F482003

General Info

Members Datasets Scaffolds Average Seq Length
814 411 1628 328

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2969079654|2969082261
Length 382
Sequence IKLFMFQSGTQHCRYQHIRMNQGVGEHYEIPVPWFLLTHPDGFTLIDGGLAVEGLKDPSGYWGSTVSALGLGCMGLSHGYGPATDTRQAIELIRAGVERGVTFFDTAEVYGPYLNEEVVGEALKPLRERVVIATKFGFTFGNDNRQQILNSRPSHIREAVEGSLRRLKTDVIDLLYQHRVDPDVPIEDVAGTVKDLIAEGKVKHFGLSEAGAQTIRRAHAIQPVAALQSEYSMWWREPEQEILPLLEELGIGFVPFSPLGKGFLTGTIRAGSTFGEDDFRSKVPRFAAQALEANEKLVSLISVIAAENRVTPAQIALAWLLAQKPWIVPIPGTTKLHRLEENLAAAEIQLSPGELEKISRALETVKILGERYPAALQARVGR

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
197 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
198 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
311 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
334 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
335 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
336 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
337 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
338 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
341 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
342 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
347 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
348 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
349 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
350 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
351 2511231004 Pseudomonas sp. GM102 Isolate Nodule
352 2511231023 Pseudomonas sp. GM80 Isolate Nodule
353 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
354 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
355 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
356 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
357 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
358 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
359 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
360 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
361 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
362 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
363 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
364 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
365 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
366 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
367 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
368 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
369 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
370 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
371 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
372 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
373 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
374 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
375 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
376 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
377 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
378 2636415599 Klebsiella variicola DX120E Isolate Unclassified
379 2643221599 Rhizobium sp. Root708 Isolate Unclassified
380 2643221615 Nocardioides sp. Root224 Isolate Unclassified
381 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
382 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
383 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
384 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
385 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
386 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
387 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
388 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
389 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
390 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
391 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
392 2857564685 Duganella sp. R-74599 Isolate Unclassified
393 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
394 2865014394 Pantoea sp. R-71966 Isolate Unclassified
395 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
396 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
397 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
398 2904504865 Serratia marcescens 1822 Isolate Unclassified
399 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
400 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
401 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
402 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
403 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
404 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
405 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
406 8018176218 Rhizobium sp. N122 Isolate Nodule
407 8018221730 Enterobacter sp. CM29 Isolate Unclassified
408 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
409 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
410 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
411 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.77
Metatranscriptomes 0
Isolates 8.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 1.47
Rhizoplane 6.39
Rhizosphere 76.17
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10011974 3300002067 Bacteria 2744
2 JGI24735J21928_10017115 3300002067 Bacteria 2243
3 JGI25162J39368_1000002 3300002737 Bacteria 663004
4 JGI25163J39215_1000043 3300002771 Bacteria 55468
5 JGI25164J39214_1000066 3300002772 Bacteria 106367
6 JGI25406J46586_10001789 3300003203 Bacteria 10099
7 JGI25406J46586_10026758 3300003203 Bacteria 2219
8 Ga0055538_1000003 3300003751 Bacteria 663004
9 Ga0055539_1000003 3300003752 Bacteria 663004
10 Ga0055539_1000836 3300003752 Bacteria 7216
11 Ga0055533_1000005 3300003756 Bacteria 663004
12 Ga0055533_1007646 3300003756 Bacteria 1448
13 Ga0055525_1000005 3300003759 Bacteria 663004
14 Ga0055527_1000037 3300003760 Bacteria 124590
15 Ga0055535_1000059 3300003761 Bacteria 124595
16 Ga0055542_1000086 3300003762 Bacteria 124594
17 Ga0055529_1000231 3300003763 Bacteria 70928
18 Ga0055540_1019204 3300003792 Bacteria 1847
19 Ga0055531_10049763 3300003794 Bacteria 1116
20 Ga0055541_1000003 3300003841 Bacteria 663004
21 Ga0058692_1001201 3300003856 Bacteria 9924
22 Ga0058692_1009243 3300003856 Bacteria 2497
23 Ga0065704_10003190 3300005289 Bacteria 4277
24 Ga0065704_10190575 3300005289 Bacteria 1184
25 Ga0070658_10041386 3300005327 Bacteria 3717
26 Ga0070683_100142390 3300005329 Unclassified 2272
27 Ga0070690_100279182 3300005330 Bacteria 1191
28 Ga0070670_100146788 3300005331 Bacteria 2041
29 Ga0070666_10000003 3300005335 Bacteria 463666
30 Ga0070666_10154762 3300005335 Bacteria 1600
31 Ga0070682_100083490 3300005337 Bacteria 2073
32 Ga0070689_100007811 3300005340 Bacteria 7495
33 Ga0070689_100008890 3300005340 Bacteria 7101
34 Ga0070687_100209289 3300005343 Bacteria 1187
35 Ga0070661_100018950 3300005344 Bacteria 4901
36 Ga0070671_100092107 3300005355 Bacteria 2539
37 Ga0070671_100284442 3300005355 Bacteria 1407
38 Ga0070673_100040702 3300005364 Bacteria 3567
39 Ga0070714_100019059 3300005435 Bacteria 5583
40 Ga0070714_100049176 3300005435 Bacteria 3589
41 Ga0070714_100054675 3300005435 Bacteria 3411
42 Ga0070713_100000524 3300005436 Bacteria 24320
43 Ga0070713_100272651 3300005436 Bacteria 1550
44 Ga0070711_100108597 3300005439 Bacteria 2033
45 Ga0070700_100058445 3300005441 Bacteria 2423
46 Ga0070708_100288993 3300005445 Bacteria 1543
47 Ga0070663_100006248 3300005455 Bacteria 7142
48 Ga0070663_100024663 3300005455 Bacteria 4052
49 Ga0070681_10028764 3300005458 Bacteria 5586
50 Ga0070685_10042375 3300005466 Bacteria 2598
51 Ga0070685_10062077 3300005466 Bacteria 2190
52 Ga0070706_100161445 3300005467 Bacteria 2093
53 Ga0070706_100301189 3300005467 Bacteria 1496
54 Ga0070707_100258966 3300005468 Bacteria 1692
55 Ga0070707_100541745 3300005468 Bacteria 1126
56 Ga0070699_100229057 3300005518 Bacteria 1657
57 Ga0070679_100191321 3300005530 Bacteria 2015
58 Ga0070684_100040485 3300005535 Bacteria 4013
59 Ga0070684_100182823 3300005535 Bacteria 1906
60 Ga0068853_100000635 3300005539 Bacteria 24029
61 Ga0070696_100004816 3300005546 Bacteria 9020
62 Ga0070696_100034637 3300005546 Bacteria 3475
63 Ga0070693_100008068 3300005547 Bacteria 5170
64 Ga0070665_100027074 3300005548 Bacteria 5774
65 Ga0070665_100065899 3300005548 Bacteria 3632
66 Ga0070704_100038993 3300005549 Bacteria 3259
67 Ga0070704_100182506 3300005549 Bacteria 1680
68 Ga0068855_100004022 3300005563 Bacteria 17947
69 Ga0068855_100012713 3300005563 Bacteria 10153
70 Ga0070664_100059919 3300005564 Bacteria 3240
71 Ga0068857_100016940 3300005577 Bacteria 6385
72 Ga0068854_100014963 3300005578 Bacteria 5126
73 Ga0068856_100001530 3300005614 Bacteria 24235
74 Ga0068856_100003746 3300005614 Bacteria 15243
75 Ga0068856_100012673 3300005614 Bacteria 8163
76 Ga0068856_100079820 3300005614 Bacteria 3245
77 Ga0068852_100000234 3300005616 Bacteria 37575
78 Ga0068852_100130625 3300005616 Bacteria 2313
79 Ga0068859_100013483 3300005617 Bacteria 8196
80 Ga0068859_100031068 3300005617 Bacteria 5361
81 Ga0068859_100084260 3300005617 Unclassified 3224
82 Ga0068859_100123275 3300005617 Bacteria 2659
83 Ga0068859_100320371 3300005617 Bacteria 1644
84 Ga0068864_100004501 3300005618 Bacteria 11462
85 Ga0068864_100128708 3300005618 Bacteria 2272
86 Ga0068864_100382674 3300005618 Bacteria 1334
87 Ga0068863_100108984 3300005841 Bacteria 2636
88 Ga0068858_100061121 3300005842 Bacteria 3482
89 Ga0068860_100283232 3300005843 Bacteria 1620
90 Ga0081538_10059932 3300005981 Bacteria 2194
91 Ga0081540_1118328 3300005983 Bacteria 1105
92 Ga0081539_10000045 3300005985 Bacteria 277027
93 Ga0081539_10037914 3300005985 Bacteria 2863
94 Ga0070716_100225132 3300006173 Bacteria 1262
95 Ga0070712_100092352 3300006175 Bacteria 2220
96 Ga0097621_100000417 3300006237 Bacteria 29675
97 Ga0097621_100016407 3300006237 Bacteria 5600
98 Ga0068871_100000652 3300006358 Bacteria 23848
99 Ga0068871_100111404 3300006358 Bacteria 2302
100 Ga0068871_100560307 3300006358 Bacteria 1036
101 Ga0075428_100161311 3300006844 Bacteria 2433
102 Ga0075428_100469038 3300006844 Bacteria 1348
103 Ga0075434_100078047 3300006871 Bacteria 3307
104 Ga0075434_100317955 3300006871 Bacteria 1577
105 Ga0068865_100008092 3300006881 Bacteria 6488
106 Ga0068865_100142372 3300006881 Bacteria 1809
107 Ga0068865_100236845 3300006881 Bacteria 1434
108 Ga0075436_100031864 3300006914 Bacteria 3632
109 Ga0075436_100049846 3300006914 Bacteria 2890
110 Ga0075436_100121580 3300006914 Bacteria 1827
111 Ga0097620_100013483 3300006931 Bacteria 8196
112 Ga0097620_100031068 3300006931 Bacteria 5361
113 Ga0097620_100084262 3300006931 Unclassified 3224
114 Ga0097620_100123274 3300006931 Bacteria 2659
115 Ga0097620_100320356 3300006931 Bacteria 1644
116 Ga0079104_1000014 3300006946 Bacteria 337362
117 Ga0079104_1000203 3300006946 Bacteria 83190
118 Ga0079104_1000357 3300006946 Bacteria 55345
119 Ga0075435_100091397 3300007076 Bacteria 2512
120 Ga0105251_10000086 3300009011 Bacteria 88725
121 Ga0105251_10000529 3300009011 Bacteria 36039
122 Ga0105251_10005219 3300009011 Bacteria 8562
123 Ga0105251_10013602 3300009011 Bacteria 4546
124 Ga0105251_10027030 3300009011 Bacteria 2914
125 Ga0105251_10068242 3300009011 Bacteria 1659
126 Ga0105251_10080345 3300009011 Bacteria 1508
127 Ga0105244_10001832 3300009036 Bacteria 16628
128 Ga0105244_10006109 3300009036 Bacteria 7865
129 Ga0105244_10006547 3300009036 Bacteria 7514
130 Ga0105244_10009564 3300009036 Bacteria 5946
131 Ga0105244_10032598 3300009036 Bacteria 2756
132 Ga0105244_10045867 3300009036 Bacteria 2247
133 Ga0105244_10058537 3300009036 Bacteria 1944
134 Ga0105250_10000002 3300009092 Bacteria 566949
135 Ga0105250_10000070 3300009092 Bacteria 96227
136 Ga0105250_10000616 3300009092 Bacteria 23145
137 Ga0105250_10001404 3300009092 Bacteria 13014
138 Ga0105250_10001622 3300009092 Bacteria 12022
139 Ga0105250_10002655 3300009092 Bacteria 8867
140 Ga0105250_10008467 3300009092 Bacteria 4367
141 Ga0105240_10003365 3300009093 Bacteria 24874
142 Ga0105240_10004201 3300009093 Bacteria 22030
143 Ga0105240_10006437 3300009093 Bacteria 17263
144 Ga0105240_10098903 3300009093 Bacteria 3552
145 Ga0105240_10180679 3300009093 Bacteria 2490
146 Ga0105240_10269666 3300009093 Bacteria 1960
147 Ga0105245_10007338 3300009098 Bacteria 9654
148 Ga0114129_10004675 3300009147 Bacteria 19333
149 Ga0105243_10050400 3300009148 Bacteria 3289
150 Ga0105241_10000383 3300009174 Bacteria 33616
151 Ga0105241_10012596 3300009174 Bacteria 6204
152 Ga0105241_10019513 3300009174 Bacteria 4999
153 Ga0105241_10027715 3300009174 Bacteria 4218
154 Ga0105241_10039319 3300009174 Bacteria 3568
155 Ga0105242_10116979 3300009176 Bacteria 2282
156 Ga0105248_10005255 3300009177 Bacteria 14254
157 Ga0105248_10029774 3300009177 Bacteria 6092
158 Ga0105248_10303395 3300009177 Bacteria 1798
159 Ga0105237_10016153 3300009545 Bacteria 7765
160 Ga0105237_10040970 3300009545 Bacteria 4671
161 Ga0105237_10121831 3300009545 Bacteria 2603
162 Ga0105238_10002982 3300009551 Bacteria 16898
163 Ga0105238_10004919 3300009551 Bacteria 13224
164 Ga0105238_10015258 3300009551 Bacteria 7778
165 Ga0105238_10170473 3300009551 Bacteria 2152
166 Ga0105238_10184975 3300009551 Bacteria 2060
167 Ga0105249_10160098 3300009553 Bacteria 2175
168 Ga0105239_10007680 3300010375 Bacteria 12350
169 Ga0105239_10017583 3300010375 Bacteria 7908
170 Ga0105239_10202198 3300010375 Bacteria 2226
171 Ga0105246_10000013 3300011119 Bacteria 67142
172 Ga0105246_10002258 3300011119 Bacteria 11631
173 Ga0157373_10001081 3300013100 Bacteria 20989
174 Ga0157371_10000092 3300013102 Bacteria 141282
175 Ga0157371_10003279 3300013102 Bacteria 14838
176 Ga0157370_10000596 3300013104 Bacteria 45119
177 Ga0157370_10012653 3300013104 Bacteria 8740
178 Ga0157369_10005321 3300013105 Bacteria 14997
179 Ga0157369_10005711 3300013105 Bacteria 14453
180 Ga0157369_10047903 3300013105 Bacteria 4639
181 Ga0157369_10050166 3300013105 Bacteria 4522
182 Ga0157374_10000955 3300013296 Bacteria 25080
183 Ga0157374_10002768 3300013296 Bacteria 14718
184 Ga0157374_10033334 3300013296 Bacteria 4699
185 Ga0157374_10104431 3300013296 Bacteria 2720
186 Ga0157374_10171631 3300013296 Bacteria 2116
187 Ga0157378_10015715 3300013297 Bacteria 6629
188 Ga0157378_10047021 3300013297 Bacteria 3836
189 Ga0157378_10158133 3300013297 Bacteria 2117
190 Ga0163162_10000378 3300013306 Bacteria 40518
191 Ga0163162_10003202 3300013306 Bacteria 15655
192 Ga0163162_10108982 3300013306 Bacteria 2866
193 Ga0157372_10004147 3300013307 Bacteria 15519
194 Ga0157372_10013100 3300013307 Bacteria 8847
195 Ga0157372_10015595 3300013307 Bacteria 8147
196 Ga0157372_10041549 3300013307 Bacteria 5085
197 Ga0157372_10053886 3300013307 Bacteria 4485
198 Ga0157372_10099595 3300013307 Bacteria 3315
199 Ga0157372_10104030 3300013307 Bacteria 3245
200 Ga0157372_10161897 3300013307 Bacteria 2586
201 Ga0157375_10006430 3300013308 Bacteria 10240
202 Ga0157375_10186084 3300013308 Bacteria 2230
203 Ga0163163_10000075 3300014325 Bacteria 109545
204 Ga0163163_10002698 3300014325 Bacteria 15003
205 Ga0163163_10130540 3300014325 Bacteria 2552
206 Ga0163163_10272001 3300014325 Bacteria 1745
207 Ga0163163_10347819 3300014325 Bacteria 1538
208 Ga0157380_10010450 3300014326 Bacteria 6679
209 Ga0157380_10068862 3300014326 Bacteria 2854
210 Ga0157377_10052336 3300014745 Unclassified 2305
211 Ga0157379_10151341 3300014968 Bacteria 2093
212 Ga0157379_10182204 3300014968 Bacteria 1897
213 Ga0157379_10327801 3300014968 Bacteria 1399
214 Ga0182005_1007744 3300015265 Bacteria 3205
215 Ga0183369_1003 3300015685 Bacteria 726443
216 Ga0163161_10018993 3300017792 Bacteria 4818
217 Ga0163161_10075363 3300017792 Bacteria 2476
218 Ga0163161_10169251 3300017792 Bacteria 1670
219 Ga0213875_10002238 3300021388 Bacteria 11743
220 Ga0213875_10010744 3300021388 Bacteria 4578
221 Ga0209760_100005 3300025207 Bacteria 238315
222 Ga0209784_100001 3300025224 Bacteria 3600592
223 Ga0209566_100001 3300025225 Bacteria 3600765
224 Ga0209674_100002 3300025226 Bacteria 3600592
225 Ga0209672_100074 3300025228 Bacteria 159792
226 Ga0209563_100002 3300025230 Bacteria 2045675
227 Ga0207427_100009 3300025231 Bacteria 663036
228 Ga0209437_100001 3300025233 Bacteria 2045675
229 Ga0209258_100004 3300025242 Bacteria 1376422
230 Ga0209258_100008 3300025242 Bacteria 1009355
231 Ga0209677_100002 3300025253 Bacteria 2045675
232 Ga0209148_1000041 3300025254 Bacteria 469323
233 Ga0209455_1000007 3300025272 Bacteria 1157983
234 Ga0209455_1012340 3300025272 Bacteria 2050
235 Ga0209673_1001925 3300025273 Bacteria 16472
236 Ga0209676_1000026 3300025292 Bacteria 574599
237 Ga0209025_1015065 3300025294 Bacteria 4693
238 Ga0209758_1005968 3300025297 Bacteria 9024
239 Ga0209758_1012168 3300025297 Bacteria 4854
240 Ga0209050_1002021 3300025298 Bacteria 18884
241 Ga0209051_1000151 3300025303 Bacteria 131835
242 Ga0209051_1001926 3300025303 Bacteria 16030
243 Ga0209257_1006118 3300025304 Bacteria 7982
244 Ga0207696_1000038 3300025711 Bacteria 328221
245 Ga0207696_1000239 3300025711 Bacteria 75936
246 Ga0207696_1000304 3300025711 Bacteria 56311
247 Ga0207696_1000409 3300025711 Bacteria 40065
248 Ga0207696_1001046 3300025711 Bacteria 16401
249 Ga0207696_1007415 3300025711 Bacteria 4297
250 Ga0207696_1009567 3300025711 Bacteria 3607
251 Ga0207696_1009725 3300025711 Bacteria 3569
252 Ga0207696_1016060 3300025711 Bacteria 2516
253 Ga0207655_1000002 3300025728 Bacteria 1148694
254 Ga0207655_1000050 3300025728 Bacteria 294923
255 Ga0207655_1006728 3300025728 Bacteria 7570
256 Ga0207655_1006972 3300025728 Bacteria 7402
257 Ga0207655_1010748 3300025728 Bacteria 5523
258 Ga0207655_1010981 3300025728 Bacteria 5438
259 Ga0207655_1014723 3300025728 Bacteria 4398
260 Ga0207655_1020027 3300025728 Bacteria 3465
261 Ga0207655_1035278 3300025728 Bacteria 2235
262 Ga0207655_1040444 3300025728 Bacteria 2011
263 Ga0207713_1000002 3300025735 Bacteria 1061749
264 Ga0207713_1000155 3300025735 Bacteria 102677
265 Ga0207713_1000191 3300025735 Bacteria 85634
266 Ga0207713_1002314 3300025735 Bacteria 13998
267 Ga0207713_1002406 3300025735 Bacteria 13664
268 Ga0207713_1005935 3300025735 Bacteria 7537
269 Ga0207713_1013106 3300025735 Bacteria 4390
270 Ga0207713_1013798 3300025735 Bacteria 4234
271 Ga0207713_1021959 3300025735 Bacteria 3045
272 Ga0207680_10000006 3300025903 Bacteria 635950
273 Ga0207680_10051574 3300025903 Bacteria 2461
274 Ga0207705_10022230 3300025909 Bacteria 4524
275 Ga0207684_10152884 3300025910 Bacteria 1986
276 Ga0207684_10257587 3300025910 Bacteria 1505
277 Ga0207654_10000689 3300025911 Bacteria 18808
278 Ga0207654_10000731 3300025911 Bacteria 18271
279 Ga0207654_10019740 3300025911 Bacteria 3563
280 Ga0207654_10031820 3300025911 Bacteria 2909
281 Ga0207707_10031433 3300025912 Bacteria 4645
282 Ga0207695_10000637 3300025913 Bacteria 70175
283 Ga0207695_10002224 3300025913 Bacteria 29144
284 Ga0207695_10004845 3300025913 Bacteria 18166
285 Ga0207695_10005481 3300025913 Bacteria 16806
286 Ga0207695_10089305 3300025913 Bacteria 3099
287 Ga0207671_10000935 3300025914 Bacteria 36496
288 Ga0207671_10007610 3300025914 Bacteria 9372
289 Ga0207663_10087888 3300025916 Bacteria 2054
290 Ga0207663_10166018 3300025916 Bacteria 1563
291 Ga0207649_10063286 3300025920 Bacteria 2335
292 Ga0207646_10181601 3300025922 Bacteria 1900
293 Ga0207681_10014667 3300025923 Bacteria 4878
294 Ga0207694_10000249 3300025924 Bacteria 51431
295 Ga0207694_10001221 3300025924 Bacteria 22261
296 Ga0207694_10027998 3300025924 Bacteria 4296
297 Ga0207694_10148923 3300025924 Bacteria 1885
298 Ga0207650_10311494 3300025925 Unclassified 1288
299 Ga0207659_10114596 3300025926 Bacteria 2055
300 Ga0207687_10013607 3300025927 Bacteria 5311
301 Ga0207700_10000060 3300025928 Bacteria 68678
302 Ga0207700_10091875 3300025928 Bacteria 2399
303 Ga0207700_10232259 3300025928 Bacteria 1569
304 Ga0207664_10011276 3300025929 Bacteria 6341
305 Ga0207664_10114864 3300025929 Bacteria 2244
306 Ga0207664_10138853 3300025929 Bacteria 2053
307 Ga0207644_10239124 3300025931 Bacteria 1445
308 Ga0207665_10104037 3300025939 Bacteria 1986
309 Ga0207691_10078331 3300025940 Bacteria 2975
310 Ga0207711_10014531 3300025941 Bacteria 6544
311 Ga0207711_10032837 3300025941 Bacteria 4390
312 Ga0207711_10050081 3300025941 Bacteria 3576
313 Ga0207711_10150749 3300025941 Bacteria 2098
314 Ga0207661_10218812 3300025944 Bacteria 1682
315 Ga0207661_10236552 3300025944 Unclassified 1619
316 Ga0207679_10016801 3300025945 Bacteria 4865
317 Ga0207667_10001916 3300025949 Bacteria 26137
318 Ga0207667_10004385 3300025949 Bacteria 17283
319 Ga0207651_10027598 3300025960 Bacteria 3568
320 Ga0207668_10094625 3300025972 Bacteria 2203
321 Ga0207640_10010117 3300025981 Bacteria 5303
322 Ga0207658_10128700 3300025986 Bacteria 2031
323 Ga0207677_10056750 3300026023 Bacteria 2685
324 Ga0207677_10070454 3300026023 Bacteria 2464
325 Ga0207703_10038574 3300026035 Bacteria 3813
326 Ga0207703_10049144 3300026035 Bacteria 3409
327 Ga0207639_10000605 3300026041 Bacteria 24765
328 Ga0207639_10520976 3300026041 Bacteria 1089
329 Ga0207678_10022979 3300026067 Bacteria 5457
330 Ga0207678_10249812 3300026067 Bacteria 1519
331 Ga0207708_10015907 3300026075 Bacteria 5649
332 Ga0207702_10001049 3300026078 Bacteria 28307
333 Ga0207702_10001070 3300026078 Bacteria 28050
334 Ga0207702_10076091 3300026078 Bacteria 2901
335 Ga0207702_10124682 3300026078 Bacteria 2310
336 Ga0207641_10058811 3300026088 Bacteria 3272
337 Ga0207676_10001466 3300026095 Bacteria 17524
338 Ga0207676_10126349 3300026095 Bacteria 2166
339 Ga0207683_10312502 3300026121 Bacteria 1438
340 Ga0207698_10000623 3300026142 Bacteria 20591
341 Ga0209281_1000032 3300027111 Bacteria 401727
342 Ga0209281_1000338 3300027111 Bacteria 79936
343 Ga0209389_1000103 3300027296 Bacteria 75590
344 Ga0209371_1000017 3300027312 Bacteria 625776
345 Ga0209371_1000577 3300027312 Bacteria 32935
346 Ga0209371_1001607 3300027312 Bacteria 14687
347 Ga0207428_10005919 3300027907 Bacteria 11322
348 Ga0207428_10026747 3300027907 Bacteria 4809
349 Ga0268266_10000021 3300028379 Bacteria 522453
350 Ga0268266_10034222 3300028379 Bacteria 4321
351 Ga0268266_10114872 3300028379 Bacteria 2389
352 Ga0268264_10081099 3300028381 Bacteria 2772
353 Ga0268264_10192436 3300028381 Bacteria 1860
354 Ga0265338_10018014 3300028800 Bacteria 7582
355 Ga0268256_1000036 3300030500 Bacteria 370250
356 Ga0268256_1000819 3300030500 Bacteria 22302
357 Ga0268256_1001390 3300030500 Bacteria 14687
358 Ga0265325_10043684 3300031241 Bacteria 2337
359 Ga0265339_10044702 3300031249 Bacteria 2441
360 Ga0265316_10132332 3300031344 Bacteria 1878
361 Ga0307509_10000004 3300031507 Bacteria 535507
362 Ga0307408_100095864 3300031548 Bacteria 2249
363 Ga0265313_10027776 3300031595 Bacteria 2957
364 Ga0307508_10080456 3300031616 Bacteria 2840
365 Ga0316575_10012714 3300031665 Bacteria 3136
366 Ga0265314_10010456 3300031711 Bacteria 7742
367 Ga0307412_10001266 3300031911 Bacteria 14173
368 Ga0307412_10044273 3300031911 Bacteria 2903
369 Ga0307412_10049883 3300031911 Bacteria 2759
370 Ga0307409_100100442 3300031995 Bacteria 2398
371 Ga0373959_0000450 3300034820 Bacteria 7685
372 Ga0316574_0005675 3300035398 Bacteria 6676
373 Ga0373935_0041032 3300035692 Bacteria 2906
374 Ga0373927_0038275 3300035695 Bacteria 3114
375 Ga0373937_0019256 3300036401 Bacteria 6109
376 Ga0395899_0035576 3300037312 Bacteria 3738
377 Ga0395900_0026896 3300037418 Bacteria 5888
378 Ga0395900_0191019 3300037418 Bacteria 2077
379 Ga0395905_0000769 3300037471 Bacteria 42306
380 Ga0395905_0169447 3300037471 Bacteria 2051
381 Ga0436364_0471524 3300037853 Bacteria 6420
382 Ga0436364_0613787 3300037853 Bacteria 13985
383 Ga0395901_0003843 3300038443 Bacteria 15134
384 Ga0395901_0085074 3300038443 Bacteria 3306
385 Ga0395901_0387040 3300038443 Bacteria 1438
386 Ga0395901_0430218 3300038443 Bacteria 1352
387 Ga0436365_0203066 3300039437 Bacteria 111457
388 Ga0436361_0462153 3300039447 Bacteria 6697
389 Ga0439438_016041 3300041405 Bacteria 2186
390 Ga0439447_000503 3300041407 Bacteria 14536
391 Ga0439447_007866 3300041407 Bacteria 3342
392 Ga0439466_0008252 3300041411 Bacteria 3924
393 Ga0439465_0019909 3300041413 Bacteria 2099
394 Ga0439463_000015 3300042016 Bacteria 36632
395 Ga0439464_0011013 3300042439 Bacteria 2391
396 Ga0466966_0021607 3300044684 Bacteria 4226
397 Ga0466963_0015844 3300044694 Bacteria 4679
398 Ga0453684_0000065 3300044712 Bacteria 468481
399 Ga0453684_0003037 3300044712 Bacteria 39031
400 Ga0453684_0123407 3300044712 Bacteria 3122
401 Ga0453684_0265918 3300044712 Bacteria 1962
402 Ga0453684_0297727 3300044712 Bacteria 1835
403 Ga0466968_0036004 3300044735 Bacteria 2073
404 Ga0466970_0058034 3300044765 Bacteria 2071
405 Ga0451576_0000325 3300045051 Bacteria 115644
406 Ga0451576_0004373 3300045051 Bacteria 18423
407 Ga0451576_0165107 3300045051 Bacteria 2311
408 Ga0451576_0507514 3300045051 Bacteria 1267
409 Ga0466958_0066902 3300045836 Bacteria 2194
410 Ga0466967_0007112 3300045976 Bacteria 8031
411 Ga0466967_0064875 3300045976 Bacteria 3249
412 Ga0495617_000166 3300046452 Bacteria 42074
413 Ga0495617_000972 3300046452 Bacteria 13311
414 Ga0495617_009939 3300046452 Bacteria 3262
415 Ga0495617_013456 3300046452 Bacteria 2785
416 Ga0495617_036485 3300046452 Bacteria 1648
417 Ga0495617_048588 3300046452 Bacteria 1412
418 Ga0495603_0000025 3300046455 Bacteria 62985
419 Ga0495590_0000306 3300046457 Bacteria 25686
420 Ga0495591_000002 3300046458 Bacteria 455013
421 Ga0495591_000049 3300046458 Bacteria 138951
422 Ga0495591_000076 3300046458 Bacteria 111124
423 Ga0495591_000545 3300046458 Bacteria 28926
424 Ga0495591_016191 3300046458 Bacteria 2608
425 Ga0495638_0000373 3300046460 Bacteria 55670
426 Ga0495638_0000477 3300046460 Bacteria 48044
427 Ga0495638_0001957 3300046460 Bacteria 17643
428 Ga0495638_0092687 3300046460 Bacteria 1818
429 Ga0495638_0179805 3300046460 Bacteria 1207
430 Ga0495653_0003212 3300046463 Bacteria 13091
431 Ga0495653_0006291 3300046463 Bacteria 9741
432 Ga0495653_0044424 3300046463 Bacteria 3447
433 Ga0495650_0000031 3300046471 Bacteria 433811
434 Ga0495650_0001378 3300046471 Bacteria 23968
435 Ga0495650_0004885 3300046471 Bacteria 8968
436 Ga0495650_0006455 3300046471 Bacteria 7298
437 Ga0495650_0006668 3300046471 Bacteria 7155
438 Ga0495580_0000005 3300046472 Bacteria 107243
439 Ga0495580_0004911 3300046472 Bacteria 11183
440 Ga0495580_0005902 3300046472 Bacteria 10048
441 Ga0495580_0014041 3300046472 Bacteria 6091
442 Ga0495605_0000517 3300046474 Bacteria 32881
443 Ga0495605_0001304 3300046474 Bacteria 16517
444 Ga0495605_0003775 3300046474 Bacteria 8987
445 Ga0495605_0014986 3300046474 Bacteria 4227
446 Ga0495605_0051067 3300046474 Bacteria 2014
447 Ga0495664_0012766 3300046477 Bacteria 4759
448 Ga0495584_0036972 3300046491 Bacteria 2466
449 Ga0495585_0002349 3300046492 Bacteria 13593
450 Ga0495585_0004774 3300046492 Bacteria 8719
451 Ga0495585_0021020 3300046492 Bacteria 3748
452 Ga0495585_0062695 3300046492 Bacteria 2042
453 Ga0495594_0062851 3300046499 Bacteria 2056
454 Ga0495596_0000087 3300046500 Bacteria 64252
455 Ga0495607_0003007 3300046501 Bacteria 13165
456 Ga0495607_0021248 3300046501 Bacteria 4086
457 Ga0495607_0078103 3300046501 Bacteria 1827
458 Ga0495607_0175416 3300046501 Bacteria 1079
459 Ga0495583_0000059 3300046506 Bacteria 199575
460 Ga0495583_0003963 3300046506 Bacteria 10932
461 Ga0495583_0010191 3300046506 Bacteria 5514
462 Ga0495583_0031047 3300046506 Bacteria 2595
463 Ga0495583_0066259 3300046506 Bacteria 1598
464 Ga0495606_0001321 3300046507 Bacteria 33870
465 Ga0495606_0117543 3300046507 Bacteria 1595
466 Ga0495606_0142562 3300046507 Bacteria 1413
467 Ga0495606_0191427 3300046507 Bacteria 1172
468 Ga0495608_0001348 3300046511 Bacteria 17514
469 Ga0495608_0065502 3300046511 Bacteria 2380
470 Ga0495610_0000848 3300046512 Bacteria 28487
471 Ga0495610_0001087 3300046512 Bacteria 24865
472 Ga0495610_0001982 3300046512 Bacteria 17467
473 Ga0495610_0022283 3300046512 Bacteria 3468
474 Ga0495616_0000165 3300046513 Bacteria 57822
475 Ga0495616_0023716 3300046513 Bacteria 3298
476 Ga0495620_0001627 3300046515 Bacteria 13296
477 Ga0495620_0004873 3300046515 Bacteria 7532
478 Ga0495620_0054395 3300046515 Bacteria 1691
479 Ga0495628_0001615 3300046516 Bacteria 20645
480 Ga0495628_0312991 3300046516 Bacteria 1160
481 Ga0495630_0055415 3300046517 Bacteria 2971
482 Ga0495630_0091075 3300046517 Bacteria 2304
483 Ga0495630_0163812 3300046517 Bacteria 1692
484 Ga0495630_0189494 3300046517 Bacteria 1569
485 Ga0495631_0000031 3300046518 Bacteria 85555
486 Ga0495631_0005399 3300046518 Bacteria 6686
487 Ga0495631_0007732 3300046518 Bacteria 5454
488 Ga0495632_0016673 3300046519 Bacteria 4078
489 Ga0495632_0028749 3300046519 Bacteria 2899
490 Ga0495632_0038410 3300046519 Bacteria 2424
491 Ga0495637_0000365 3300046520 Bacteria 34448
492 Ga0495637_0003162 3300046520 Bacteria 8788
493 Ga0495637_0021867 3300046520 Bacteria 2925
494 Ga0495643_0000284 3300046522 Bacteria 72435
495 Ga0495643_0093138 3300046522 Bacteria 1552
496 Ga0495648_0001897 3300046524 Bacteria 19952
497 Ga0495648_0004024 3300046524 Bacteria 12700
498 Ga0495648_0026190 3300046524 Bacteria 3929
499 Ga0495648_0049774 3300046524 Bacteria 2565
500 Ga0495648_0148890 3300046524 Bacteria 1223
501 Ga0495663_0067576 3300046525 Bacteria 1133
502 Ga0495666_0009884 3300046526 Bacteria 4765
503 Ga0495652_0000812 3300046529 Bacteria 36015
504 Ga0495652_0048359 3300046529 Bacteria 3645
505 Ga0495652_0144169 3300046529 Bacteria 1869
506 Ga0495654_0000069 3300046530 Bacteria 120853
507 Ga0495654_0000079 3300046530 Bacteria 109816
508 Ga0495654_0005114 3300046530 Bacteria 7664
509 Ga0495654_0021836 3300046530 Bacteria 3329
510 Ga0495654_0054102 3300046530 Bacteria 1948
511 Ga0495654_0105631 3300046530 Bacteria 1290
512 Ga0495665_0020274 3300046531 Bacteria 3572
513 Ga0495640_0114021 3300046533 Bacteria 1763
514 Ga0495587_0001718 3300046536 Bacteria 14619
515 Ga0495621_0001317 3300046539 Bacteria 6415
516 Ga0495597_0001260 3300046542 Bacteria 18706
517 Ga0495597_0062640 3300046542 Bacteria 1617
518 Ga0495645_0016029 3300046543 Bacteria 5342
519 Ga0495622_0000011 3300046557 Bacteria 201507
520 Ga0495622_0001980 3300046557 Bacteria 10037
521 Ga0495633_0011667 3300046558 Bacteria 4719
522 Ga0495633_0076960 3300046558 Bacteria 1554
523 Ga0495633_0078976 3300046558 Bacteria 1532
524 Ga0495633_0143891 3300046558 Bacteria 1102
525 Ga0495667_0000215 3300046559 Bacteria 38593
526 Ga0495656_0015779 3300046615 Bacteria 2857
527 Ga0495668_0002790 3300046616 Bacteria 13912
528 Ga0495668_0007922 3300046616 Bacteria 6704
529 Ga0495668_0025823 3300046616 Bacteria 3336
530 Ga0495668_0065237 3300046616 Bacteria 2004
531 Ga0495634_0000347 3300046642 Bacteria 44864
532 Ga0495611_0001754 3300046648 Bacteria 10495
533 Ga0495611_0006671 3300046648 Bacteria 4911
534 Ga0495611_0054525 3300046648 Bacteria 1807
535 Ga0495625_0001743 3300046660 Bacteria 25161
536 Ga0495625_0003377 3300046660 Bacteria 16005
537 Ga0495625_0005641 3300046660 Bacteria 11340
538 Ga0495625_0005925 3300046660 Bacteria 10995
539 Ga0495625_0015936 3300046660 Bacteria 5930
540 Ga0495625_0245233 3300046660 Bacteria 1165
541 Ga0495635_0046015 3300046663 Bacteria 3010
542 Ga0495661_0000861 3300046665 Bacteria 28277
543 Ga0495588_0001410 3300046674 Bacteria 10267
544 Ga0495657_0006599 3300046675 Bacteria 9063
545 Ga0495599_0078903 3300046678 Bacteria 2056
546 Ga0495623_0002958 3300046679 Bacteria 11177
547 Ga0495623_0011387 3300046679 Bacteria 5755
548 Ga0495646_0023944 3300046680 Bacteria 3845
549 Ga0495646_0046615 3300046680 Bacteria 2641
550 Ga0495613_0102040 3300046689 Bacteria 2072
551 Ga0495624_0016322 3300046690 Bacteria 4998
552 Ga0495624_0028114 3300046690 Bacteria 3677
553 Ga0495670_0004284 3300046691 Bacteria 6989
554 Ga0495670_0004799 3300046691 Bacteria 6640
555 Ga0495671_0000446 3300046692 Bacteria 32728
556 Ga0495671_0002224 3300046692 Bacteria 12335
557 Ga0495671_0074469 3300046692 Bacteria 1665
558 Ga0495649_0000245 3300046694 Bacteria 47917
559 Ga0495649_0006297 3300046694 Bacteria 7386
560 Ga0495649_0008701 3300046694 Bacteria 6090
561 Ga0495649_0019004 3300046694 Bacteria 3861
562 Ga0495649_0021669 3300046694 Bacteria 3600
563 Ga0495649_0025203 3300046694 Bacteria 3312
564 Ga0495649_0188377 3300046694 Bacteria 1074
565 Ga0495589_0011590 3300046794 Bacteria 4577
566 Ga0495589_0024759 3300046794 Bacteria 3049
567 Ga0495589_0046180 3300046794 Bacteria 2163
568 Ga0495600_0029338 3300046809 Bacteria 3561
569 Ga0495660_0000016 3300046810 Bacteria 321859
570 Ga0495660_0000153 3300046810 Bacteria 74797
571 Ga0495660_0000302 3300046810 Bacteria 44594
572 Ga0495660_0002788 3300046810 Bacteria 11013
573 Ga0495660_0020164 3300046810 Bacteria 3822
574 Ga0495660_0022024 3300046810 Bacteria 3643
575 Ga0495660_0053672 3300046810 Bacteria 2187
576 Ga0495660_0095053 3300046810 Bacteria 1542
577 Ga0495604_0019379 3300047317 Bacteria 5445
578 Ga0495604_0022082 3300047317 Bacteria 5079
579 Ga0495604_0057310 3300047317 Bacteria 2995
580 Ga0495674_0000271 3300047319 Bacteria 44227
581 Ga0495674_0008422 3300047319 Bacteria 9823
582 Ga0495674_0017477 3300047319 Bacteria 6674
583 Ga0495674_0048003 3300047319 Bacteria 3781
584 Ga0495672_0000001 3300047320 Bacteria 1458820
585 Ga0495672_0000037 3300047320 Bacteria 278588
586 Ga0495672_0000062 3300047320 Bacteria 211745
587 Ga0495672_0002052 3300047320 Bacteria 18929
588 Ga0495680_0002950 3300047322 Bacteria 17024
589 Ga0495680_0029851 3300047322 Bacteria 4460
590 Ga0495683_0002439 3300047323 Bacteria 11240
591 Ga0495687_013230 3300047443 Bacteria 4318
592 Ga0495687_027145 3300047443 Bacteria 2683
593 Ga0495675_0000354 3300047444 Bacteria 32123
594 Ga0495675_0046475 3300047444 Bacteria 2763
595 Ga0495679_000590 3300047446 Bacteria 24982
596 Ga0495679_017874 3300047446 Bacteria 2529
597 Ga0495679_022488 3300047446 Bacteria 2156
598 Ga0495673_0000191 3300047469 Bacteria 96817
599 Ga0495673_0000358 3300047469 Bacteria 56024
600 Ga0495673_0000753 3300047469 Bacteria 30736
601 Ga0495681_0000527 3300047470 Bacteria 29212
602 Ga0495681_0006810 3300047470 Bacteria 7434
603 Ga0495681_0009252 3300047470 Bacteria 6091
604 Ga0495681_0017092 3300047470 Bacteria 4041
605 Ga0495684_0002068 3300047471 Bacteria 16129
606 Ga0495684_0020764 3300047471 Bacteria 5060
607 Ga0495686_0000047 3300047472 Bacteria 280086
608 Ga0495686_0002819 3300047472 Bacteria 15756
609 Ga0495593_0013628 3300047673 Bacteria 4633
610 Ga0495602_0059737 3300048088 Bacteria 3326
611 Ga0495626_0000057 3300048091 Bacteria 148288
612 Ga0495626_0000374 3300048091 Bacteria 46701
613 Ga0495626_0005649 3300048091 Bacteria 7245
614 Ga0496100_0024105 3300048903 Bacteria 3706
615 Ga0496100_0065169 3300048903 Bacteria 2413
616 Ga0496101_0008350 3300048904 Bacteria 6767
617 Ga0496101_0022200 3300048904 Bacteria 4367
618 Ga0496101_0051243 3300048904 Bacteria 2974
619 Ga0496101_0089574 3300048904 Bacteria 2287
620 Ga0496102_0000444 3300048905 Bacteria 47025
621 Ga0496102_0005013 3300048905 Bacteria 11214
622 Ga0496102_0059670 3300048905 Bacteria 3489
623 Ga0496102_0119593 3300048905 Bacteria 2460
624 Ga0496102_0281788 3300048905 Bacteria 1567
625 Ga0496102_0331593 3300048905 Bacteria 1433
626 Ga0496103_0000290 3300048906 Bacteria 47006
627 Ga0496103_0046510 3300048906 Bacteria 2679
628 Ga0496104_0006840 3300048907 Bacteria 10049
629 Ga0496104_0202072 3300048907 Bacteria 1899
630 Ga0496105_0049651 3300048908 Bacteria 3464
631 Ga0496105_0179163 3300048908 Bacteria 1735
632 Ga0496105_0252066 3300048908 Bacteria 1430
633 Ga0496106_0090721 3300048909 Bacteria 2358
634 Ga0496107_0011893 3300048910 Bacteria 6079
635 Ga0496107_0028942 3300048910 Bacteria 3940
636 Ga0496107_0162996 3300048910 Bacteria 1653
637 Ga0496108_0069625 3300048911 Bacteria 2969
638 Ga0496108_0349892 3300048911 Bacteria 1289
639 Ga0496109_0010551 3300048912 Bacteria 7898
640 Ga0496109_0422889 3300048912 Bacteria 1258
641 Ga0496110_0010902 3300048913 Bacteria 7411
642 Ga0496110_0016914 3300048913 Bacteria 6096
643 Ga0496110_0153019 3300048913 Bacteria 2089
644 Ga0496114_0021179 3300048917 Bacteria 5287
645 Ga0496114_0095352 3300048917 Bacteria 2532
646 Ga0496114_0132976 3300048917 Bacteria 2150
647 Ga0496114_0161162 3300048917 Bacteria 1951
648 Ga0496115_0001021 3300048918 Bacteria 20300
649 Ga0496115_0015041 3300048918 Bacteria 5865
650 Ga0496115_0109155 3300048918 Bacteria 2272
651 Ga0496116_0000394 3300048919 Bacteria 63846
652 Ga0496116_0015807 3300048919 Bacteria 5944
653 Ga0496116_0035428 3300048919 Bacteria 3505
654 Ga0496116_0055403 3300048919 Bacteria 2604
655 Ga0496117_0001290 3300048920 Bacteria 36931
656 Ga0496117_0002386 3300048920 Bacteria 23895
657 Ga0496117_0008509 3300048920 Bacteria 9730
658 Ga0496117_0032627 3300048920 Bacteria 3953
659 Ga0496117_0062710 3300048920 Bacteria 2545
660 Ga0496118_0000048 3300048921 Bacteria 253404
661 Ga0496118_0000491 3300048921 Bacteria 65587
662 Ga0496118_0005120 3300048921 Bacteria 15061
663 Ga0496118_0039071 3300048921 Bacteria 3792
664 Ga0496118_0082682 3300048921 Bacteria 2248
665 Ga0496119_0005301 3300048922 Bacteria 12414
666 Ga0496120_0085256 3300048923 Bacteria 1701
667 Ga0496121_0000055 3300048924 Bacteria 304572
668 Ga0496121_0001253 3300048924 Bacteria 43985
669 Ga0496121_0008653 3300048924 Bacteria 11901
670 Ga0496122_0000810 3300048925 Bacteria 59986
671 Ga0496123_0001426 3300048926 Bacteria 33426
672 Ga0496124_0000390 3300048927 Bacteria 79997
673 Ga0496124_0000445 3300048927 Bacteria 72989
674 Ga0496124_0000634 3300048927 Bacteria 58255
675 Ga0496124_0005976 3300048927 Bacteria 13440
676 Ga0496124_0006685 3300048927 Bacteria 12486
677 Ga0496124_0009020 3300048927 Bacteria 10319
678 Ga0496124_0010485 3300048927 Bacteria 9377
679 Ga0496124_0023815 3300048927 Bacteria 5580
680 Ga0496125_0000232 3300048928 Bacteria 114025
681 Ga0496125_0005805 3300048928 Bacteria 13555
682 Ga0496125_0009714 3300048928 Bacteria 9824
683 Ga0496125_0011442 3300048928 Bacteria 8873
684 Ga0496125_0101591 3300048928 Bacteria 2116
685 Ga0496126_0069447 3300048929 Bacteria 3143
686 Ga0496126_0073802 3300048929 Bacteria 3032
687 Ga0496126_0120620 3300048929 Bacteria 2274
688 Ga0496126_0161928 3300048929 Bacteria 1911
689 Ga0496126_0299154 3300048929 Bacteria 1328
690 Ga0495678_000091 3300049459 Bacteria 114504
691 Ga0495678_002781 3300049459 Bacteria 11428
692 Ga0495678_027486 3300049459 Bacteria 2413
693 Ga0495682_0000001 3300049460 Bacteria 1559116
694 Ga0495682_0000152 3300049460 Bacteria 59145
695 Ga0495682_0000232 3300049460 Bacteria 43870
696 Ga0495682_0004828 3300049460 Bacteria 5692
697 Ga0495682_0007557 3300049460 Bacteria 4316
698 Ga0495682_0023301 3300049460 Bacteria 2311
699 Ga0495682_0051776 3300049460 Bacteria 1493
700 Ga0501034_0101163 3300049571 Bacteria 2876
701 Ga0501037_0176986 3300049573 Bacteria 1515
702 Ga0501046_0350519 3300049580 Bacteria 1072
703 Ga0501047_0228330 3300049581 Bacteria 1716
704 Ga0501070_0040644 3300049586 Bacteria 3878
705 Ga0501070_0166386 3300049586 Bacteria 1817
706 Ga0501249_000065 3300049679 Bacteria 38092
707 Ga0501080_0033932 3300049742 Bacteria 4764
708 Ga0501080_0313469 3300049742 Bacteria 1421
709 Ga0501083_0105627 3300049744 Bacteria 1854
710 Ga0501044_0160648 3300049823 Bacteria 2224
711 Ga0501204_003614 3300049850 Bacteria 1636
712 nmdc:mga00v17_4678_c1 3300050491 Bacteria 7149
713 nmdc:mga05p37_3097_c1 3300050507 Bacteria 19323
714 nmdc:mga05p37_4683_c1 3300050507 Bacteria 15978
715 nmdc:mga09592_14038_c1 3300050508 Bacteria 6540
716 nmdc:mga0n895_104802_c1 3300050512 Bacteria 2840
717 nmdc:mga0n895_352619_c1 3300050512 Bacteria 1490
718 nmdc:mga0rr50_38934_c1 3300050513 Bacteria 3445
719 nmdc:mga08x19_17316_c1 3300050514 Bacteria 4407
720 nmdc:mga08x19_25250_c1 3300050514 Bacteria 3700
721 nmdc:mga08x19_34963_c1 3300050514 Bacteria 3178
722 Ga0495601_0076363 3300053077 Bacteria 2145
723 Ga0500610_0075796 3300053079 Bacteria 1754
724 Ga0495619_0036206 3300053085 Bacteria 3212
725 Ga0500578_0131726 3300053086 Bacteria 1568
726 Ga0500643_000024 3300053087 Bacteria 265935
727 Ga0500644_0000126 3300053088 Bacteria 47091
728 Ga0500555_020364 3300053103 Bacteria 1910
729 Ga0500569_016973 3300053109 Bacteria 1853
730 Ga0500594_0000563 3300053118 Bacteria 8009
731 Ga0500594_0000661 3300053118 Bacteria 7332
732 Ga0500594_0003332 3300053118 Bacteria 3519
733 Ga0500618_000116 3300053125 Bacteria 64971
734 Ga0500618_000269 3300053125 Bacteria 40125
735 Ga0500618_000344 3300053125 Bacteria 33227
736 Ga0500621_000002 3300053126 Bacteria 849473
737 Ga0500658_0046104 3300053134 Bacteria 1764
738 Ga0500659_0004513 3300053135 Bacteria 7941
739 Ga0500559_0061927 3300053136 Bacteria 1670
740 Ga0500568_0000168 3300053139 Bacteria 56752
741 Ga0500568_0053025 3300053139 Bacteria 1590
742 Ga0500616_0001366 3300053153 Bacteria 23717
743 Ga0500634_0000185 3300053161 Bacteria 20592
744 Ga0500636_0001796 3300053177 Bacteria 11746
745 Ga0500636_0028376 3300053177 Bacteria 3306
746 Ga0500609_000501 3300053731 Bacteria 5862
747 Ga0500661_003130 3300055283 Bacteria 3109
748 2969082261 2969079654 Bacteria 5439582
749 2511131630 2510917022 Bacteria 6504556
750 2511195577 2510917030 Bacteria 7460662
751 2511257805 2511231004 Bacteria 6669789
752 2511371659 2511231023 Bacteria 6808468
753 2511433105 2511231035 Bacteria 5341610
754 2511437259 2511231035 Bacteria 5341610
755 2511825122 2511231156 Bacteria 6845832
756 2513868976 2513237138 Bacteria 7368160
757 2524452122 2524023207 Bacteria 6813453
758 2585275104 2582581307 Bacteria 6597605
759 2585553970 2585427530 Bacteria 7383882
760 2585555122 2585427530 Bacteria 7383882
761 2585561182 2585427531 Bacteria 6992870
762 2585563712 2585427531 Bacteria 6992870
763 2585848029 2585427594 Bacteria 6180594
764 2585900045 2585427608 Bacteria 6544331
765 2585908224 2585427609 Bacteria 6667127
766 2587983741 2585428125 Bacteria 6662905
767 2599409392 2599185169 Bacteria 5441380
768 2601643728 2600255287 Bacteria 5210468
769 2601663552 2600255291 Bacteria 5217298
770 2601696567 2600255298 Bacteria 5215185
771 2601701184 2600255299 Bacteria 5218662
772 2601721591 2600255303 Bacteria 5219315
773 2601739932 2600255307 Bacteria 5439064
774 2601750421 2600255309 Bacteria 5431045
775 2602017674 2600255392 Bacteria 5437392
776 2603660938 2602042052 Bacteria 5215873
777 2603666212 2602042053 Bacteria 5214361
778 2603697914 2602042066 Bacteria 4423871
779 2603877025 2602042111 Bacteria 5212080
780 2606070645 2603880184 Bacteria 5217896
781 2637225288 2636415599 Bacteria 5718434
782 2644003296 2643221599 Bacteria 6292121
783 2644089906 2643221615 Bacteria 5487866
784 2644319751 2643221657 Bacteria 5490246
785 2644498200 2643221689 Bacteria 6042950
786 2676406537 2675903046 Bacteria 5451247
787 2739793002 2739367756 Bacteria 4553612
788 2807176779 2806310673 Bacteria 4801221
789 2819683018 2818991461 Bacteria 7026071
790 2842875173 2842871566 Bacteria 4827117
791 2842925267 2842922631 Bacteria 5824079
792 2844529751 2844528606 Bacteria 4733806
793 2852108096 2852103415 Bacteria 5193810
794 2855387097 2855386786 Bacteria 4752232
795 2857567803 2857564685 Bacteria 6290584
796 2857743625 2857740372 Bacteria 4782044
797 2865014704 2865014394 Bacteria 4764573
798 2888374792 2888373701 Bacteria 5098052
799 2889421354 2889415604 Bacteria 8048700
800 2904500801 2904497146 Bacteria 4731781
801 2904508657 2904504865 Bacteria 5152820
802 2908673891 2908669403 Bacteria 5740494
803 2910812536 2910809715 Bacteria 4982797
804 2919461241 2919456309 Bacteria 6586567
805 2939573338 2939573065 Bacteria 4926053
806 2939675912 2939674588 Bacteria 4844420
807 3007614439 3007614139 Bacteria 6053559
808 643603760 643348564 Bacteria 8839022
809 8018179758 8018176218 Bacteria 6896178
810 8018222226 8018221730 Bacteria 4616064
811 8055090080 8055087960 Bacteria 4784273
812 8055093110 8055092621 Bacteria 4873875
813 8055695740 8055693939 Bacteria 4772047
814 8056182471 8056177738 Bacteria 6748268
815 JGI24735J21928_10011974
816 JGI24735J21928_10017115
817 JGI25162J39368_1000002
818 JGI25163J39215_1000043
819 JGI25164J39214_1000066
820 JGI25406J46586_10001789
821 JGI25406J46586_10026758
822 Ga0055538_1000003
823 Ga0055539_1000003
824 Ga0055539_1000836
825 Ga0055533_1000005
826 Ga0055533_1007646
827 Ga0055525_1000005
828 Ga0055527_1000037
829 Ga0055535_1000059
830 Ga0055542_1000086
831 Ga0055529_1000231
832 Ga0055540_1019204
833 Ga0055531_10049763
834 Ga0055541_1000003
835 Ga0058692_1001201
836 Ga0058692_1009243
837 Ga0065704_10003190
838 Ga0065704_10190575
839 Ga0070658_10041386
840 Ga0070683_100142390
841 Ga0070690_100279182
842 Ga0070670_100146788
843 Ga0070666_10000003
844 Ga0070666_10154762
845 Ga0070682_100083490
846 Ga0070689_100007811
847 Ga0070689_100008890
848 Ga0070687_100209289
849 Ga0070661_100018950
850 Ga0070671_100092107
851 Ga0070671_100284442
852 Ga0070673_100040702
853 Ga0070714_100019059
854 Ga0070714_100049176
855 Ga0070714_100054675
856 Ga0070713_100000524
857 Ga0070713_100272651
858 Ga0070711_100108597
859 Ga0070700_100058445
860 Ga0070708_100288993
861 Ga0070663_100006248
862 Ga0070663_100024663
863 Ga0070681_10028764
864 Ga0070685_10042375
865 Ga0070685_10062077
866 Ga0070706_100161445
867 Ga0070706_100301189
868 Ga0070707_100258966
869 Ga0070707_100541745
870 Ga0070699_100229057
871 Ga0070679_100191321
872 Ga0070684_100040485
873 Ga0070684_100182823
874 Ga0068853_100000635
875 Ga0070696_100004816
876 Ga0070696_100034637
877 Ga0070693_100008068
878 Ga0070665_100027074
879 Ga0070665_100065899
880 Ga0070704_100038993
881 Ga0070704_100182506
882 Ga0068855_100004022
883 Ga0068855_100012713
884 Ga0070664_100059919
885 Ga0068857_100016940
886 Ga0068854_100014963
887 Ga0068856_100001530
888 Ga0068856_100003746
889 Ga0068856_100012673
890 Ga0068856_100079820
891 Ga0068852_100000234
892 Ga0068852_100130625
893 Ga0068859_100013483
894 Ga0068859_100031068
895 Ga0068859_100084260
896 Ga0068859_100123275
897 Ga0068859_100320371
898 Ga0068864_100004501
899 Ga0068864_100128708
900 Ga0068864_100382674
901 Ga0068863_100108984
902 Ga0068858_100061121
903 Ga0068860_100283232
904 Ga0081538_10059932
905 Ga0081540_1118328
906 Ga0081539_10000045
907 Ga0081539_10037914
908 Ga0070716_100225132
909 Ga0070712_100092352
910 Ga0097621_100000417
911 Ga0097621_100016407
912 Ga0068871_100000652
913 Ga0068871_100111404
914 Ga0068871_100560307
915 Ga0075428_100161311
916 Ga0075428_100469038
917 Ga0075434_100078047
918 Ga0075434_100317955
919 Ga0068865_100008092
920 Ga0068865_100142372
921 Ga0068865_100236845
922 Ga0075436_100031864
923 Ga0075436_100049846
924 Ga0075436_100121580
925 Ga0097620_100013483
926 Ga0097620_100031068
927 Ga0097620_100084262
928 Ga0097620_100123274
929 Ga0097620_100320356
930 Ga0079104_1000014
931 Ga0079104_1000203
932 Ga0079104_1000357
933 Ga0075435_100091397
934 Ga0105251_10000086
935 Ga0105251_10000529
936 Ga0105251_10005219
937 Ga0105251_10013602
938 Ga0105251_10027030
939 Ga0105251_10068242
940 Ga0105251_10080345
941 Ga0105244_10001832
942 Ga0105244_10006109
943 Ga0105244_10006547
944 Ga0105244_10009564
945 Ga0105244_10032598
946 Ga0105244_10045867
947 Ga0105244_10058537
948 Ga0105250_10000002
949 Ga0105250_10000070
950 Ga0105250_10000616
951 Ga0105250_10001404
952 Ga0105250_10001622
953 Ga0105250_10002655
954 Ga0105250_10008467
955 Ga0105240_10003365
956 Ga0105240_10004201
957 Ga0105240_10006437
958 Ga0105240_10098903
959 Ga0105240_10180679
960 Ga0105240_10269666
961 Ga0105245_10007338
962 Ga0114129_10004675
963 Ga0105243_10050400
964 Ga0105241_10000383
965 Ga0105241_10012596
966 Ga0105241_10019513
967 Ga0105241_10027715
968 Ga0105241_10039319
969 Ga0105242_10116979
970 Ga0105248_10005255
971 Ga0105248_10029774
972 Ga0105248_10303395
973 Ga0105237_10016153
974 Ga0105237_10040970
975 Ga0105237_10121831
976 Ga0105238_10002982
977 Ga0105238_10004919
978 Ga0105238_10015258
979 Ga0105238_10170473
980 Ga0105238_10184975
981 Ga0105249_10160098
982 Ga0105239_10007680
983 Ga0105239_10017583
984 Ga0105239_10202198
985 Ga0105246_10000013
986 Ga0105246_10002258
987 Ga0157373_10001081
988 Ga0157371_10000092
989 Ga0157371_10003279
990 Ga0157370_10000596
991 Ga0157370_10012653
992 Ga0157369_10005321
993 Ga0157369_10005711
994 Ga0157369_10047903
995 Ga0157369_10050166
996 Ga0157374_10000955
997 Ga0157374_10002768
998 Ga0157374_10033334
999 Ga0157374_10104431
1000 Ga0157374_10171631
1001 Ga0157378_10015715
1002 Ga0157378_10047021
1003 Ga0157378_10158133
1004 Ga0163162_10000378
1005 Ga0163162_10003202
1006 Ga0163162_10108982
1007 Ga0157372_10004147
1008 Ga0157372_10013100
1009 Ga0157372_10015595
1010 Ga0157372_10041549
1011 Ga0157372_10053886
1012 Ga0157372_10099595
1013 Ga0157372_10104030
1014 Ga0157372_10161897
1015 Ga0157375_10006430
1016 Ga0157375_10186084
1017 Ga0163163_10000075
1018 Ga0163163_10002698
1019 Ga0163163_10130540
1020 Ga0163163_10272001
1021 Ga0163163_10347819
1022 Ga0157380_10010450
1023 Ga0157380_10068862
1024 Ga0157377_10052336
1025 Ga0157379_10151341
1026 Ga0157379_10182204
1027 Ga0157379_10327801
1028 Ga0182005_1007744
1029 Ga0183369_1003
1030 Ga0163161_10018993
1031 Ga0163161_10075363
1032 Ga0163161_10169251
1033 Ga0213875_10002238
1034 Ga0213875_10010744
1035 Ga0209760_100005
1036 Ga0209784_100001
1037 Ga0209566_100001
1038 Ga0209674_100002
1039 Ga0209672_100074
1040 Ga0209563_100002
1041 Ga0207427_100009
1042 Ga0209437_100001
1043 Ga0209258_100004
1044 Ga0209258_100008
1045 Ga0209677_100002
1046 Ga0209148_1000041
1047 Ga0209455_1000007
1048 Ga0209455_1012340
1049 Ga0209673_1001925
1050 Ga0209676_1000026
1051 Ga0209025_1015065
1052 Ga0209758_1005968
1053 Ga0209758_1012168
1054 Ga0209050_1002021
1055 Ga0209051_1000151
1056 Ga0209051_1001926
1057 Ga0209257_1006118
1058 Ga0207696_1000038
1059 Ga0207696_1000239
1060 Ga0207696_1000304
1061 Ga0207696_1000409
1062 Ga0207696_1001046
1063 Ga0207696_1007415
1064 Ga0207696_1009567
1065 Ga0207696_1009725
1066 Ga0207696_1016060
1067 Ga0207655_1000002
1068 Ga0207655_1000050
1069 Ga0207655_1006728
1070 Ga0207655_1006972
1071 Ga0207655_1010748
1072 Ga0207655_1010981
1073 Ga0207655_1014723
1074 Ga0207655_1020027
1075 Ga0207655_1035278
1076 Ga0207655_1040444
1077 Ga0207713_1000002
1078 Ga0207713_1000155
1079 Ga0207713_1000191
1080 Ga0207713_1002314
1081 Ga0207713_1002406
1082 Ga0207713_1005935
1083 Ga0207713_1013106
1084 Ga0207713_1013798
1085 Ga0207713_1021959
1086 Ga0207680_10000006
1087 Ga0207680_10051574
1088 Ga0207705_10022230
1089 Ga0207684_10152884
1090 Ga0207684_10257587
1091 Ga0207654_10000689
1092 Ga0207654_10000731
1093 Ga0207654_10019740
1094 Ga0207654_10031820
1095 Ga0207707_10031433
1096 Ga0207695_10000637
1097 Ga0207695_10002224
1098 Ga0207695_10004845
1099 Ga0207695_10005481
1100 Ga0207695_10089305
1101 Ga0207671_10000935
1102 Ga0207671_10007610
1103 Ga0207663_10087888
1104 Ga0207663_10166018
1105 Ga0207649_10063286
1106 Ga0207646_10181601
1107 Ga0207681_10014667
1108 Ga0207694_10000249
1109 Ga0207694_10001221
1110 Ga0207694_10027998
1111 Ga0207694_10148923
1112 Ga0207650_10311494
1113 Ga0207659_10114596
1114 Ga0207687_10013607
1115 Ga0207700_10000060
1116 Ga0207700_10091875
1117 Ga0207700_10232259
1118 Ga0207664_10011276
1119 Ga0207664_10114864
1120 Ga0207664_10138853
1121 Ga0207644_10239124
1122 Ga0207665_10104037
1123 Ga0207691_10078331
1124 Ga0207711_10014531
1125 Ga0207711_10032837
1126 Ga0207711_10050081
1127 Ga0207711_10150749
1128 Ga0207661_10218812
1129 Ga0207661_10236552
1130 Ga0207679_10016801
1131 Ga0207667_10001916
1132 Ga0207667_10004385
1133 Ga0207651_10027598
1134 Ga0207668_10094625
1135 Ga0207640_10010117
1136 Ga0207658_10128700
1137 Ga0207677_10056750
1138 Ga0207677_10070454
1139 Ga0207703_10038574
1140 Ga0207703_10049144
1141 Ga0207639_10000605
1142 Ga0207639_10520976
1143 Ga0207678_10022979
1144 Ga0207678_10249812
1145 Ga0207708_10015907
1146 Ga0207702_10001049
1147 Ga0207702_10001070
1148 Ga0207702_10076091
1149 Ga0207702_10124682
1150 Ga0207641_10058811
1151 Ga0207676_10001466
1152 Ga0207676_10126349
1153 Ga0207683_10312502
1154 Ga0207698_10000623
1155 Ga0209281_1000032
1156 Ga0209281_1000338
1157 Ga0209389_1000103
1158 Ga0209371_1000017
1159 Ga0209371_1000577
1160 Ga0209371_1001607
1161 Ga0207428_10005919
1162 Ga0207428_10026747
1163 Ga0268266_10000021
1164 Ga0268266_10034222
1165 Ga0268266_10114872
1166 Ga0268264_10081099
1167 Ga0268264_10192436
1168 Ga0265338_10018014
1169 Ga0268256_1000036
1170 Ga0268256_1000819
1171 Ga0268256_1001390
1172 Ga0265325_10043684
1173 Ga0265339_10044702
1174 Ga0265316_10132332
1175 Ga0307509_10000004
1176 Ga0307408_100095864
1177 Ga0265313_10027776
1178 Ga0307508_10080456
1179 Ga0316575_10012714
1180 Ga0265314_10010456
1181 Ga0307412_10001266
1182 Ga0307412_10044273
1183 Ga0307412_10049883
1184 Ga0307409_100100442
1185 Ga0373959_0000450
1186 Ga0316574_0005675
1187 Ga0373935_0041032
1188 Ga0373927_0038275
1189 Ga0373937_0019256
1190 Ga0395899_0035576
1191 Ga0395900_0026896
1192 Ga0395900_0191019
1193 Ga0395905_0000769
1194 Ga0395905_0169447
1195 Ga0436364_0471524
1196 Ga0436364_0613787
1197 Ga0395901_0003843
1198 Ga0395901_0085074
1199 Ga0395901_0387040
1200 Ga0395901_0430218
1201 Ga0436365_0203066
1202 Ga0436361_0462153
1203 Ga0439438_016041
1204 Ga0439447_000503
1205 Ga0439447_007866
1206 Ga0439466_0008252
1207 Ga0439465_0019909
1208 Ga0439463_000015
1209 Ga0439464_0011013
1210 Ga0466966_0021607
1211 Ga0466963_0015844
1212 Ga0453684_0000065
1213 Ga0453684_0003037
1214 Ga0453684_0123407
1215 Ga0453684_0265918
1216 Ga0453684_0297727
1217 Ga0466968_0036004
1218 Ga0466970_0058034
1219 Ga0451576_0000325
1220 Ga0451576_0004373
1221 Ga0451576_0165107
1222 Ga0451576_0507514
1223 Ga0466958_0066902
1224 Ga0466967_0007112
1225 Ga0466967_0064875
1226 Ga0495617_000166
1227 Ga0495617_000972
1228 Ga0495617_009939
1229 Ga0495617_013456
1230 Ga0495617_036485
1231 Ga0495617_048588
1232 Ga0495603_0000025
1233 Ga0495590_0000306
1234 Ga0495591_000002
1235 Ga0495591_000049
1236 Ga0495591_000076
1237 Ga0495591_000545
1238 Ga0495591_016191
1239 Ga0495638_0000373
1240 Ga0495638_0000477
1241 Ga0495638_0001957
1242 Ga0495638_0092687
1243 Ga0495638_0179805
1244 Ga0495653_0003212
1245 Ga0495653_0006291
1246 Ga0495653_0044424
1247 Ga0495650_0000031
1248 Ga0495650_0001378
1249 Ga0495650_0004885
1250 Ga0495650_0006455
1251 Ga0495650_0006668
1252 Ga0495580_0000005
1253 Ga0495580_0004911
1254 Ga0495580_0005902
1255 Ga0495580_0014041
1256 Ga0495605_0000517
1257 Ga0495605_0001304
1258 Ga0495605_0003775
1259 Ga0495605_0014986
1260 Ga0495605_0051067
1261 Ga0495664_0012766
1262 Ga0495584_0036972
1263 Ga0495585_0002349
1264 Ga0495585_0004774
1265 Ga0495585_0021020
1266 Ga0495585_0062695
1267 Ga0495594_0062851
1268 Ga0495596_0000087
1269 Ga0495607_0003007
1270 Ga0495607_0021248
1271 Ga0495607_0078103
1272 Ga0495607_0175416
1273 Ga0495583_0000059
1274 Ga0495583_0003963
1275 Ga0495583_0010191
1276 Ga0495583_0031047
1277 Ga0495583_0066259
1278 Ga0495606_0001321
1279 Ga0495606_0117543
1280 Ga0495606_0142562
1281 Ga0495606_0191427
1282 Ga0495608_0001348
1283 Ga0495608_0065502
1284 Ga0495610_0000848
1285 Ga0495610_0001087
1286 Ga0495610_0001982
1287 Ga0495610_0022283
1288 Ga0495616_0000165
1289 Ga0495616_0023716
1290 Ga0495620_0001627
1291 Ga0495620_0004873
1292 Ga0495620_0054395
1293 Ga0495628_0001615
1294 Ga0495628_0312991
1295 Ga0495630_0055415
1296 Ga0495630_0091075
1297 Ga0495630_0163812
1298 Ga0495630_0189494
1299 Ga0495631_0000031
1300 Ga0495631_0005399
1301 Ga0495631_0007732
1302 Ga0495632_0016673
1303 Ga0495632_0028749
1304 Ga0495632_0038410
1305 Ga0495637_0000365
1306 Ga0495637_0003162
1307 Ga0495637_0021867
1308 Ga0495643_0000284
1309 Ga0495643_0093138
1310 Ga0495648_0001897
1311 Ga0495648_0004024
1312 Ga0495648_0026190
1313 Ga0495648_0049774
1314 Ga0495648_0148890
1315 Ga0495663_0067576
1316 Ga0495666_0009884
1317 Ga0495652_0000812
1318 Ga0495652_0048359
1319 Ga0495652_0144169
1320 Ga0495654_0000069
1321 Ga0495654_0000079
1322 Ga0495654_0005114
1323 Ga0495654_0021836
1324 Ga0495654_0054102
1325 Ga0495654_0105631
1326 Ga0495665_0020274
1327 Ga0495640_0114021
1328 Ga0495587_0001718
1329 Ga0495621_0001317
1330 Ga0495597_0001260
1331 Ga0495597_0062640
1332 Ga0495645_0016029
1333 Ga0495622_0000011
1334 Ga0495622_0001980
1335 Ga0495633_0011667
1336 Ga0495633_0076960
1337 Ga0495633_0078976
1338 Ga0495633_0143891
1339 Ga0495667_0000215
1340 Ga0495656_0015779
1341 Ga0495668_0002790
1342 Ga0495668_0007922
1343 Ga0495668_0025823
1344 Ga0495668_0065237
1345 Ga0495634_0000347
1346 Ga0495611_0001754
1347 Ga0495611_0006671
1348 Ga0495611_0054525
1349 Ga0495625_0001743
1350 Ga0495625_0003377
1351 Ga0495625_0005641
1352 Ga0495625_0005925
1353 Ga0495625_0015936
1354 Ga0495625_0245233
1355 Ga0495635_0046015
1356 Ga0495661_0000861
1357 Ga0495588_0001410
1358 Ga0495657_0006599
1359 Ga0495599_0078903
1360 Ga0495623_0002958
1361 Ga0495623_0011387
1362 Ga0495646_0023944
1363 Ga0495646_0046615
1364 Ga0495613_0102040
1365 Ga0495624_0016322
1366 Ga0495624_0028114
1367 Ga0495670_0004284
1368 Ga0495670_0004799
1369 Ga0495671_0000446
1370 Ga0495671_0002224
1371 Ga0495671_0074469
1372 Ga0495649_0000245
1373 Ga0495649_0006297
1374 Ga0495649_0008701
1375 Ga0495649_0019004
1376 Ga0495649_0021669
1377 Ga0495649_0025203
1378 Ga0495649_0188377
1379 Ga0495589_0011590
1380 Ga0495589_0024759
1381 Ga0495589_0046180
1382 Ga0495600_0029338
1383 Ga0495660_0000016
1384 Ga0495660_0000153
1385 Ga0495660_0000302
1386 Ga0495660_0002788
1387 Ga0495660_0020164
1388 Ga0495660_0022024
1389 Ga0495660_0053672
1390 Ga0495660_0095053
1391 Ga0495604_0019379
1392 Ga0495604_0022082
1393 Ga0495604_0057310
1394 Ga0495674_0000271
1395 Ga0495674_0008422
1396 Ga0495674_0017477
1397 Ga0495674_0048003
1398 Ga0495672_0000001
1399 Ga0495672_0000037
1400 Ga0495672_0000062
1401 Ga0495672_0002052
1402 Ga0495680_0002950
1403 Ga0495680_0029851
1404 Ga0495683_0002439
1405 Ga0495687_013230
1406 Ga0495687_027145
1407 Ga0495675_0000354
1408 Ga0495675_0046475
1409 Ga0495679_000590
1410 Ga0495679_017874
1411 Ga0495679_022488
1412 Ga0495673_0000191
1413 Ga0495673_0000358
1414 Ga0495673_0000753
1415 Ga0495681_0000527
1416 Ga0495681_0006810
1417 Ga0495681_0009252
1418 Ga0495681_0017092
1419 Ga0495684_0002068
1420 Ga0495684_0020764
1421 Ga0495686_0000047
1422 Ga0495686_0002819
1423 Ga0495593_0013628
1424 Ga0495602_0059737
1425 Ga0495626_0000057
1426 Ga0495626_0000374
1427 Ga0495626_0005649
1428 Ga0496100_0024105
1429 Ga0496100_0065169
1430 Ga0496101_0008350
1431 Ga0496101_0022200
1432 Ga0496101_0051243
1433 Ga0496101_0089574
1434 Ga0496102_0000444
1435 Ga0496102_0005013
1436 Ga0496102_0059670
1437 Ga0496102_0119593
1438 Ga0496102_0281788
1439 Ga0496102_0331593
1440 Ga0496103_0000290
1441 Ga0496103_0046510
1442 Ga0496104_0006840
1443 Ga0496104_0202072
1444 Ga0496105_0049651
1445 Ga0496105_0179163
1446 Ga0496105_0252066
1447 Ga0496106_0090721
1448 Ga0496107_0011893
1449 Ga0496107_0028942
1450 Ga0496107_0162996
1451 Ga0496108_0069625
1452 Ga0496108_0349892
1453 Ga0496109_0010551
1454 Ga0496109_0422889
1455 Ga0496110_0010902
1456 Ga0496110_0016914
1457 Ga0496110_0153019
1458 Ga0496114_0021179
1459 Ga0496114_0095352
1460 Ga0496114_0132976
1461 Ga0496114_0161162
1462 Ga0496115_0001021
1463 Ga0496115_0015041
1464 Ga0496115_0109155
1465 Ga0496116_0000394
1466 Ga0496116_0015807
1467 Ga0496116_0035428
1468 Ga0496116_0055403
1469 Ga0496117_0001290
1470 Ga0496117_0002386
1471 Ga0496117_0008509
1472 Ga0496117_0032627
1473 Ga0496117_0062710
1474 Ga0496118_0000048
1475 Ga0496118_0000491
1476 Ga0496118_0005120
1477 Ga0496118_0039071
1478 Ga0496118_0082682
1479 Ga0496119_0005301
1480 Ga0496120_0085256
1481 Ga0496121_0000055
1482 Ga0496121_0001253
1483 Ga0496121_0008653
1484 Ga0496122_0000810
1485 Ga0496123_0001426
1486 Ga0496124_0000390
1487 Ga0496124_0000445
1488 Ga0496124_0000634
1489 Ga0496124_0005976
1490 Ga0496124_0006685
1491 Ga0496124_0009020
1492 Ga0496124_0010485
1493 Ga0496124_0023815
1494 Ga0496125_0000232
1495 Ga0496125_0005805
1496 Ga0496125_0009714
1497 Ga0496125_0011442
1498 Ga0496125_0101591
1499 Ga0496126_0069447
1500 Ga0496126_0073802
1501 Ga0496126_0120620
1502 Ga0496126_0161928
1503 Ga0496126_0299154
1504 Ga0495678_000091
1505 Ga0495678_002781
1506 Ga0495678_027486
1507 Ga0495682_0000001
1508 Ga0495682_0000152
1509 Ga0495682_0000232
1510 Ga0495682_0004828
1511 Ga0495682_0007557
1512 Ga0495682_0023301
1513 Ga0495682_0051776
1514 Ga0501034_0101163
1515 Ga0501037_0176986
1516 Ga0501046_0350519
1517 Ga0501047_0228330
1518 Ga0501070_0040644
1519 Ga0501070_0166386
1520 Ga0501249_000065
1521 Ga0501080_0033932
1522 Ga0501080_0313469
1523 Ga0501083_0105627
1524 Ga0501044_0160648
1525 Ga0501204_003614
1526 nmdc:mga00v17_4678_c1
1527 nmdc:mga05p37_3097_c1
1528 nmdc:mga05p37_4683_c1
1529 nmdc:mga09592_14038_c1
1530 nmdc:mga0n895_104802_c1
1531 nmdc:mga0n895_352619_c1
1532 nmdc:mga0rr50_38934_c1
1533 nmdc:mga08x19_17316_c1
1534 nmdc:mga08x19_25250_c1
1535 nmdc:mga08x19_34963_c1
1536 Ga0495601_0076363
1537 Ga0500610_0075796
1538 Ga0495619_0036206
1539 Ga0500578_0131726
1540 Ga0500643_000024
1541 Ga0500644_0000126
1542 Ga0500555_020364
1543 Ga0500569_016973
1544 Ga0500594_0000563
1545 Ga0500594_0000661
1546 Ga0500594_0003332
1547 Ga0500618_000116
1548 Ga0500618_000269
1549 Ga0500618_000344
1550 Ga0500621_000002
1551 Ga0500658_0046104
1552 Ga0500659_0004513
1553 Ga0500559_0061927
1554 Ga0500568_0000168
1555 Ga0500568_0053025
1556 Ga0500616_0001366
1557 Ga0500634_0000185
1558 Ga0500636_0001796
1559 Ga0500636_0028376
1560 Ga0500609_000501
1561 Ga0500661_003130
1562 2969082261
1563 2511131630
1564 2511195577
1565 2511257805
1566 2511371659
1567 2511433105
1568 2511437259
1569 2511825122
1570 2513868976
1571 2524452122
1572 2585275104
1573 2585553970
1574 2585555122
1575 2585561182
1576 2585563712
1577 2585848029
1578 2585900045
1579 2585908224
1580 2587983741
1581 2599409392
1582 2601643728
1583 2601663552
1584 2601696567
1585 2601701184
1586 2601721591
1587 2601739932
1588 2601750421
1589 2602017674
1590 2603660938
1591 2603666212
1592 2603697914
1593 2603877025
1594 2606070645
1595 2637225288
1596 2644003296
1597 2644089906
1598 2644319751
1599 2644498200
1600 2676406537
1601 2739793002
1602 2807176779
1603 2819683018
1604 2842875173
1605 2842925267
1606 2844529751
1607 2852108096
1608 2855387097
1609 2857567803
1610 2857743625
1611 2865014704
1612 2888374792
1613 2889421354
1614 2904500801
1615 2904508657
1616 2908673891
1617 2910812536
1618 2919461241
1619 2939573338
1620 2939675912
1621 3007614439
1622 643603760
1623 8018179758
1624 8018222226
1625 8055090080
1626 8055093110
1627 8055695740
1628 8056182471

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

68

363

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9395 1 306
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9312 1 309
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9075 1 318
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.907 1 306
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9069 3 303
ID Description Score Start End Superfamily
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9486 4 326 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9475 1 319 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9435 73 327 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9409 1 223 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9395 1 306 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 1.002 121 204 GO:0004033
GO:0005737
AF-A0A2V9HFB4-F1-model_v4 Aldo/keto reductase 0.9891 1 324 GO:0004033
GO:0005737
AF-A0A3B9ANH9-F1-model_v4 Aldo/keto reductase 0.9888 77 317 GO:0004033
GO:0005737
AF-A0A2V5YE55-F1-model_v4 Aldo/keto reductase 0.9871 1 327 GO:0004033
GO:0005737
AF-A0A7X1W0Z7-F1-model_v4 deleted 0.9855 1 327

Map