0501071_0008372
1425 Ga0501072_0031955
1426 Ga0501072_0273447
1427 Ga0501073_0020944
1428 Ga0501073_0035250
1429 Ga0501073_0172242
1430 Ga0501074_0016706
1431 Ga0501077_0155961
1432 Ga0501080_0000134
1433 Ga0501080_0076432
1434 Ga0501080_0096254
1435 Ga0501083_0059557
1436 Ga0501035_0011940
1437 Ga0501035_0013921
1438 Ga0501035_0031423
1439 Ga0501035_0342307
1440 Ga0501044_0032155
1441 Ga0501044_0035611
1442 Ga0501044_0052806
1443 Ga0501044_0106641
1444 Ga0501044_0166603
1445 Ga0501044_0281133
1446 Ga0501045_0009279
1447 Ga0501045_0084610
1448 nmdc:mga00v17_144910_c1
1449 nmdc:mga00v17_1997_c1
1450 nmdc:mga00v17_403171_c1
1451 nmdc:mga00v17_85220_c1
1452 nmdc:mga0yw44_30856_c1
1453 nmdc:mga0yw44_359986_c1
1454 nmdc:mga0yw44_46195_c1
1455 nmdc:mga0yw44_86862_c1
1456 nmdc:mga07m45_166704_c1
1457 nmdc:mga07m45_182575_c1
1458 nmdc:mga07m45_59229_c1
1459 nmdc:mga0sz30_1528_c1
1460 nmdc:mga0sz30_26287_c1
1461 Ga0500635_0000064
1462 Ga0500635_0036677
1463 Ga0495655_0001072
1464 Ga0495595_0033536
1465 Ga0495619_0028909
1466 Ga0500578_0144435
1467 Ga0500651_0007780
1468 Ga0500641_0000256
1469 Ga0500641_0012501
1470 Ga0500556_0000282
1471 Ga0500560_000276
1472 Ga0500562_000728
1473 Ga0500593_000801
1474 Ga0500655_005387
1475 Ga0500559_0000373
1476 Ga0500559_0007855
1477 Ga0500568_0003755
1478 Ga0500573_0002950
1479 Ga0500573_0024767
1480 Ga0500573_0187854
1481 Ga0500590_008902
1482 Ga0500616_0000010
1483 Ga0500616_0000089
1484 Ga0500616_0002518
1485 Ga0500620_001350
1486 Ga0500624_001992
1487 Ga0500645_010320
1488 Ga0500645_023345
1489 Ga0501084_0363005
1490 Ga0590075_047614
1491 Ga0587084_000001
1492 Ga0587070_003876
1493 Ga0587077_000012
1494 Ga0587085_000135
1495 Ga0587086_000121
1496 Ga0587088_000056
1497 Ga0587090_000385
1498 Ga0587091_000248
1499 Ga0587092_000031
1500 Ga0587094_000035
1501 Ga0587101_000017
1502 Ga0587117_006144
1503 Ga0587127_000551
1504 Ga0587130_000142
1505 Ga0587069_000061
1506 Ga0587100_000016
1507 Ga0587124_000076
1508 Ga0587111_0000048
1509 Ga0501082_0316856
1510 Ga0530510_0323323
1511 2946043353
1512 2523384334
1513 2537899229
1514 2559425556
1515 2566993830
1516 2585297155
1517 2585310760
1518 2588109082
1519 2616696124
1520 2623500618
1521 2643734962
1522 2643753322
1523 2643768978
1524 2643783427
1525 2643851247
1526 2643877045
1527 2643888358
1528 2643892860
1529 2643962309
1530 2643995000
1531 2644031882
1532 2644096630
1533 2644102809
1534 2644112404
1535 2644118471
1536 2644138118
1537 2644173122
1538 2644279684
1539 2644384100
1540 2644491464
1541 2644539117
1542 2644679333
1543 2655033417
1544 2730228852
1545 2738696292
1546 2739603329
1547 2739607616
1548 2740169542
1549 2747954324
1550 2753263784
1551 2753303322
1552 2760623853
1553 2774381890
1554 2774400400
1555 2785338888
1556 2804847151
1557 2808629854
1558 2808900546
1559 2809026496
1560 2810362858
1561 2812354923
1562 2812483449
1563 2817508119
1564 2821268863
1565 2833709695
1566 2844843168
1567 2852633855
1568 2852648003
1569 2852665727
1570 2857479192
1571 2857632804
1572 2857727161
1573 2857727405
1574 2857739644
1575 2862515615
1576 2863407732
1577 2866612606
1578 2868090310
1579 2870804147
1580 2870806006
1581 2884766153
1582 2895662173
1583 2897562360
1584 2899361575
1585 2904511379
1586 2904536920
1587 2905929399
1588 2908679902
1589 2908815514
1590 2910814430
1591 2919038221
1592 2919053513
1593 2919058657
1594 2919072829
1595 2919393525
1596 2919445129
1597 2919448308
1598 2919541155
1599 2920881380
1600 2922555343
1601 2928146591
1602 2928153305
1603 2932427298
1604 2935411671
1605 2939582743
1606 2939659606
1607 2939661207
1608 2939676851
1609 2945960523
1610 2945969265
1611 2946005808
1612 2946025012
1613 2946034579
1614 2946081700
1615 2977232031
1616 2977237386
1617 2977267378
1618 2984544829
1619 2984578109
1620 2990257623
1621 8004025644
1622 8004183679
1623 8004215425
1624 8025414379
1625 8055039726
1626 8055181567
1627 8056582505
1628 8057346269

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

225

320

0.99

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

46

223

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

46

146

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lkd-assembly1.cif.gz_A in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor 0.9448 6 35
6aa8-assembly1.cif.gz_F crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ 0.9437 7 268
3hdh-assembly1.cif.gz_B pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination 0.9435 4 268
4r1n-assembly1.cif.gz_A crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum. 0.9423 6 268
6hrd-assembly2.cif.gz_D crystal structure of m. tuberculosis fadb2 (rv0468) 0.9421 4 268
ID Description Score Start End Superfamily
6hrdD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9881 181 264 1.10.1040.10
4kueA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9831 181 264 1.10.1040.10
4kueB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9825 181 264 1.10.1040.10
6acqA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9824 181 264 1.10.1040.10
4kuhF02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9823 181 264 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A537GWX2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9896 120 268 GO:0006631
GO:0016616
GO:0070403
AF-A0A7Y2M4B1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9847 2 270 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A7W0XUR0-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9838 117 268 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A537GIM5-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9829 103 268 GO:0006631
GO:0016616
GO:0070403
AF-A0A7V2TWC1-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9828 118 268 GO:0006635
GO:0008691
GO:0070403

Map