F482003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 814 | 411 | 1628 | 328 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2969079654|2969082261 |
| Length | 382 |
| Sequence | IKLFMFQSGTQHCRYQHIRMNQGVGEHYEIPVPWFLLTHPDGFTLIDGGLAVEGLKDPSGYWGSTVSALGLGCMGLSHGYGPATDTRQAIELIRAGVERGVTFFDTAEVYGPYLNEEVVGEALKPLRERVVIATKFGFTFGNDNRQQILNSRPSHIREAVEGSLRRLKTDVIDLLYQHRVDPDVPIEDVAGTVKDLIAEGKVKHFGLSEAGAQTIRRAHAIQPVAALQSEYSMWWREPEQEILPLLEELGIGFVPFSPLGKGFLTGTIRAGSTFGEDDFRSKVPRFAAQALEANEKLVSLISVIAAENRVTPAQIALAWLLAQKPWIVPIPGTTKLHRLEENLAAAEIQLSPGELEKISRALETVKILGERYPAALQARVGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 166 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 167 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 180 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 197 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 198 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 199 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 200 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 201 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 202 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 203 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 336 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 341 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 342 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 343 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 347 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 348 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 349 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 350 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 351 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 352 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 353 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 354 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 355 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 356 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 357 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 358 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 359 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 360 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 361 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 362 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 363 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 364 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 365 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 366 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 367 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 368 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 369 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 370 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 371 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 372 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 373 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 374 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 375 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 376 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 377 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 378 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 379 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 380 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 381 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 382 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 383 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 384 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 385 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 386 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 387 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 388 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 389 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 390 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 391 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 392 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 393 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 394 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 395 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 396 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 397 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 398 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 399 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 400 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 401 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 402 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 403 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 404 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 405 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 406 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 407 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 408 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 409 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 410 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 411 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.77 |
| Metatranscriptomes | 0 |
| Isolates | 8.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.86 |
| Nodule | 1.47 |
| Rhizoplane | 6.39 |
| Rhizosphere | 76.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10011974 | 3300002067 | Bacteria | 2744 |
| 2 | JGI24735J21928_10017115 | 3300002067 | Bacteria | 2243 |
| 3 | JGI25162J39368_1000002 | 3300002737 | Bacteria | 663004 |
| 4 | JGI25163J39215_1000043 | 3300002771 | Bacteria | 55468 |
| 5 | JGI25164J39214_1000066 | 3300002772 | Bacteria | 106367 |
| 6 | JGI25406J46586_10001789 | 3300003203 | Bacteria | 10099 |
| 7 | JGI25406J46586_10026758 | 3300003203 | Bacteria | 2219 |
| 8 | Ga0055538_1000003 | 3300003751 | Bacteria | 663004 |
| 9 | Ga0055539_1000003 | 3300003752 | Bacteria | 663004 |
| 10 | Ga0055539_1000836 | 3300003752 | Bacteria | 7216 |
| 11 | Ga0055533_1000005 | 3300003756 | Bacteria | 663004 |
| 12 | Ga0055533_1007646 | 3300003756 | Bacteria | 1448 |
| 13 | Ga0055525_1000005 | 3300003759 | Bacteria | 663004 |
| 14 | Ga0055527_1000037 | 3300003760 | Bacteria | 124590 |
| 15 | Ga0055535_1000059 | 3300003761 | Bacteria | 124595 |
| 16 | Ga0055542_1000086 | 3300003762 | Bacteria | 124594 |
| 17 | Ga0055529_1000231 | 3300003763 | Bacteria | 70928 |
| 18 | Ga0055540_1019204 | 3300003792 | Bacteria | 1847 |
| 19 | Ga0055531_10049763 | 3300003794 | Bacteria | 1116 |
| 20 | Ga0055541_1000003 | 3300003841 | Bacteria | 663004 |
| 21 | Ga0058692_1001201 | 3300003856 | Bacteria | 9924 |
| 22 | Ga0058692_1009243 | 3300003856 | Bacteria | 2497 |
| 23 | Ga0065704_10003190 | 3300005289 | Bacteria | 4277 |
| 24 | Ga0065704_10190575 | 3300005289 | Bacteria | 1184 |
| 25 | Ga0070658_10041386 | 3300005327 | Bacteria | 3717 |
| 26 | Ga0070683_100142390 | 3300005329 | Unclassified | 2272 |
| 27 | Ga0070690_100279182 | 3300005330 | Bacteria | 1191 |
| 28 | Ga0070670_100146788 | 3300005331 | Bacteria | 2041 |
| 29 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 30 | Ga0070666_10154762 | 3300005335 | Bacteria | 1600 |
| 31 | Ga0070682_100083490 | 3300005337 | Bacteria | 2073 |
| 32 | Ga0070689_100007811 | 3300005340 | Bacteria | 7495 |
| 33 | Ga0070689_100008890 | 3300005340 | Bacteria | 7101 |
| 34 | Ga0070687_100209289 | 3300005343 | Bacteria | 1187 |
| 35 | Ga0070661_100018950 | 3300005344 | Bacteria | 4901 |
| 36 | Ga0070671_100092107 | 3300005355 | Bacteria | 2539 |
| 37 | Ga0070671_100284442 | 3300005355 | Bacteria | 1407 |
| 38 | Ga0070673_100040702 | 3300005364 | Bacteria | 3567 |
| 39 | Ga0070714_100019059 | 3300005435 | Bacteria | 5583 |
| 40 | Ga0070714_100049176 | 3300005435 | Bacteria | 3589 |
| 41 | Ga0070714_100054675 | 3300005435 | Bacteria | 3411 |
| 42 | Ga0070713_100000524 | 3300005436 | Bacteria | 24320 |
| 43 | Ga0070713_100272651 | 3300005436 | Bacteria | 1550 |
| 44 | Ga0070711_100108597 | 3300005439 | Bacteria | 2033 |
| 45 | Ga0070700_100058445 | 3300005441 | Bacteria | 2423 |
| 46 | Ga0070708_100288993 | 3300005445 | Bacteria | 1543 |
| 47 | Ga0070663_100006248 | 3300005455 | Bacteria | 7142 |
| 48 | Ga0070663_100024663 | 3300005455 | Bacteria | 4052 |
| 49 | Ga0070681_10028764 | 3300005458 | Bacteria | 5586 |
| 50 | Ga0070685_10042375 | 3300005466 | Bacteria | 2598 |
| 51 | Ga0070685_10062077 | 3300005466 | Bacteria | 2190 |
| 52 | Ga0070706_100161445 | 3300005467 | Bacteria | 2093 |
| 53 | Ga0070706_100301189 | 3300005467 | Bacteria | 1496 |
| 54 | Ga0070707_100258966 | 3300005468 | Bacteria | 1692 |
| 55 | Ga0070707_100541745 | 3300005468 | Bacteria | 1126 |
| 56 | Ga0070699_100229057 | 3300005518 | Bacteria | 1657 |
| 57 | Ga0070679_100191321 | 3300005530 | Bacteria | 2015 |
| 58 | Ga0070684_100040485 | 3300005535 | Bacteria | 4013 |
| 59 | Ga0070684_100182823 | 3300005535 | Bacteria | 1906 |
| 60 | Ga0068853_100000635 | 3300005539 | Bacteria | 24029 |
| 61 | Ga0070696_100004816 | 3300005546 | Bacteria | 9020 |
| 62 | Ga0070696_100034637 | 3300005546 | Bacteria | 3475 |
| 63 | Ga0070693_100008068 | 3300005547 | Bacteria | 5170 |
| 64 | Ga0070665_100027074 | 3300005548 | Bacteria | 5774 |
| 65 | Ga0070665_100065899 | 3300005548 | Bacteria | 3632 |
| 66 | Ga0070704_100038993 | 3300005549 | Bacteria | 3259 |
| 67 | Ga0070704_100182506 | 3300005549 | Bacteria | 1680 |
| 68 | Ga0068855_100004022 | 3300005563 | Bacteria | 17947 |
| 69 | Ga0068855_100012713 | 3300005563 | Bacteria | 10153 |
| 70 | Ga0070664_100059919 | 3300005564 | Bacteria | 3240 |
| 71 | Ga0068857_100016940 | 3300005577 | Bacteria | 6385 |
| 72 | Ga0068854_100014963 | 3300005578 | Bacteria | 5126 |
| 73 | Ga0068856_100001530 | 3300005614 | Bacteria | 24235 |
| 74 | Ga0068856_100003746 | 3300005614 | Bacteria | 15243 |
| 75 | Ga0068856_100012673 | 3300005614 | Bacteria | 8163 |
| 76 | Ga0068856_100079820 | 3300005614 | Bacteria | 3245 |
| 77 | Ga0068852_100000234 | 3300005616 | Bacteria | 37575 |
| 78 | Ga0068852_100130625 | 3300005616 | Bacteria | 2313 |
| 79 | Ga0068859_100013483 | 3300005617 | Bacteria | 8196 |
| 80 | Ga0068859_100031068 | 3300005617 | Bacteria | 5361 |
| 81 | Ga0068859_100084260 | 3300005617 | Unclassified | 3224 |
| 82 | Ga0068859_100123275 | 3300005617 | Bacteria | 2659 |
| 83 | Ga0068859_100320371 | 3300005617 | Bacteria | 1644 |
| 84 | Ga0068864_100004501 | 3300005618 | Bacteria | 11462 |
| 85 | Ga0068864_100128708 | 3300005618 | Bacteria | 2272 |
| 86 | Ga0068864_100382674 | 3300005618 | Bacteria | 1334 |
| 87 | Ga0068863_100108984 | 3300005841 | Bacteria | 2636 |
| 88 | Ga0068858_100061121 | 3300005842 | Bacteria | 3482 |
| 89 | Ga0068860_100283232 | 3300005843 | Bacteria | 1620 |
| 90 | Ga0081538_10059932 | 3300005981 | Bacteria | 2194 |
| 91 | Ga0081540_1118328 | 3300005983 | Bacteria | 1105 |
| 92 | Ga0081539_10000045 | 3300005985 | Bacteria | 277027 |
| 93 | Ga0081539_10037914 | 3300005985 | Bacteria | 2863 |
| 94 | Ga0070716_100225132 | 3300006173 | Bacteria | 1262 |
| 95 | Ga0070712_100092352 | 3300006175 | Bacteria | 2220 |
| 96 | Ga0097621_100000417 | 3300006237 | Bacteria | 29675 |
| 97 | Ga0097621_100016407 | 3300006237 | Bacteria | 5600 |
| 98 | Ga0068871_100000652 | 3300006358 | Bacteria | 23848 |
| 99 | Ga0068871_100111404 | 3300006358 | Bacteria | 2302 |
| 100 | Ga0068871_100560307 | 3300006358 | Bacteria | 1036 |
| 101 | Ga0075428_100161311 | 3300006844 | Bacteria | 2433 |
| 102 | Ga0075428_100469038 | 3300006844 | Bacteria | 1348 |
| 103 | Ga0075434_100078047 | 3300006871 | Bacteria | 3307 |
| 104 | Ga0075434_100317955 | 3300006871 | Bacteria | 1577 |
| 105 | Ga0068865_100008092 | 3300006881 | Bacteria | 6488 |
| 106 | Ga0068865_100142372 | 3300006881 | Bacteria | 1809 |
| 107 | Ga0068865_100236845 | 3300006881 | Bacteria | 1434 |
| 108 | Ga0075436_100031864 | 3300006914 | Bacteria | 3632 |
| 109 | Ga0075436_100049846 | 3300006914 | Bacteria | 2890 |
| 110 | Ga0075436_100121580 | 3300006914 | Bacteria | 1827 |
| 111 | Ga0097620_100013483 | 3300006931 | Bacteria | 8196 |
| 112 | Ga0097620_100031068 | 3300006931 | Bacteria | 5361 |
| 113 | Ga0097620_100084262 | 3300006931 | Unclassified | 3224 |
| 114 | Ga0097620_100123274 | 3300006931 | Bacteria | 2659 |
| 115 | Ga0097620_100320356 | 3300006931 | Bacteria | 1644 |
| 116 | Ga0079104_1000014 | 3300006946 | Bacteria | 337362 |
| 117 | Ga0079104_1000203 | 3300006946 | Bacteria | 83190 |
| 118 | Ga0079104_1000357 | 3300006946 | Bacteria | 55345 |
| 119 | Ga0075435_100091397 | 3300007076 | Bacteria | 2512 |
| 120 | Ga0105251_10000086 | 3300009011 | Bacteria | 88725 |
| 121 | Ga0105251_10000529 | 3300009011 | Bacteria | 36039 |
| 122 | Ga0105251_10005219 | 3300009011 | Bacteria | 8562 |
| 123 | Ga0105251_10013602 | 3300009011 | Bacteria | 4546 |
| 124 | Ga0105251_10027030 | 3300009011 | Bacteria | 2914 |
| 125 | Ga0105251_10068242 | 3300009011 | Bacteria | 1659 |
| 126 | Ga0105251_10080345 | 3300009011 | Bacteria | 1508 |
| 127 | Ga0105244_10001832 | 3300009036 | Bacteria | 16628 |
| 128 | Ga0105244_10006109 | 3300009036 | Bacteria | 7865 |
| 129 | Ga0105244_10006547 | 3300009036 | Bacteria | 7514 |
| 130 | Ga0105244_10009564 | 3300009036 | Bacteria | 5946 |
| 131 | Ga0105244_10032598 | 3300009036 | Bacteria | 2756 |
| 132 | Ga0105244_10045867 | 3300009036 | Bacteria | 2247 |
| 133 | Ga0105244_10058537 | 3300009036 | Bacteria | 1944 |
| 134 | Ga0105250_10000002 | 3300009092 | Bacteria | 566949 |
| 135 | Ga0105250_10000070 | 3300009092 | Bacteria | 96227 |
| 136 | Ga0105250_10000616 | 3300009092 | Bacteria | 23145 |
| 137 | Ga0105250_10001404 | 3300009092 | Bacteria | 13014 |
| 138 | Ga0105250_10001622 | 3300009092 | Bacteria | 12022 |
| 139 | Ga0105250_10002655 | 3300009092 | Bacteria | 8867 |
| 140 | Ga0105250_10008467 | 3300009092 | Bacteria | 4367 |
| 141 | Ga0105240_10003365 | 3300009093 | Bacteria | 24874 |
| 142 | Ga0105240_10004201 | 3300009093 | Bacteria | 22030 |
| 143 | Ga0105240_10006437 | 3300009093 | Bacteria | 17263 |
| 144 | Ga0105240_10098903 | 3300009093 | Bacteria | 3552 |
| 145 | Ga0105240_10180679 | 3300009093 | Bacteria | 2490 |
| 146 | Ga0105240_10269666 | 3300009093 | Bacteria | 1960 |
| 147 | Ga0105245_10007338 | 3300009098 | Bacteria | 9654 |
| 148 | Ga0114129_10004675 | 3300009147 | Bacteria | 19333 |
| 149 | Ga0105243_10050400 | 3300009148 | Bacteria | 3289 |
| 150 | Ga0105241_10000383 | 3300009174 | Bacteria | 33616 |
| 151 | Ga0105241_10012596 | 3300009174 | Bacteria | 6204 |
| 152 | Ga0105241_10019513 | 3300009174 | Bacteria | 4999 |
| 153 | Ga0105241_10027715 | 3300009174 | Bacteria | 4218 |
| 154 | Ga0105241_10039319 | 3300009174 | Bacteria | 3568 |
| 155 | Ga0105242_10116979 | 3300009176 | Bacteria | 2282 |
| 156 | Ga0105248_10005255 | 3300009177 | Bacteria | 14254 |
| 157 | Ga0105248_10029774 | 3300009177 | Bacteria | 6092 |
| 158 | Ga0105248_10303395 | 3300009177 | Bacteria | 1798 |
| 159 | Ga0105237_10016153 | 3300009545 | Bacteria | 7765 |
| 160 | Ga0105237_10040970 | 3300009545 | Bacteria | 4671 |
| 161 | Ga0105237_10121831 | 3300009545 | Bacteria | 2603 |
| 162 | Ga0105238_10002982 | 3300009551 | Bacteria | 16898 |
| 163 | Ga0105238_10004919 | 3300009551 | Bacteria | 13224 |
| 164 | Ga0105238_10015258 | 3300009551 | Bacteria | 7778 |
| 165 | Ga0105238_10170473 | 3300009551 | Bacteria | 2152 |
| 166 | Ga0105238_10184975 | 3300009551 | Bacteria | 2060 |
| 167 | Ga0105249_10160098 | 3300009553 | Bacteria | 2175 |
| 168 | Ga0105239_10007680 | 3300010375 | Bacteria | 12350 |
| 169 | Ga0105239_10017583 | 3300010375 | Bacteria | 7908 |
| 170 | Ga0105239_10202198 | 3300010375 | Bacteria | 2226 |
| 171 | Ga0105246_10000013 | 3300011119 | Bacteria | 67142 |
| 172 | Ga0105246_10002258 | 3300011119 | Bacteria | 11631 |
| 173 | Ga0157373_10001081 | 3300013100 | Bacteria | 20989 |
| 174 | Ga0157371_10000092 | 3300013102 | Bacteria | 141282 |
| 175 | Ga0157371_10003279 | 3300013102 | Bacteria | 14838 |
| 176 | Ga0157370_10000596 | 3300013104 | Bacteria | 45119 |
| 177 | Ga0157370_10012653 | 3300013104 | Bacteria | 8740 |
| 178 | Ga0157369_10005321 | 3300013105 | Bacteria | 14997 |
| 179 | Ga0157369_10005711 | 3300013105 | Bacteria | 14453 |
| 180 | Ga0157369_10047903 | 3300013105 | Bacteria | 4639 |
| 181 | Ga0157369_10050166 | 3300013105 | Bacteria | 4522 |
| 182 | Ga0157374_10000955 | 3300013296 | Bacteria | 25080 |
| 183 | Ga0157374_10002768 | 3300013296 | Bacteria | 14718 |
| 184 | Ga0157374_10033334 | 3300013296 | Bacteria | 4699 |
| 185 | Ga0157374_10104431 | 3300013296 | Bacteria | 2720 |
| 186 | Ga0157374_10171631 | 3300013296 | Bacteria | 2116 |
| 187 | Ga0157378_10015715 | 3300013297 | Bacteria | 6629 |
| 188 | Ga0157378_10047021 | 3300013297 | Bacteria | 3836 |
| 189 | Ga0157378_10158133 | 3300013297 | Bacteria | 2117 |
| 190 | Ga0163162_10000378 | 3300013306 | Bacteria | 40518 |
| 191 | Ga0163162_10003202 | 3300013306 | Bacteria | 15655 |
| 192 | Ga0163162_10108982 | 3300013306 | Bacteria | 2866 |
| 193 | Ga0157372_10004147 | 3300013307 | Bacteria | 15519 |
| 194 | Ga0157372_10013100 | 3300013307 | Bacteria | 8847 |
| 195 | Ga0157372_10015595 | 3300013307 | Bacteria | 8147 |
| 196 | Ga0157372_10041549 | 3300013307 | Bacteria | 5085 |
| 197 | Ga0157372_10053886 | 3300013307 | Bacteria | 4485 |
| 198 | Ga0157372_10099595 | 3300013307 | Bacteria | 3315 |
| 199 | Ga0157372_10104030 | 3300013307 | Bacteria | 3245 |
| 200 | Ga0157372_10161897 | 3300013307 | Bacteria | 2586 |
| 201 | Ga0157375_10006430 | 3300013308 | Bacteria | 10240 |
| 202 | Ga0157375_10186084 | 3300013308 | Bacteria | 2230 |
| 203 | Ga0163163_10000075 | 3300014325 | Bacteria | 109545 |
| 204 | Ga0163163_10002698 | 3300014325 | Bacteria | 15003 |
| 205 | Ga0163163_10130540 | 3300014325 | Bacteria | 2552 |
| 206 | Ga0163163_10272001 | 3300014325 | Bacteria | 1745 |
| 207 | Ga0163163_10347819 | 3300014325 | Bacteria | 1538 |
| 208 | Ga0157380_10010450 | 3300014326 | Bacteria | 6679 |
| 209 | Ga0157380_10068862 | 3300014326 | Bacteria | 2854 |
| 210 | Ga0157377_10052336 | 3300014745 | Unclassified | 2305 |
| 211 | Ga0157379_10151341 | 3300014968 | Bacteria | 2093 |
| 212 | Ga0157379_10182204 | 3300014968 | Bacteria | 1897 |
| 213 | Ga0157379_10327801 | 3300014968 | Bacteria | 1399 |
| 214 | Ga0182005_1007744 | 3300015265 | Bacteria | 3205 |
| 215 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 216 | Ga0163161_10018993 | 3300017792 | Bacteria | 4818 |
| 217 | Ga0163161_10075363 | 3300017792 | Bacteria | 2476 |
| 218 | Ga0163161_10169251 | 3300017792 | Bacteria | 1670 |
| 219 | Ga0213875_10002238 | 3300021388 | Bacteria | 11743 |
| 220 | Ga0213875_10010744 | 3300021388 | Bacteria | 4578 |
| 221 | Ga0209760_100005 | 3300025207 | Bacteria | 238315 |
| 222 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 223 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 224 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 225 | Ga0209672_100074 | 3300025228 | Bacteria | 159792 |
| 226 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 227 | Ga0207427_100009 | 3300025231 | Bacteria | 663036 |
| 228 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 229 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 230 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 231 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 232 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 233 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 234 | Ga0209455_1012340 | 3300025272 | Bacteria | 2050 |
| 235 | Ga0209673_1001925 | 3300025273 | Bacteria | 16472 |
| 236 | Ga0209676_1000026 | 3300025292 | Bacteria | 574599 |
| 237 | Ga0209025_1015065 | 3300025294 | Bacteria | 4693 |
| 238 | Ga0209758_1005968 | 3300025297 | Bacteria | 9024 |
| 239 | Ga0209758_1012168 | 3300025297 | Bacteria | 4854 |
| 240 | Ga0209050_1002021 | 3300025298 | Bacteria | 18884 |
| 241 | Ga0209051_1000151 | 3300025303 | Bacteria | 131835 |
| 242 | Ga0209051_1001926 | 3300025303 | Bacteria | 16030 |
| 243 | Ga0209257_1006118 | 3300025304 | Bacteria | 7982 |
| 244 | Ga0207696_1000038 | 3300025711 | Bacteria | 328221 |
| 245 | Ga0207696_1000239 | 3300025711 | Bacteria | 75936 |
| 246 | Ga0207696_1000304 | 3300025711 | Bacteria | 56311 |
| 247 | Ga0207696_1000409 | 3300025711 | Bacteria | 40065 |
| 248 | Ga0207696_1001046 | 3300025711 | Bacteria | 16401 |
| 249 | Ga0207696_1007415 | 3300025711 | Bacteria | 4297 |
| 250 | Ga0207696_1009567 | 3300025711 | Bacteria | 3607 |
| 251 | Ga0207696_1009725 | 3300025711 | Bacteria | 3569 |
| 252 | Ga0207696_1016060 | 3300025711 | Bacteria | 2516 |
| 253 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 254 | Ga0207655_1000050 | 3300025728 | Bacteria | 294923 |
| 255 | Ga0207655_1006728 | 3300025728 | Bacteria | 7570 |
| 256 | Ga0207655_1006972 | 3300025728 | Bacteria | 7402 |
| 257 | Ga0207655_1010748 | 3300025728 | Bacteria | 5523 |
| 258 | Ga0207655_1010981 | 3300025728 | Bacteria | 5438 |
| 259 | Ga0207655_1014723 | 3300025728 | Bacteria | 4398 |
| 260 | Ga0207655_1020027 | 3300025728 | Bacteria | 3465 |
| 261 | Ga0207655_1035278 | 3300025728 | Bacteria | 2235 |
| 262 | Ga0207655_1040444 | 3300025728 | Bacteria | 2011 |
| 263 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 264 | Ga0207713_1000155 | 3300025735 | Bacteria | 102677 |
| 265 | Ga0207713_1000191 | 3300025735 | Bacteria | 85634 |
| 266 | Ga0207713_1002314 | 3300025735 | Bacteria | 13998 |
| 267 | Ga0207713_1002406 | 3300025735 | Bacteria | 13664 |
| 268 | Ga0207713_1005935 | 3300025735 | Bacteria | 7537 |
| 269 | Ga0207713_1013106 | 3300025735 | Bacteria | 4390 |
| 270 | Ga0207713_1013798 | 3300025735 | Bacteria | 4234 |
| 271 | Ga0207713_1021959 | 3300025735 | Bacteria | 3045 |
| 272 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 273 | Ga0207680_10051574 | 3300025903 | Bacteria | 2461 |
| 274 | Ga0207705_10022230 | 3300025909 | Bacteria | 4524 |
| 275 | Ga0207684_10152884 | 3300025910 | Bacteria | 1986 |
| 276 | Ga0207684_10257587 | 3300025910 | Bacteria | 1505 |
| 277 | Ga0207654_10000689 | 3300025911 | Bacteria | 18808 |
| 278 | Ga0207654_10000731 | 3300025911 | Bacteria | 18271 |
| 279 | Ga0207654_10019740 | 3300025911 | Bacteria | 3563 |
| 280 | Ga0207654_10031820 | 3300025911 | Bacteria | 2909 |
| 281 | Ga0207707_10031433 | 3300025912 | Bacteria | 4645 |
| 282 | Ga0207695_10000637 | 3300025913 | Bacteria | 70175 |
| 283 | Ga0207695_10002224 | 3300025913 | Bacteria | 29144 |
| 284 | Ga0207695_10004845 | 3300025913 | Bacteria | 18166 |
| 285 | Ga0207695_10005481 | 3300025913 | Bacteria | 16806 |
| 286 | Ga0207695_10089305 | 3300025913 | Bacteria | 3099 |
| 287 | Ga0207671_10000935 | 3300025914 | Bacteria | 36496 |
| 288 | Ga0207671_10007610 | 3300025914 | Bacteria | 9372 |
| 289 | Ga0207663_10087888 | 3300025916 | Bacteria | 2054 |
| 290 | Ga0207663_10166018 | 3300025916 | Bacteria | 1563 |
| 291 | Ga0207649_10063286 | 3300025920 | Bacteria | 2335 |
| 292 | Ga0207646_10181601 | 3300025922 | Bacteria | 1900 |
| 293 | Ga0207681_10014667 | 3300025923 | Bacteria | 4878 |
| 294 | Ga0207694_10000249 | 3300025924 | Bacteria | 51431 |
| 295 | Ga0207694_10001221 | 3300025924 | Bacteria | 22261 |
| 296 | Ga0207694_10027998 | 3300025924 | Bacteria | 4296 |
| 297 | Ga0207694_10148923 | 3300025924 | Bacteria | 1885 |
| 298 | Ga0207650_10311494 | 3300025925 | Unclassified | 1288 |
| 299 | Ga0207659_10114596 | 3300025926 | Bacteria | 2055 |
| 300 | Ga0207687_10013607 | 3300025927 | Bacteria | 5311 |
| 301 | Ga0207700_10000060 | 3300025928 | Bacteria | 68678 |
| 302 | Ga0207700_10091875 | 3300025928 | Bacteria | 2399 |
| 303 | Ga0207700_10232259 | 3300025928 | Bacteria | 1569 |
| 304 | Ga0207664_10011276 | 3300025929 | Bacteria | 6341 |
| 305 | Ga0207664_10114864 | 3300025929 | Bacteria | 2244 |
| 306 | Ga0207664_10138853 | 3300025929 | Bacteria | 2053 |
| 307 | Ga0207644_10239124 | 3300025931 | Bacteria | 1445 |
| 308 | Ga0207665_10104037 | 3300025939 | Bacteria | 1986 |
| 309 | Ga0207691_10078331 | 3300025940 | Bacteria | 2975 |
| 310 | Ga0207711_10014531 | 3300025941 | Bacteria | 6544 |
| 311 | Ga0207711_10032837 | 3300025941 | Bacteria | 4390 |
| 312 | Ga0207711_10050081 | 3300025941 | Bacteria | 3576 |
| 313 | Ga0207711_10150749 | 3300025941 | Bacteria | 2098 |
| 314 | Ga0207661_10218812 | 3300025944 | Bacteria | 1682 |
| 315 | Ga0207661_10236552 | 3300025944 | Unclassified | 1619 |
| 316 | Ga0207679_10016801 | 3300025945 | Bacteria | 4865 |
| 317 | Ga0207667_10001916 | 3300025949 | Bacteria | 26137 |
| 318 | Ga0207667_10004385 | 3300025949 | Bacteria | 17283 |
| 319 | Ga0207651_10027598 | 3300025960 | Bacteria | 3568 |
| 320 | Ga0207668_10094625 | 3300025972 | Bacteria | 2203 |
| 321 | Ga0207640_10010117 | 3300025981 | Bacteria | 5303 |
| 322 | Ga0207658_10128700 | 3300025986 | Bacteria | 2031 |
| 323 | Ga0207677_10056750 | 3300026023 | Bacteria | 2685 |
| 324 | Ga0207677_10070454 | 3300026023 | Bacteria | 2464 |
| 325 | Ga0207703_10038574 | 3300026035 | Bacteria | 3813 |
| 326 | Ga0207703_10049144 | 3300026035 | Bacteria | 3409 |
| 327 | Ga0207639_10000605 | 3300026041 | Bacteria | 24765 |
| 328 | Ga0207639_10520976 | 3300026041 | Bacteria | 1089 |
| 329 | Ga0207678_10022979 | 3300026067 | Bacteria | 5457 |
| 330 | Ga0207678_10249812 | 3300026067 | Bacteria | 1519 |
| 331 | Ga0207708_10015907 | 3300026075 | Bacteria | 5649 |
| 332 | Ga0207702_10001049 | 3300026078 | Bacteria | 28307 |
| 333 | Ga0207702_10001070 | 3300026078 | Bacteria | 28050 |
| 334 | Ga0207702_10076091 | 3300026078 | Bacteria | 2901 |
| 335 | Ga0207702_10124682 | 3300026078 | Bacteria | 2310 |
| 336 | Ga0207641_10058811 | 3300026088 | Bacteria | 3272 |
| 337 | Ga0207676_10001466 | 3300026095 | Bacteria | 17524 |
| 338 | Ga0207676_10126349 | 3300026095 | Bacteria | 2166 |
| 339 | Ga0207683_10312502 | 3300026121 | Bacteria | 1438 |
| 340 | Ga0207698_10000623 | 3300026142 | Bacteria | 20591 |
| 341 | Ga0209281_1000032 | 3300027111 | Bacteria | 401727 |
| 342 | Ga0209281_1000338 | 3300027111 | Bacteria | 79936 |
| 343 | Ga0209389_1000103 | 3300027296 | Bacteria | 75590 |
| 344 | Ga0209371_1000017 | 3300027312 | Bacteria | 625776 |
| 345 | Ga0209371_1000577 | 3300027312 | Bacteria | 32935 |
| 346 | Ga0209371_1001607 | 3300027312 | Bacteria | 14687 |
| 347 | Ga0207428_10005919 | 3300027907 | Bacteria | 11322 |
| 348 | Ga0207428_10026747 | 3300027907 | Bacteria | 4809 |
| 349 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 350 | Ga0268266_10034222 | 3300028379 | Bacteria | 4321 |
| 351 | Ga0268266_10114872 | 3300028379 | Bacteria | 2389 |
| 352 | Ga0268264_10081099 | 3300028381 | Bacteria | 2772 |
| 353 | Ga0268264_10192436 | 3300028381 | Bacteria | 1860 |
| 354 | Ga0265338_10018014 | 3300028800 | Bacteria | 7582 |
| 355 | Ga0268256_1000036 | 3300030500 | Bacteria | 370250 |
| 356 | Ga0268256_1000819 | 3300030500 | Bacteria | 22302 |
| 357 | Ga0268256_1001390 | 3300030500 | Bacteria | 14687 |
| 358 | Ga0265325_10043684 | 3300031241 | Bacteria | 2337 |
| 359 | Ga0265339_10044702 | 3300031249 | Bacteria | 2441 |
| 360 | Ga0265316_10132332 | 3300031344 | Bacteria | 1878 |
| 361 | Ga0307509_10000004 | 3300031507 | Bacteria | 535507 |
| 362 | Ga0307408_100095864 | 3300031548 | Bacteria | 2249 |
| 363 | Ga0265313_10027776 | 3300031595 | Bacteria | 2957 |
| 364 | Ga0307508_10080456 | 3300031616 | Bacteria | 2840 |
| 365 | Ga0316575_10012714 | 3300031665 | Bacteria | 3136 |
| 366 | Ga0265314_10010456 | 3300031711 | Bacteria | 7742 |
| 367 | Ga0307412_10001266 | 3300031911 | Bacteria | 14173 |
| 368 | Ga0307412_10044273 | 3300031911 | Bacteria | 2903 |
| 369 | Ga0307412_10049883 | 3300031911 | Bacteria | 2759 |
| 370 | Ga0307409_100100442 | 3300031995 | Bacteria | 2398 |
| 371 | Ga0373959_0000450 | 3300034820 | Bacteria | 7685 |
| 372 | Ga0316574_0005675 | 3300035398 | Bacteria | 6676 |
| 373 | Ga0373935_0041032 | 3300035692 | Bacteria | 2906 |
| 374 | Ga0373927_0038275 | 3300035695 | Bacteria | 3114 |
| 375 | Ga0373937_0019256 | 3300036401 | Bacteria | 6109 |
| 376 | Ga0395899_0035576 | 3300037312 | Bacteria | 3738 |
| 377 | Ga0395900_0026896 | 3300037418 | Bacteria | 5888 |
| 378 | Ga0395900_0191019 | 3300037418 | Bacteria | 2077 |
| 379 | Ga0395905_0000769 | 3300037471 | Bacteria | 42306 |
| 380 | Ga0395905_0169447 | 3300037471 | Bacteria | 2051 |
| 381 | Ga0436364_0471524 | 3300037853 | Bacteria | 6420 |
| 382 | Ga0436364_0613787 | 3300037853 | Bacteria | 13985 |
| 383 | Ga0395901_0003843 | 3300038443 | Bacteria | 15134 |
| 384 | Ga0395901_0085074 | 3300038443 | Bacteria | 3306 |
| 385 | Ga0395901_0387040 | 3300038443 | Bacteria | 1438 |
| 386 | Ga0395901_0430218 | 3300038443 | Bacteria | 1352 |
| 387 | Ga0436365_0203066 | 3300039437 | Bacteria | 111457 |
| 388 | Ga0436361_0462153 | 3300039447 | Bacteria | 6697 |
| 389 | Ga0439438_016041 | 3300041405 | Bacteria | 2186 |
| 390 | Ga0439447_000503 | 3300041407 | Bacteria | 14536 |
| 391 | Ga0439447_007866 | 3300041407 | Bacteria | 3342 |
| 392 | Ga0439466_0008252 | 3300041411 | Bacteria | 3924 |
| 393 | Ga0439465_0019909 | 3300041413 | Bacteria | 2099 |
| 394 | Ga0439463_000015 | 3300042016 | Bacteria | 36632 |
| 395 | Ga0439464_0011013 | 3300042439 | Bacteria | 2391 |
| 396 | Ga0466966_0021607 | 3300044684 | Bacteria | 4226 |
| 397 | Ga0466963_0015844 | 3300044694 | Bacteria | 4679 |
| 398 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 399 | Ga0453684_0003037 | 3300044712 | Bacteria | 39031 |
| 400 | Ga0453684_0123407 | 3300044712 | Bacteria | 3122 |
| 401 | Ga0453684_0265918 | 3300044712 | Bacteria | 1962 |
| 402 | Ga0453684_0297727 | 3300044712 | Bacteria | 1835 |
| 403 | Ga0466968_0036004 | 3300044735 | Bacteria | 2073 |
| 404 | Ga0466970_0058034 | 3300044765 | Bacteria | 2071 |
| 405 | Ga0451576_0000325 | 3300045051 | Bacteria | 115644 |
| 406 | Ga0451576_0004373 | 3300045051 | Bacteria | 18423 |
| 407 | Ga0451576_0165107 | 3300045051 | Bacteria | 2311 |
| 408 | Ga0451576_0507514 | 3300045051 | Bacteria | 1267 |
| 409 | Ga0466958_0066902 | 3300045836 | Bacteria | 2194 |
| 410 | Ga0466967_0007112 | 3300045976 | Bacteria | 8031 |
| 411 | Ga0466967_0064875 | 3300045976 | Bacteria | 3249 |
| 412 | Ga0495617_000166 | 3300046452 | Bacteria | 42074 |
| 413 | Ga0495617_000972 | 3300046452 | Bacteria | 13311 |
| 414 | Ga0495617_009939 | 3300046452 | Bacteria | 3262 |
| 415 | Ga0495617_013456 | 3300046452 | Bacteria | 2785 |
| 416 | Ga0495617_036485 | 3300046452 | Bacteria | 1648 |
| 417 | Ga0495617_048588 | 3300046452 | Bacteria | 1412 |
| 418 | Ga0495603_0000025 | 3300046455 | Bacteria | 62985 |
| 419 | Ga0495590_0000306 | 3300046457 | Bacteria | 25686 |
| 420 | Ga0495591_000002 | 3300046458 | Bacteria | 455013 |
| 421 | Ga0495591_000049 | 3300046458 | Bacteria | 138951 |
| 422 | Ga0495591_000076 | 3300046458 | Bacteria | 111124 |
| 423 | Ga0495591_000545 | 3300046458 | Bacteria | 28926 |
| 424 | Ga0495591_016191 | 3300046458 | Bacteria | 2608 |
| 425 | Ga0495638_0000373 | 3300046460 | Bacteria | 55670 |
| 426 | Ga0495638_0000477 | 3300046460 | Bacteria | 48044 |
| 427 | Ga0495638_0001957 | 3300046460 | Bacteria | 17643 |
| 428 | Ga0495638_0092687 | 3300046460 | Bacteria | 1818 |
| 429 | Ga0495638_0179805 | 3300046460 | Bacteria | 1207 |
| 430 | Ga0495653_0003212 | 3300046463 | Bacteria | 13091 |
| 431 | Ga0495653_0006291 | 3300046463 | Bacteria | 9741 |
| 432 | Ga0495653_0044424 | 3300046463 | Bacteria | 3447 |
| 433 | Ga0495650_0000031 | 3300046471 | Bacteria | 433811 |
| 434 | Ga0495650_0001378 | 3300046471 | Bacteria | 23968 |
| 435 | Ga0495650_0004885 | 3300046471 | Bacteria | 8968 |
| 436 | Ga0495650_0006455 | 3300046471 | Bacteria | 7298 |
| 437 | Ga0495650_0006668 | 3300046471 | Bacteria | 7155 |
| 438 | Ga0495580_0000005 | 3300046472 | Bacteria | 107243 |
| 439 | Ga0495580_0004911 | 3300046472 | Bacteria | 11183 |
| 440 | Ga0495580_0005902 | 3300046472 | Bacteria | 10048 |
| 441 | Ga0495580_0014041 | 3300046472 | Bacteria | 6091 |
| 442 | Ga0495605_0000517 | 3300046474 | Bacteria | 32881 |
| 443 | Ga0495605_0001304 | 3300046474 | Bacteria | 16517 |
| 444 | Ga0495605_0003775 | 3300046474 | Bacteria | 8987 |
| 445 | Ga0495605_0014986 | 3300046474 | Bacteria | 4227 |
| 446 | Ga0495605_0051067 | 3300046474 | Bacteria | 2014 |
| 447 | Ga0495664_0012766 | 3300046477 | Bacteria | 4759 |
| 448 | Ga0495584_0036972 | 3300046491 | Bacteria | 2466 |
| 449 | Ga0495585_0002349 | 3300046492 | Bacteria | 13593 |
| 450 | Ga0495585_0004774 | 3300046492 | Bacteria | 8719 |
| 451 | Ga0495585_0021020 | 3300046492 | Bacteria | 3748 |
| 452 | Ga0495585_0062695 | 3300046492 | Bacteria | 2042 |
| 453 | Ga0495594_0062851 | 3300046499 | Bacteria | 2056 |
| 454 | Ga0495596_0000087 | 3300046500 | Bacteria | 64252 |
| 455 | Ga0495607_0003007 | 3300046501 | Bacteria | 13165 |
| 456 | Ga0495607_0021248 | 3300046501 | Bacteria | 4086 |
| 457 | Ga0495607_0078103 | 3300046501 | Bacteria | 1827 |
| 458 | Ga0495607_0175416 | 3300046501 | Bacteria | 1079 |
| 459 | Ga0495583_0000059 | 3300046506 | Bacteria | 199575 |
| 460 | Ga0495583_0003963 | 3300046506 | Bacteria | 10932 |
| 461 | Ga0495583_0010191 | 3300046506 | Bacteria | 5514 |
| 462 | Ga0495583_0031047 | 3300046506 | Bacteria | 2595 |
| 463 | Ga0495583_0066259 | 3300046506 | Bacteria | 1598 |
| 464 | Ga0495606_0001321 | 3300046507 | Bacteria | 33870 |
| 465 | Ga0495606_0117543 | 3300046507 | Bacteria | 1595 |
| 466 | Ga0495606_0142562 | 3300046507 | Bacteria | 1413 |
| 467 | Ga0495606_0191427 | 3300046507 | Bacteria | 1172 |
| 468 | Ga0495608_0001348 | 3300046511 | Bacteria | 17514 |
| 469 | Ga0495608_0065502 | 3300046511 | Bacteria | 2380 |
| 470 | Ga0495610_0000848 | 3300046512 | Bacteria | 28487 |
| 471 | Ga0495610_0001087 | 3300046512 | Bacteria | 24865 |
| 472 | Ga0495610_0001982 | 3300046512 | Bacteria | 17467 |
| 473 | Ga0495610_0022283 | 3300046512 | Bacteria | 3468 |
| 474 | Ga0495616_0000165 | 3300046513 | Bacteria | 57822 |
| 475 | Ga0495616_0023716 | 3300046513 | Bacteria | 3298 |
| 476 | Ga0495620_0001627 | 3300046515 | Bacteria | 13296 |
| 477 | Ga0495620_0004873 | 3300046515 | Bacteria | 7532 |
| 478 | Ga0495620_0054395 | 3300046515 | Bacteria | 1691 |
| 479 | Ga0495628_0001615 | 3300046516 | Bacteria | 20645 |
| 480 | Ga0495628_0312991 | 3300046516 | Bacteria | 1160 |
| 481 | Ga0495630_0055415 | 3300046517 | Bacteria | 2971 |
| 482 | Ga0495630_0091075 | 3300046517 | Bacteria | 2304 |
| 483 | Ga0495630_0163812 | 3300046517 | Bacteria | 1692 |
| 484 | Ga0495630_0189494 | 3300046517 | Bacteria | 1569 |
| 485 | Ga0495631_0000031 | 3300046518 | Bacteria | 85555 |
| 486 | Ga0495631_0005399 | 3300046518 | Bacteria | 6686 |
| 487 | Ga0495631_0007732 | 3300046518 | Bacteria | 5454 |
| 488 | Ga0495632_0016673 | 3300046519 | Bacteria | 4078 |
| 489 | Ga0495632_0028749 | 3300046519 | Bacteria | 2899 |
| 490 | Ga0495632_0038410 | 3300046519 | Bacteria | 2424 |
| 491 | Ga0495637_0000365 | 3300046520 | Bacteria | 34448 |
| 492 | Ga0495637_0003162 | 3300046520 | Bacteria | 8788 |
| 493 | Ga0495637_0021867 | 3300046520 | Bacteria | 2925 |
| 494 | Ga0495643_0000284 | 3300046522 | Bacteria | 72435 |
| 495 | Ga0495643_0093138 | 3300046522 | Bacteria | 1552 |
| 496 | Ga0495648_0001897 | 3300046524 | Bacteria | 19952 |
| 497 | Ga0495648_0004024 | 3300046524 | Bacteria | 12700 |
| 498 | Ga0495648_0026190 | 3300046524 | Bacteria | 3929 |
| 499 | Ga0495648_0049774 | 3300046524 | Bacteria | 2565 |
| 500 | Ga0495648_0148890 | 3300046524 | Bacteria | 1223 |
| 501 | Ga0495663_0067576 | 3300046525 | Bacteria | 1133 |
| 502 | Ga0495666_0009884 | 3300046526 | Bacteria | 4765 |
| 503 | Ga0495652_0000812 | 3300046529 | Bacteria | 36015 |
| 504 | Ga0495652_0048359 | 3300046529 | Bacteria | 3645 |
| 505 | Ga0495652_0144169 | 3300046529 | Bacteria | 1869 |
| 506 | Ga0495654_0000069 | 3300046530 | Bacteria | 120853 |
| 507 | Ga0495654_0000079 | 3300046530 | Bacteria | 109816 |
| 508 | Ga0495654_0005114 | 3300046530 | Bacteria | 7664 |
| 509 | Ga0495654_0021836 | 3300046530 | Bacteria | 3329 |
| 510 | Ga0495654_0054102 | 3300046530 | Bacteria | 1948 |
| 511 | Ga0495654_0105631 | 3300046530 | Bacteria | 1290 |
| 512 | Ga0495665_0020274 | 3300046531 | Bacteria | 3572 |
| 513 | Ga0495640_0114021 | 3300046533 | Bacteria | 1763 |
| 514 | Ga0495587_0001718 | 3300046536 | Bacteria | 14619 |
| 515 | Ga0495621_0001317 | 3300046539 | Bacteria | 6415 |
| 516 | Ga0495597_0001260 | 3300046542 | Bacteria | 18706 |
| 517 | Ga0495597_0062640 | 3300046542 | Bacteria | 1617 |
| 518 | Ga0495645_0016029 | 3300046543 | Bacteria | 5342 |
| 519 | Ga0495622_0000011 | 3300046557 | Bacteria | 201507 |
| 520 | Ga0495622_0001980 | 3300046557 | Bacteria | 10037 |
| 521 | Ga0495633_0011667 | 3300046558 | Bacteria | 4719 |
| 522 | Ga0495633_0076960 | 3300046558 | Bacteria | 1554 |
| 523 | Ga0495633_0078976 | 3300046558 | Bacteria | 1532 |
| 524 | Ga0495633_0143891 | 3300046558 | Bacteria | 1102 |
| 525 | Ga0495667_0000215 | 3300046559 | Bacteria | 38593 |
| 526 | Ga0495656_0015779 | 3300046615 | Bacteria | 2857 |
| 527 | Ga0495668_0002790 | 3300046616 | Bacteria | 13912 |
| 528 | Ga0495668_0007922 | 3300046616 | Bacteria | 6704 |
| 529 | Ga0495668_0025823 | 3300046616 | Bacteria | 3336 |
| 530 | Ga0495668_0065237 | 3300046616 | Bacteria | 2004 |
| 531 | Ga0495634_0000347 | 3300046642 | Bacteria | 44864 |
| 532 | Ga0495611_0001754 | 3300046648 | Bacteria | 10495 |
| 533 | Ga0495611_0006671 | 3300046648 | Bacteria | 4911 |
| 534 | Ga0495611_0054525 | 3300046648 | Bacteria | 1807 |
| 535 | Ga0495625_0001743 | 3300046660 | Bacteria | 25161 |
| 536 | Ga0495625_0003377 | 3300046660 | Bacteria | 16005 |
| 537 | Ga0495625_0005641 | 3300046660 | Bacteria | 11340 |
| 538 | Ga0495625_0005925 | 3300046660 | Bacteria | 10995 |
| 539 | Ga0495625_0015936 | 3300046660 | Bacteria | 5930 |
| 540 | Ga0495625_0245233 | 3300046660 | Bacteria | 1165 |
| 541 | Ga0495635_0046015 | 3300046663 | Bacteria | 3010 |
| 542 | Ga0495661_0000861 | 3300046665 | Bacteria | 28277 |
| 543 | Ga0495588_0001410 | 3300046674 | Bacteria | 10267 |
| 544 | Ga0495657_0006599 | 3300046675 | Bacteria | 9063 |
| 545 | Ga0495599_0078903 | 3300046678 | Bacteria | 2056 |
| 546 | Ga0495623_0002958 | 3300046679 | Bacteria | 11177 |
| 547 | Ga0495623_0011387 | 3300046679 | Bacteria | 5755 |
| 548 | Ga0495646_0023944 | 3300046680 | Bacteria | 3845 |
| 549 | Ga0495646_0046615 | 3300046680 | Bacteria | 2641 |
| 550 | Ga0495613_0102040 | 3300046689 | Bacteria | 2072 |
| 551 | Ga0495624_0016322 | 3300046690 | Bacteria | 4998 |
| 552 | Ga0495624_0028114 | 3300046690 | Bacteria | 3677 |
| 553 | Ga0495670_0004284 | 3300046691 | Bacteria | 6989 |
| 554 | Ga0495670_0004799 | 3300046691 | Bacteria | 6640 |
| 555 | Ga0495671_0000446 | 3300046692 | Bacteria | 32728 |
| 556 | Ga0495671_0002224 | 3300046692 | Bacteria | 12335 |
| 557 | Ga0495671_0074469 | 3300046692 | Bacteria | 1665 |
| 558 | Ga0495649_0000245 | 3300046694 | Bacteria | 47917 |
| 559 | Ga0495649_0006297 | 3300046694 | Bacteria | 7386 |
| 560 | Ga0495649_0008701 | 3300046694 | Bacteria | 6090 |
| 561 | Ga0495649_0019004 | 3300046694 | Bacteria | 3861 |
| 562 | Ga0495649_0021669 | 3300046694 | Bacteria | 3600 |
| 563 | Ga0495649_0025203 | 3300046694 | Bacteria | 3312 |
| 564 | Ga0495649_0188377 | 3300046694 | Bacteria | 1074 |
| 565 | Ga0495589_0011590 | 3300046794 | Bacteria | 4577 |
| 566 | Ga0495589_0024759 | 3300046794 | Bacteria | 3049 |
| 567 | Ga0495589_0046180 | 3300046794 | Bacteria | 2163 |
| 568 | Ga0495600_0029338 | 3300046809 | Bacteria | 3561 |
| 569 | Ga0495660_0000016 | 3300046810 | Bacteria | 321859 |
| 570 | Ga0495660_0000153 | 3300046810 | Bacteria | 74797 |
| 571 | Ga0495660_0000302 | 3300046810 | Bacteria | 44594 |
| 572 | Ga0495660_0002788 | 3300046810 | Bacteria | 11013 |
| 573 | Ga0495660_0020164 | 3300046810 | Bacteria | 3822 |
| 574 | Ga0495660_0022024 | 3300046810 | Bacteria | 3643 |
| 575 | Ga0495660_0053672 | 3300046810 | Bacteria | 2187 |
| 576 | Ga0495660_0095053 | 3300046810 | Bacteria | 1542 |
| 577 | Ga0495604_0019379 | 3300047317 | Bacteria | 5445 |
| 578 | Ga0495604_0022082 | 3300047317 | Bacteria | 5079 |
| 579 | Ga0495604_0057310 | 3300047317 | Bacteria | 2995 |
| 580 | Ga0495674_0000271 | 3300047319 | Bacteria | 44227 |
| 581 | Ga0495674_0008422 | 3300047319 | Bacteria | 9823 |
| 582 | Ga0495674_0017477 | 3300047319 | Bacteria | 6674 |
| 583 | Ga0495674_0048003 | 3300047319 | Bacteria | 3781 |
| 584 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 585 | Ga0495672_0000037 | 3300047320 | Bacteria | 278588 |
| 586 | Ga0495672_0000062 | 3300047320 | Bacteria | 211745 |
| 587 | Ga0495672_0002052 | 3300047320 | Bacteria | 18929 |
| 588 | Ga0495680_0002950 | 3300047322 | Bacteria | 17024 |
| 589 | Ga0495680_0029851 | 3300047322 | Bacteria | 4460 |
| 590 | Ga0495683_0002439 | 3300047323 | Bacteria | 11240 |
| 591 | Ga0495687_013230 | 3300047443 | Bacteria | 4318 |
| 592 | Ga0495687_027145 | 3300047443 | Bacteria | 2683 |
| 593 | Ga0495675_0000354 | 3300047444 | Bacteria | 32123 |
| 594 | Ga0495675_0046475 | 3300047444 | Bacteria | 2763 |
| 595 | Ga0495679_000590 | 3300047446 | Bacteria | 24982 |
| 596 | Ga0495679_017874 | 3300047446 | Bacteria | 2529 |
| 597 | Ga0495679_022488 | 3300047446 | Bacteria | 2156 |
| 598 | Ga0495673_0000191 | 3300047469 | Bacteria | 96817 |
| 599 | Ga0495673_0000358 | 3300047469 | Bacteria | 56024 |
| 600 | Ga0495673_0000753 | 3300047469 | Bacteria | 30736 |
| 601 | Ga0495681_0000527 | 3300047470 | Bacteria | 29212 |
| 602 | Ga0495681_0006810 | 3300047470 | Bacteria | 7434 |
| 603 | Ga0495681_0009252 | 3300047470 | Bacteria | 6091 |
| 604 | Ga0495681_0017092 | 3300047470 | Bacteria | 4041 |
| 605 | Ga0495684_0002068 | 3300047471 | Bacteria | 16129 |
| 606 | Ga0495684_0020764 | 3300047471 | Bacteria | 5060 |
| 607 | Ga0495686_0000047 | 3300047472 | Bacteria | 280086 |
| 608 | Ga0495686_0002819 | 3300047472 | Bacteria | 15756 |
| 609 | Ga0495593_0013628 | 3300047673 | Bacteria | 4633 |
| 610 | Ga0495602_0059737 | 3300048088 | Bacteria | 3326 |
| 611 | Ga0495626_0000057 | 3300048091 | Bacteria | 148288 |
| 612 | Ga0495626_0000374 | 3300048091 | Bacteria | 46701 |
| 613 | Ga0495626_0005649 | 3300048091 | Bacteria | 7245 |
| 614 | Ga0496100_0024105 | 3300048903 | Bacteria | 3706 |
| 615 | Ga0496100_0065169 | 3300048903 | Bacteria | 2413 |
| 616 | Ga0496101_0008350 | 3300048904 | Bacteria | 6767 |
| 617 | Ga0496101_0022200 | 3300048904 | Bacteria | 4367 |
| 618 | Ga0496101_0051243 | 3300048904 | Bacteria | 2974 |
| 619 | Ga0496101_0089574 | 3300048904 | Bacteria | 2287 |
| 620 | Ga0496102_0000444 | 3300048905 | Bacteria | 47025 |
| 621 | Ga0496102_0005013 | 3300048905 | Bacteria | 11214 |
| 622 | Ga0496102_0059670 | 3300048905 | Bacteria | 3489 |
| 623 | Ga0496102_0119593 | 3300048905 | Bacteria | 2460 |
| 624 | Ga0496102_0281788 | 3300048905 | Bacteria | 1567 |
| 625 | Ga0496102_0331593 | 3300048905 | Bacteria | 1433 |
| 626 | Ga0496103_0000290 | 3300048906 | Bacteria | 47006 |
| 627 | Ga0496103_0046510 | 3300048906 | Bacteria | 2679 |
| 628 | Ga0496104_0006840 | 3300048907 | Bacteria | 10049 |
| 629 | Ga0496104_0202072 | 3300048907 | Bacteria | 1899 |
| 630 | Ga0496105_0049651 | 3300048908 | Bacteria | 3464 |
| 631 | Ga0496105_0179163 | 3300048908 | Bacteria | 1735 |
| 632 | Ga0496105_0252066 | 3300048908 | Bacteria | 1430 |
| 633 | Ga0496106_0090721 | 3300048909 | Bacteria | 2358 |
| 634 | Ga0496107_0011893 | 3300048910 | Bacteria | 6079 |
| 635 | Ga0496107_0028942 | 3300048910 | Bacteria | 3940 |
| 636 | Ga0496107_0162996 | 3300048910 | Bacteria | 1653 |
| 637 | Ga0496108_0069625 | 3300048911 | Bacteria | 2969 |
| 638 | Ga0496108_0349892 | 3300048911 | Bacteria | 1289 |
| 639 | Ga0496109_0010551 | 3300048912 | Bacteria | 7898 |
| 640 | Ga0496109_0422889 | 3300048912 | Bacteria | 1258 |
| 641 | Ga0496110_0010902 | 3300048913 | Bacteria | 7411 |
| 642 | Ga0496110_0016914 | 3300048913 | Bacteria | 6096 |
| 643 | Ga0496110_0153019 | 3300048913 | Bacteria | 2089 |
| 644 | Ga0496114_0021179 | 3300048917 | Bacteria | 5287 |
| 645 | Ga0496114_0095352 | 3300048917 | Bacteria | 2532 |
| 646 | Ga0496114_0132976 | 3300048917 | Bacteria | 2150 |
| 647 | Ga0496114_0161162 | 3300048917 | Bacteria | 1951 |
| 648 | Ga0496115_0001021 | 3300048918 | Bacteria | 20300 |
| 649 | Ga0496115_0015041 | 3300048918 | Bacteria | 5865 |
| 650 | Ga0496115_0109155 | 3300048918 | Bacteria | 2272 |
| 651 | Ga0496116_0000394 | 3300048919 | Bacteria | 63846 |
| 652 | Ga0496116_0015807 | 3300048919 | Bacteria | 5944 |
| 653 | Ga0496116_0035428 | 3300048919 | Bacteria | 3505 |
| 654 | Ga0496116_0055403 | 3300048919 | Bacteria | 2604 |
| 655 | Ga0496117_0001290 | 3300048920 | Bacteria | 36931 |
| 656 | Ga0496117_0002386 | 3300048920 | Bacteria | 23895 |
| 657 | Ga0496117_0008509 | 3300048920 | Bacteria | 9730 |
| 658 | Ga0496117_0032627 | 3300048920 | Bacteria | 3953 |
| 659 | Ga0496117_0062710 | 3300048920 | Bacteria | 2545 |
| 660 | Ga0496118_0000048 | 3300048921 | Bacteria | 253404 |
| 661 | Ga0496118_0000491 | 3300048921 | Bacteria | 65587 |
| 662 | Ga0496118_0005120 | 3300048921 | Bacteria | 15061 |
| 663 | Ga0496118_0039071 | 3300048921 | Bacteria | 3792 |
| 664 | Ga0496118_0082682 | 3300048921 | Bacteria | 2248 |
| 665 | Ga0496119_0005301 | 3300048922 | Bacteria | 12414 |
| 666 | Ga0496120_0085256 | 3300048923 | Bacteria | 1701 |
| 667 | Ga0496121_0000055 | 3300048924 | Bacteria | 304572 |
| 668 | Ga0496121_0001253 | 3300048924 | Bacteria | 43985 |
| 669 | Ga0496121_0008653 | 3300048924 | Bacteria | 11901 |
| 670 | Ga0496122_0000810 | 3300048925 | Bacteria | 59986 |
| 671 | Ga0496123_0001426 | 3300048926 | Bacteria | 33426 |
| 672 | Ga0496124_0000390 | 3300048927 | Bacteria | 79997 |
| 673 | Ga0496124_0000445 | 3300048927 | Bacteria | 72989 |
| 674 | Ga0496124_0000634 | 3300048927 | Bacteria | 58255 |
| 675 | Ga0496124_0005976 | 3300048927 | Bacteria | 13440 |
| 676 | Ga0496124_0006685 | 3300048927 | Bacteria | 12486 |
| 677 | Ga0496124_0009020 | 3300048927 | Bacteria | 10319 |
| 678 | Ga0496124_0010485 | 3300048927 | Bacteria | 9377 |
| 679 | Ga0496124_0023815 | 3300048927 | Bacteria | 5580 |
| 680 | Ga0496125_0000232 | 3300048928 | Bacteria | 114025 |
| 681 | Ga0496125_0005805 | 3300048928 | Bacteria | 13555 |
| 682 | Ga0496125_0009714 | 3300048928 | Bacteria | 9824 |
| 683 | Ga0496125_0011442 | 3300048928 | Bacteria | 8873 |
| 684 | Ga0496125_0101591 | 3300048928 | Bacteria | 2116 |
| 685 | Ga0496126_0069447 | 3300048929 | Bacteria | 3143 |
| 686 | Ga0496126_0073802 | 3300048929 | Bacteria | 3032 |
| 687 | Ga0496126_0120620 | 3300048929 | Bacteria | 2274 |
| 688 | Ga0496126_0161928 | 3300048929 | Bacteria | 1911 |
| 689 | Ga0496126_0299154 | 3300048929 | Bacteria | 1328 |
| 690 | Ga0495678_000091 | 3300049459 | Bacteria | 114504 |
| 691 | Ga0495678_002781 | 3300049459 | Bacteria | 11428 |
| 692 | Ga0495678_027486 | 3300049459 | Bacteria | 2413 |
| 693 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 694 | Ga0495682_0000152 | 3300049460 | Bacteria | 59145 |
| 695 | Ga0495682_0000232 | 3300049460 | Bacteria | 43870 |
| 696 | Ga0495682_0004828 | 3300049460 | Bacteria | 5692 |
| 697 | Ga0495682_0007557 | 3300049460 | Bacteria | 4316 |
| 698 | Ga0495682_0023301 | 3300049460 | Bacteria | 2311 |
| 699 | Ga0495682_0051776 | 3300049460 | Bacteria | 1493 |
| 700 | Ga0501034_0101163 | 3300049571 | Bacteria | 2876 |
| 701 | Ga0501037_0176986 | 3300049573 | Bacteria | 1515 |
| 702 | Ga0501046_0350519 | 3300049580 | Bacteria | 1072 |
| 703 | Ga0501047_0228330 | 3300049581 | Bacteria | 1716 |
| 704 | Ga0501070_0040644 | 3300049586 | Bacteria | 3878 |
| 705 | Ga0501070_0166386 | 3300049586 | Bacteria | 1817 |
| 706 | Ga0501249_000065 | 3300049679 | Bacteria | 38092 |
| 707 | Ga0501080_0033932 | 3300049742 | Bacteria | 4764 |
| 708 | Ga0501080_0313469 | 3300049742 | Bacteria | 1421 |
| 709 | Ga0501083_0105627 | 3300049744 | Bacteria | 1854 |
| 710 | Ga0501044_0160648 | 3300049823 | Bacteria | 2224 |
| 711 | Ga0501204_003614 | 3300049850 | Bacteria | 1636 |
| 712 | nmdc:mga00v17_4678_c1 | 3300050491 | Bacteria | 7149 |
| 713 | nmdc:mga05p37_3097_c1 | 3300050507 | Bacteria | 19323 |
| 714 | nmdc:mga05p37_4683_c1 | 3300050507 | Bacteria | 15978 |
| 715 | nmdc:mga09592_14038_c1 | 3300050508 | Bacteria | 6540 |
| 716 | nmdc:mga0n895_104802_c1 | 3300050512 | Bacteria | 2840 |
| 717 | nmdc:mga0n895_352619_c1 | 3300050512 | Bacteria | 1490 |
| 718 | nmdc:mga0rr50_38934_c1 | 3300050513 | Bacteria | 3445 |
| 719 | nmdc:mga08x19_17316_c1 | 3300050514 | Bacteria | 4407 |
| 720 | nmdc:mga08x19_25250_c1 | 3300050514 | Bacteria | 3700 |
| 721 | nmdc:mga08x19_34963_c1 | 3300050514 | Bacteria | 3178 |
| 722 | Ga0495601_0076363 | 3300053077 | Bacteria | 2145 |
| 723 | Ga0500610_0075796 | 3300053079 | Bacteria | 1754 |
| 724 | Ga0495619_0036206 | 3300053085 | Bacteria | 3212 |
| 725 | Ga0500578_0131726 | 3300053086 | Bacteria | 1568 |
| 726 | Ga0500643_000024 | 3300053087 | Bacteria | 265935 |
| 727 | Ga0500644_0000126 | 3300053088 | Bacteria | 47091 |
| 728 | Ga0500555_020364 | 3300053103 | Bacteria | 1910 |
| 729 | Ga0500569_016973 | 3300053109 | Bacteria | 1853 |
| 730 | Ga0500594_0000563 | 3300053118 | Bacteria | 8009 |
| 731 | Ga0500594_0000661 | 3300053118 | Bacteria | 7332 |
| 732 | Ga0500594_0003332 | 3300053118 | Bacteria | 3519 |
| 733 | Ga0500618_000116 | 3300053125 | Bacteria | 64971 |
| 734 | Ga0500618_000269 | 3300053125 | Bacteria | 40125 |
| 735 | Ga0500618_000344 | 3300053125 | Bacteria | 33227 |
| 736 | Ga0500621_000002 | 3300053126 | Bacteria | 849473 |
| 737 | Ga0500658_0046104 | 3300053134 | Bacteria | 1764 |
| 738 | Ga0500659_0004513 | 3300053135 | Bacteria | 7941 |
| 739 | Ga0500559_0061927 | 3300053136 | Bacteria | 1670 |
| 740 | Ga0500568_0000168 | 3300053139 | Bacteria | 56752 |
| 741 | Ga0500568_0053025 | 3300053139 | Bacteria | 1590 |
| 742 | Ga0500616_0001366 | 3300053153 | Bacteria | 23717 |
| 743 | Ga0500634_0000185 | 3300053161 | Bacteria | 20592 |
| 744 | Ga0500636_0001796 | 3300053177 | Bacteria | 11746 |
| 745 | Ga0500636_0028376 | 3300053177 | Bacteria | 3306 |
| 746 | Ga0500609_000501 | 3300053731 | Bacteria | 5862 |
| 747 | Ga0500661_003130 | 3300055283 | Bacteria | 3109 |
| 748 | 2969082261 | 2969079654 | Bacteria | 5439582 |
| 749 | 2511131630 | 2510917022 | Bacteria | 6504556 |
| 750 | 2511195577 | 2510917030 | Bacteria | 7460662 |
| 751 | 2511257805 | 2511231004 | Bacteria | 6669789 |
| 752 | 2511371659 | 2511231023 | Bacteria | 6808468 |
| 753 | 2511433105 | 2511231035 | Bacteria | 5341610 |
| 754 | 2511437259 | 2511231035 | Bacteria | 5341610 |
| 755 | 2511825122 | 2511231156 | Bacteria | 6845832 |
| 756 | 2513868976 | 2513237138 | Bacteria | 7368160 |
| 757 | 2524452122 | 2524023207 | Bacteria | 6813453 |
| 758 | 2585275104 | 2582581307 | Bacteria | 6597605 |
| 759 | 2585553970 | 2585427530 | Bacteria | 7383882 |
| 760 | 2585555122 | 2585427530 | Bacteria | 7383882 |
| 761 | 2585561182 | 2585427531 | Bacteria | 6992870 |
| 762 | 2585563712 | 2585427531 | Bacteria | 6992870 |
| 763 | 2585848029 | 2585427594 | Bacteria | 6180594 |
| 764 | 2585900045 | 2585427608 | Bacteria | 6544331 |
| 765 | 2585908224 | 2585427609 | Bacteria | 6667127 |
| 766 | 2587983741 | 2585428125 | Bacteria | 6662905 |
| 767 | 2599409392 | 2599185169 | Bacteria | 5441380 |
| 768 | 2601643728 | 2600255287 | Bacteria | 5210468 |
| 769 | 2601663552 | 2600255291 | Bacteria | 5217298 |
| 770 | 2601696567 | 2600255298 | Bacteria | 5215185 |
| 771 | 2601701184 | 2600255299 | Bacteria | 5218662 |
| 772 | 2601721591 | 2600255303 | Bacteria | 5219315 |
| 773 | 2601739932 | 2600255307 | Bacteria | 5439064 |
| 774 | 2601750421 | 2600255309 | Bacteria | 5431045 |
| 775 | 2602017674 | 2600255392 | Bacteria | 5437392 |
| 776 | 2603660938 | 2602042052 | Bacteria | 5215873 |
| 777 | 2603666212 | 2602042053 | Bacteria | 5214361 |
| 778 | 2603697914 | 2602042066 | Bacteria | 4423871 |
| 779 | 2603877025 | 2602042111 | Bacteria | 5212080 |
| 780 | 2606070645 | 2603880184 | Bacteria | 5217896 |
| 781 | 2637225288 | 2636415599 | Bacteria | 5718434 |
| 782 | 2644003296 | 2643221599 | Bacteria | 6292121 |
| 783 | 2644089906 | 2643221615 | Bacteria | 5487866 |
| 784 | 2644319751 | 2643221657 | Bacteria | 5490246 |
| 785 | 2644498200 | 2643221689 | Bacteria | 6042950 |
| 786 | 2676406537 | 2675903046 | Bacteria | 5451247 |
| 787 | 2739793002 | 2739367756 | Bacteria | 4553612 |
| 788 | 2807176779 | 2806310673 | Bacteria | 4801221 |
| 789 | 2819683018 | 2818991461 | Bacteria | 7026071 |
| 790 | 2842875173 | 2842871566 | Bacteria | 4827117 |
| 791 | 2842925267 | 2842922631 | Bacteria | 5824079 |
| 792 | 2844529751 | 2844528606 | Bacteria | 4733806 |
| 793 | 2852108096 | 2852103415 | Bacteria | 5193810 |
| 794 | 2855387097 | 2855386786 | Bacteria | 4752232 |
| 795 | 2857567803 | 2857564685 | Bacteria | 6290584 |
| 796 | 2857743625 | 2857740372 | Bacteria | 4782044 |
| 797 | 2865014704 | 2865014394 | Bacteria | 4764573 |
| 798 | 2888374792 | 2888373701 | Bacteria | 5098052 |
| 799 | 2889421354 | 2889415604 | Bacteria | 8048700 |
| 800 | 2904500801 | 2904497146 | Bacteria | 4731781 |
| 801 | 2904508657 | 2904504865 | Bacteria | 5152820 |
| 802 | 2908673891 | 2908669403 | Bacteria | 5740494 |
| 803 | 2910812536 | 2910809715 | Bacteria | 4982797 |
| 804 | 2919461241 | 2919456309 | Bacteria | 6586567 |
| 805 | 2939573338 | 2939573065 | Bacteria | 4926053 |
| 806 | 2939675912 | 2939674588 | Bacteria | 4844420 |
| 807 | 3007614439 | 3007614139 | Bacteria | 6053559 |
| 808 | 643603760 | 643348564 | Bacteria | 8839022 |
| 809 | 8018179758 | 8018176218 | Bacteria | 6896178 |
| 810 | 8018222226 | 8018221730 | Bacteria | 4616064 |
| 811 | 8055090080 | 8055087960 | Bacteria | 4784273 |
| 812 | 8055093110 | 8055092621 | Bacteria | 4873875 |
| 813 | 8055695740 | 8055693939 | Bacteria | 4772047 |
| 814 | 8056182471 | 8056177738 | Bacteria | 6748268 |
| 815 | JGI24735J21928_10011974 | |||
| 816 | JGI24735J21928_10017115 | |||
| 817 | JGI25162J39368_1000002 | |||
| 818 | JGI25163J39215_1000043 | |||
| 819 | JGI25164J39214_1000066 | |||
| 820 | JGI25406J46586_10001789 | |||
| 821 | JGI25406J46586_10026758 | |||
| 822 | Ga0055538_1000003 | |||
| 823 | Ga0055539_1000003 | |||
| 824 | Ga0055539_1000836 | |||
| 825 | Ga0055533_1000005 | |||
| 826 | Ga0055533_1007646 | |||
| 827 | Ga0055525_1000005 | |||
| 828 | Ga0055527_1000037 | |||
| 829 | Ga0055535_1000059 | |||
| 830 | Ga0055542_1000086 | |||
| 831 | Ga0055529_1000231 | |||
| 832 | Ga0055540_1019204 | |||
| 833 | Ga0055531_10049763 | |||
| 834 | Ga0055541_1000003 | |||
| 835 | Ga0058692_1001201 | |||
| 836 | Ga0058692_1009243 | |||
| 837 | Ga0065704_10003190 | |||
| 838 | Ga0065704_10190575 | |||
| 839 | Ga0070658_10041386 | |||
| 840 | Ga0070683_100142390 | |||
| 841 | Ga0070690_100279182 | |||
| 842 | Ga0070670_100146788 | |||
| 843 | Ga0070666_10000003 | |||
| 844 | Ga0070666_10154762 | |||
| 845 | Ga0070682_100083490 | |||
| 846 | Ga0070689_100007811 | |||
| 847 | Ga0070689_100008890 | |||
| 848 | Ga0070687_100209289 | |||
| 849 | Ga0070661_100018950 | |||
| 850 | Ga0070671_100092107 | |||
| 851 | Ga0070671_100284442 | |||
| 852 | Ga0070673_100040702 | |||
| 853 | Ga0070714_100019059 | |||
| 854 | Ga0070714_100049176 | |||
| 855 | Ga0070714_100054675 | |||
| 856 | Ga0070713_100000524 | |||
| 857 | Ga0070713_100272651 | |||
| 858 | Ga0070711_100108597 | |||
| 859 | Ga0070700_100058445 | |||
| 860 | Ga0070708_100288993 | |||
| 861 | Ga0070663_100006248 | |||
| 862 | Ga0070663_100024663 | |||
| 863 | Ga0070681_10028764 | |||
| 864 | Ga0070685_10042375 | |||
| 865 | Ga0070685_10062077 | |||
| 866 | Ga0070706_100161445 | |||
| 867 | Ga0070706_100301189 | |||
| 868 | Ga0070707_100258966 | |||
| 869 | Ga0070707_100541745 | |||
| 870 | Ga0070699_100229057 | |||
| 871 | Ga0070679_100191321 | |||
| 872 | Ga0070684_100040485 | |||
| 873 | Ga0070684_100182823 | |||
| 874 | Ga0068853_100000635 | |||
| 875 | Ga0070696_100004816 | |||
| 876 | Ga0070696_100034637 | |||
| 877 | Ga0070693_100008068 | |||
| 878 | Ga0070665_100027074 | |||
| 879 | Ga0070665_100065899 | |||
| 880 | Ga0070704_100038993 | |||
| 881 | Ga0070704_100182506 | |||
| 882 | Ga0068855_100004022 | |||
| 883 | Ga0068855_100012713 | |||
| 884 | Ga0070664_100059919 | |||
| 885 | Ga0068857_100016940 | |||
| 886 | Ga0068854_100014963 | |||
| 887 | Ga0068856_100001530 | |||
| 888 | Ga0068856_100003746 | |||
| 889 | Ga0068856_100012673 | |||
| 890 | Ga0068856_100079820 | |||
| 891 | Ga0068852_100000234 | |||
| 892 | Ga0068852_100130625 | |||
| 893 | Ga0068859_100013483 | |||
| 894 | Ga0068859_100031068 | |||
| 895 | Ga0068859_100084260 | |||
| 896 | Ga0068859_100123275 | |||
| 897 | Ga0068859_100320371 | |||
| 898 | Ga0068864_100004501 | |||
| 899 | Ga0068864_100128708 | |||
| 900 | Ga0068864_100382674 | |||
| 901 | Ga0068863_100108984 | |||
| 902 | Ga0068858_100061121 | |||
| 903 | Ga0068860_100283232 | |||
| 904 | Ga0081538_10059932 | |||
| 905 | Ga0081540_1118328 | |||
| 906 | Ga0081539_10000045 | |||
| 907 | Ga0081539_10037914 | |||
| 908 | Ga0070716_100225132 | |||
| 909 | Ga0070712_100092352 | |||
| 910 | Ga0097621_100000417 | |||
| 911 | Ga0097621_100016407 | |||
| 912 | Ga0068871_100000652 | |||
| 913 | Ga0068871_100111404 | |||
| 914 | Ga0068871_100560307 | |||
| 915 | Ga0075428_100161311 | |||
| 916 | Ga0075428_100469038 | |||
| 917 | Ga0075434_100078047 | |||
| 918 | Ga0075434_100317955 | |||
| 919 | Ga0068865_100008092 | |||
| 920 | Ga0068865_100142372 | |||
| 921 | Ga0068865_100236845 | |||
| 922 | Ga0075436_100031864 | |||
| 923 | Ga0075436_100049846 | |||
| 924 | Ga0075436_100121580 | |||
| 925 | Ga0097620_100013483 | |||
| 926 | Ga0097620_100031068 | |||
| 927 | Ga0097620_100084262 | |||
| 928 | Ga0097620_100123274 | |||
| 929 | Ga0097620_100320356 | |||
| 930 | Ga0079104_1000014 | |||
| 931 | Ga0079104_1000203 | |||
| 932 | Ga0079104_1000357 | |||
| 933 | Ga0075435_100091397 | |||
| 934 | Ga0105251_10000086 | |||
| 935 | Ga0105251_10000529 | |||
| 936 | Ga0105251_10005219 | |||
| 937 | Ga0105251_10013602 | |||
| 938 | Ga0105251_10027030 | |||
| 939 | Ga0105251_10068242 | |||
| 940 | Ga0105251_10080345 | |||
| 941 | Ga0105244_10001832 | |||
| 942 | Ga0105244_10006109 | |||
| 943 | Ga0105244_10006547 | |||
| 944 | Ga0105244_10009564 | |||
| 945 | Ga0105244_10032598 | |||
| 946 | Ga0105244_10045867 | |||
| 947 | Ga0105244_10058537 | |||
| 948 | Ga0105250_10000002 | |||
| 949 | Ga0105250_10000070 | |||
| 950 | Ga0105250_10000616 | |||
| 951 | Ga0105250_10001404 | |||
| 952 | Ga0105250_10001622 | |||
| 953 | Ga0105250_10002655 | |||
| 954 | Ga0105250_10008467 | |||
| 955 | Ga0105240_10003365 | |||
| 956 | Ga0105240_10004201 | |||
| 957 | Ga0105240_10006437 | |||
| 958 | Ga0105240_10098903 | |||
| 959 | Ga0105240_10180679 | |||
| 960 | Ga0105240_10269666 | |||
| 961 | Ga0105245_10007338 | |||
| 962 | Ga0114129_10004675 | |||
| 963 | Ga0105243_10050400 | |||
| 964 | Ga0105241_10000383 | |||
| 965 | Ga0105241_10012596 | |||
| 966 | Ga0105241_10019513 | |||
| 967 | Ga0105241_10027715 | |||
| 968 | Ga0105241_10039319 | |||
| 969 | Ga0105242_10116979 | |||
| 970 | Ga0105248_10005255 | |||
| 971 | Ga0105248_10029774 | |||
| 972 | Ga0105248_10303395 | |||
| 973 | Ga0105237_10016153 | |||
| 974 | Ga0105237_10040970 | |||
| 975 | Ga0105237_10121831 | |||
| 976 | Ga0105238_10002982 | |||
| 977 | Ga0105238_10004919 | |||
| 978 | Ga0105238_10015258 | |||
| 979 | Ga0105238_10170473 | |||
| 980 | Ga0105238_10184975 | |||
| 981 | Ga0105249_10160098 | |||
| 982 | Ga0105239_10007680 | |||
| 983 | Ga0105239_10017583 | |||
| 984 | Ga0105239_10202198 | |||
| 985 | Ga0105246_10000013 | |||
| 986 | Ga0105246_10002258 | |||
| 987 | Ga0157373_10001081 | |||
| 988 | Ga0157371_10000092 | |||
| 989 | Ga0157371_10003279 | |||
| 990 | Ga0157370_10000596 | |||
| 991 | Ga0157370_10012653 | |||
| 992 | Ga0157369_10005321 | |||
| 993 | Ga0157369_10005711 | |||
| 994 | Ga0157369_10047903 | |||
| 995 | Ga0157369_10050166 | |||
| 996 | Ga0157374_10000955 | |||
| 997 | Ga0157374_10002768 | |||
| 998 | Ga0157374_10033334 | |||
| 999 | Ga0157374_10104431 | |||
| 1000 | Ga0157374_10171631 | |||
| 1001 | Ga0157378_10015715 | |||
| 1002 | Ga0157378_10047021 | |||
| 1003 | Ga0157378_10158133 | |||
| 1004 | Ga0163162_10000378 | |||
| 1005 | Ga0163162_10003202 | |||
| 1006 | Ga0163162_10108982 | |||
| 1007 | Ga0157372_10004147 | |||
| 1008 | Ga0157372_10013100 | |||
| 1009 | Ga0157372_10015595 | |||
| 1010 | Ga0157372_10041549 | |||
| 1011 | Ga0157372_10053886 | |||
| 1012 | Ga0157372_10099595 | |||
| 1013 | Ga0157372_10104030 | |||
| 1014 | Ga0157372_10161897 | |||
| 1015 | Ga0157375_10006430 | |||
| 1016 | Ga0157375_10186084 | |||
| 1017 | Ga0163163_10000075 | |||
| 1018 | Ga0163163_10002698 | |||
| 1019 | Ga0163163_10130540 | |||
| 1020 | Ga0163163_10272001 | |||
| 1021 | Ga0163163_10347819 | |||
| 1022 | Ga0157380_10010450 | |||
| 1023 | Ga0157380_10068862 | |||
| 1024 | Ga0157377_10052336 | |||
| 1025 | Ga0157379_10151341 | |||
| 1026 | Ga0157379_10182204 | |||
| 1027 | Ga0157379_10327801 | |||
| 1028 | Ga0182005_1007744 | |||
| 1029 | Ga0183369_1003 | |||
| 1030 | Ga0163161_10018993 | |||
| 1031 | Ga0163161_10075363 | |||
| 1032 | Ga0163161_10169251 | |||
| 1033 | Ga0213875_10002238 | |||
| 1034 | Ga0213875_10010744 | |||
| 1035 | Ga0209760_100005 | |||
| 1036 | Ga0209784_100001 | |||
| 1037 | Ga0209566_100001 | |||
| 1038 | Ga0209674_100002 | |||
| 1039 | Ga0209672_100074 | |||
| 1040 | Ga0209563_100002 | |||
| 1041 | Ga0207427_100009 | |||
| 1042 | Ga0209437_100001 | |||
| 1043 | Ga0209258_100004 | |||
| 1044 | Ga0209258_100008 | |||
| 1045 | Ga0209677_100002 | |||
| 1046 | Ga0209148_1000041 | |||
| 1047 | Ga0209455_1000007 | |||
| 1048 | Ga0209455_1012340 | |||
| 1049 | Ga0209673_1001925 | |||
| 1050 | Ga0209676_1000026 | |||
| 1051 | Ga0209025_1015065 | |||
| 1052 | Ga0209758_1005968 | |||
| 1053 | Ga0209758_1012168 | |||
| 1054 | Ga0209050_1002021 | |||
| 1055 | Ga0209051_1000151 | |||
| 1056 | Ga0209051_1001926 | |||
| 1057 | Ga0209257_1006118 | |||
| 1058 | Ga0207696_1000038 | |||
| 1059 | Ga0207696_1000239 | |||
| 1060 | Ga0207696_1000304 | |||
| 1061 | Ga0207696_1000409 | |||
| 1062 | Ga0207696_1001046 | |||
| 1063 | Ga0207696_1007415 | |||
| 1064 | Ga0207696_1009567 | |||
| 1065 | Ga0207696_1009725 | |||
| 1066 | Ga0207696_1016060 | |||
| 1067 | Ga0207655_1000002 | |||
| 1068 | Ga0207655_1000050 | |||
| 1069 | Ga0207655_1006728 | |||
| 1070 | Ga0207655_1006972 | |||
| 1071 | Ga0207655_1010748 | |||
| 1072 | Ga0207655_1010981 | |||
| 1073 | Ga0207655_1014723 | |||
| 1074 | Ga0207655_1020027 | |||
| 1075 | Ga0207655_1035278 | |||
| 1076 | Ga0207655_1040444 | |||
| 1077 | Ga0207713_1000002 | |||
| 1078 | Ga0207713_1000155 | |||
| 1079 | Ga0207713_1000191 | |||
| 1080 | Ga0207713_1002314 | |||
| 1081 | Ga0207713_1002406 | |||
| 1082 | Ga0207713_1005935 | |||
| 1083 | Ga0207713_1013106 | |||
| 1084 | Ga0207713_1013798 | |||
| 1085 | Ga0207713_1021959 | |||
| 1086 | Ga0207680_10000006 | |||
| 1087 | Ga0207680_10051574 | |||
| 1088 | Ga0207705_10022230 | |||
| 1089 | Ga0207684_10152884 | |||
| 1090 | Ga0207684_10257587 | |||
| 1091 | Ga0207654_10000689 | |||
| 1092 | Ga0207654_10000731 | |||
| 1093 | Ga0207654_10019740 | |||
| 1094 | Ga0207654_10031820 | |||
| 1095 | Ga0207707_10031433 | |||
| 1096 | Ga0207695_10000637 | |||
| 1097 | Ga0207695_10002224 | |||
| 1098 | Ga0207695_10004845 | |||
| 1099 | Ga0207695_10005481 | |||
| 1100 | Ga0207695_10089305 | |||
| 1101 | Ga0207671_10000935 | |||
| 1102 | Ga0207671_10007610 | |||
| 1103 | Ga0207663_10087888 | |||
| 1104 | Ga0207663_10166018 | |||
| 1105 | Ga0207649_10063286 | |||
| 1106 | Ga0207646_10181601 | |||
| 1107 | Ga0207681_10014667 | |||
| 1108 | Ga0207694_10000249 | |||
| 1109 | Ga0207694_10001221 | |||
| 1110 | Ga0207694_10027998 | |||
| 1111 | Ga0207694_10148923 | |||
| 1112 | Ga0207650_10311494 | |||
| 1113 | Ga0207659_10114596 | |||
| 1114 | Ga0207687_10013607 | |||
| 1115 | Ga0207700_10000060 | |||
| 1116 | Ga0207700_10091875 | |||
| 1117 | Ga0207700_10232259 | |||
| 1118 | Ga0207664_10011276 | |||
| 1119 | Ga0207664_10114864 | |||
| 1120 | Ga0207664_10138853 | |||
| 1121 | Ga0207644_10239124 | |||
| 1122 | Ga0207665_10104037 | |||
| 1123 | Ga0207691_10078331 | |||
| 1124 | Ga0207711_10014531 | |||
| 1125 | Ga0207711_10032837 | |||
| 1126 | Ga0207711_10050081 | |||
| 1127 | Ga0207711_10150749 | |||
| 1128 | Ga0207661_10218812 | |||
| 1129 | Ga0207661_10236552 | |||
| 1130 | Ga0207679_10016801 | |||
| 1131 | Ga0207667_10001916 | |||
| 1132 | Ga0207667_10004385 | |||
| 1133 | Ga0207651_10027598 | |||
| 1134 | Ga0207668_10094625 | |||
| 1135 | Ga0207640_10010117 | |||
| 1136 | Ga0207658_10128700 | |||
| 1137 | Ga0207677_10056750 | |||
| 1138 | Ga0207677_10070454 | |||
| 1139 | Ga0207703_10038574 | |||
| 1140 | Ga0207703_10049144 | |||
| 1141 | Ga0207639_10000605 | |||
| 1142 | Ga0207639_10520976 | |||
| 1143 | Ga0207678_10022979 | |||
| 1144 | Ga0207678_10249812 | |||
| 1145 | Ga0207708_10015907 | |||
| 1146 | Ga0207702_10001049 | |||
| 1147 | Ga0207702_10001070 | |||
| 1148 | Ga0207702_10076091 | |||
| 1149 | Ga0207702_10124682 | |||
| 1150 | Ga0207641_10058811 | |||
| 1151 | Ga0207676_10001466 | |||
| 1152 | Ga0207676_10126349 | |||
| 1153 | Ga0207683_10312502 | |||
| 1154 | Ga0207698_10000623 | |||
| 1155 | Ga0209281_1000032 | |||
| 1156 | Ga0209281_1000338 | |||
| 1157 | Ga0209389_1000103 | |||
| 1158 | Ga0209371_1000017 | |||
| 1159 | Ga0209371_1000577 | |||
| 1160 | Ga0209371_1001607 | |||
| 1161 | Ga0207428_10005919 | |||
| 1162 | Ga0207428_10026747 | |||
| 1163 | Ga0268266_10000021 | |||
| 1164 | Ga0268266_10034222 | |||
| 1165 | Ga0268266_10114872 | |||
| 1166 | Ga0268264_10081099 | |||
| 1167 | Ga0268264_10192436 | |||
| 1168 | Ga0265338_10018014 | |||
| 1169 | Ga0268256_1000036 | |||
| 1170 | Ga0268256_1000819 | |||
| 1171 | Ga0268256_1001390 | |||
| 1172 | Ga0265325_10043684 | |||
| 1173 | Ga0265339_10044702 | |||
| 1174 | Ga0265316_10132332 | |||
| 1175 | Ga0307509_10000004 | |||
| 1176 | Ga0307408_100095864 | |||
| 1177 | Ga0265313_10027776 | |||
| 1178 | Ga0307508_10080456 | |||
| 1179 | Ga0316575_10012714 | |||
| 1180 | Ga0265314_10010456 | |||
| 1181 | Ga0307412_10001266 | |||
| 1182 | Ga0307412_10044273 | |||
| 1183 | Ga0307412_10049883 | |||
| 1184 | Ga0307409_100100442 | |||
| 1185 | Ga0373959_0000450 | |||
| 1186 | Ga0316574_0005675 | |||
| 1187 | Ga0373935_0041032 | |||
| 1188 | Ga0373927_0038275 | |||
| 1189 | Ga0373937_0019256 | |||
| 1190 | Ga0395899_0035576 | |||
| 1191 | Ga0395900_0026896 | |||
| 1192 | Ga0395900_0191019 | |||
| 1193 | Ga0395905_0000769 | |||
| 1194 | Ga0395905_0169447 | |||
| 1195 | Ga0436364_0471524 | |||
| 1196 | Ga0436364_0613787 | |||
| 1197 | Ga0395901_0003843 | |||
| 1198 | Ga0395901_0085074 | |||
| 1199 | Ga0395901_0387040 | |||
| 1200 | Ga0395901_0430218 | |||
| 1201 | Ga0436365_0203066 | |||
| 1202 | Ga0436361_0462153 | |||
| 1203 | Ga0439438_016041 | |||
| 1204 | Ga0439447_000503 | |||
| 1205 | Ga0439447_007866 | |||
| 1206 | Ga0439466_0008252 | |||
| 1207 | Ga0439465_0019909 | |||
| 1208 | Ga0439463_000015 | |||
| 1209 | Ga0439464_0011013 | |||
| 1210 | Ga0466966_0021607 | |||
| 1211 | Ga0466963_0015844 | |||
| 1212 | Ga0453684_0000065 | |||
| 1213 | Ga0453684_0003037 | |||
| 1214 | Ga0453684_0123407 | |||
| 1215 | Ga0453684_0265918 | |||
| 1216 | Ga0453684_0297727 | |||
| 1217 | Ga0466968_0036004 | |||
| 1218 | Ga0466970_0058034 | |||
| 1219 | Ga0451576_0000325 | |||
| 1220 | Ga0451576_0004373 | |||
| 1221 | Ga0451576_0165107 | |||
| 1222 | Ga0451576_0507514 | |||
| 1223 | Ga0466958_0066902 | |||
| 1224 | Ga0466967_0007112 | |||
| 1225 | Ga0466967_0064875 | |||
| 1226 | Ga0495617_000166 | |||
| 1227 | Ga0495617_000972 | |||
| 1228 | Ga0495617_009939 | |||
| 1229 | Ga0495617_013456 | |||
| 1230 | Ga0495617_036485 | |||
| 1231 | Ga0495617_048588 | |||
| 1232 | Ga0495603_0000025 | |||
| 1233 | Ga0495590_0000306 | |||
| 1234 | Ga0495591_000002 | |||
| 1235 | Ga0495591_000049 | |||
| 1236 | Ga0495591_000076 | |||
| 1237 | Ga0495591_000545 | |||
| 1238 | Ga0495591_016191 | |||
| 1239 | Ga0495638_0000373 | |||
| 1240 | Ga0495638_0000477 | |||
| 1241 | Ga0495638_0001957 | |||
| 1242 | Ga0495638_0092687 | |||
| 1243 | Ga0495638_0179805 | |||
| 1244 | Ga0495653_0003212 | |||
| 1245 | Ga0495653_0006291 | |||
| 1246 | Ga0495653_0044424 | |||
| 1247 | Ga0495650_0000031 | |||
| 1248 | Ga0495650_0001378 | |||
| 1249 | Ga0495650_0004885 | |||
| 1250 | Ga0495650_0006455 | |||
| 1251 | Ga0495650_0006668 | |||
| 1252 | Ga0495580_0000005 | |||
| 1253 | Ga0495580_0004911 | |||
| 1254 | Ga0495580_0005902 | |||
| 1255 | Ga0495580_0014041 | |||
| 1256 | Ga0495605_0000517 | |||
| 1257 | Ga0495605_0001304 | |||
| 1258 | Ga0495605_0003775 | |||
| 1259 | Ga0495605_0014986 | |||
| 1260 | Ga0495605_0051067 | |||
| 1261 | Ga0495664_0012766 | |||
| 1262 | Ga0495584_0036972 | |||
| 1263 | Ga0495585_0002349 | |||
| 1264 | Ga0495585_0004774 | |||
| 1265 | Ga0495585_0021020 | |||
| 1266 | Ga0495585_0062695 | |||
| 1267 | Ga0495594_0062851 | |||
| 1268 | Ga0495596_0000087 | |||
| 1269 | Ga0495607_0003007 | |||
| 1270 | Ga0495607_0021248 | |||
| 1271 | Ga0495607_0078103 | |||
| 1272 | Ga0495607_0175416 | |||
| 1273 | Ga0495583_0000059 | |||
| 1274 | Ga0495583_0003963 | |||
| 1275 | Ga0495583_0010191 | |||
| 1276 | Ga0495583_0031047 | |||
| 1277 | Ga0495583_0066259 | |||
| 1278 | Ga0495606_0001321 | |||
| 1279 | Ga0495606_0117543 | |||
| 1280 | Ga0495606_0142562 | |||
| 1281 | Ga0495606_0191427 | |||
| 1282 | Ga0495608_0001348 | |||
| 1283 | Ga0495608_0065502 | |||
| 1284 | Ga0495610_0000848 | |||
| 1285 | Ga0495610_0001087 | |||
| 1286 | Ga0495610_0001982 | |||
| 1287 | Ga0495610_0022283 | |||
| 1288 | Ga0495616_0000165 | |||
| 1289 | Ga0495616_0023716 | |||
| 1290 | Ga0495620_0001627 | |||
| 1291 | Ga0495620_0004873 | |||
| 1292 | Ga0495620_0054395 | |||
| 1293 | Ga0495628_0001615 | |||
| 1294 | Ga0495628_0312991 | |||
| 1295 | Ga0495630_0055415 | |||
| 1296 | Ga0495630_0091075 | |||
| 1297 | Ga0495630_0163812 | |||
| 1298 | Ga0495630_0189494 | |||
| 1299 | Ga0495631_0000031 | |||
| 1300 | Ga0495631_0005399 | |||
| 1301 | Ga0495631_0007732 | |||
| 1302 | Ga0495632_0016673 | |||
| 1303 | Ga0495632_0028749 | |||
| 1304 | Ga0495632_0038410 | |||
| 1305 | Ga0495637_0000365 | |||
| 1306 | Ga0495637_0003162 | |||
| 1307 | Ga0495637_0021867 | |||
| 1308 | Ga0495643_0000284 | |||
| 1309 | Ga0495643_0093138 | |||
| 1310 | Ga0495648_0001897 | |||
| 1311 | Ga0495648_0004024 | |||
| 1312 | Ga0495648_0026190 | |||
| 1313 | Ga0495648_0049774 | |||
| 1314 | Ga0495648_0148890 | |||
| 1315 | Ga0495663_0067576 | |||
| 1316 | Ga0495666_0009884 | |||
| 1317 | Ga0495652_0000812 | |||
| 1318 | Ga0495652_0048359 | |||
| 1319 | Ga0495652_0144169 | |||
| 1320 | Ga0495654_0000069 | |||
| 1321 | Ga0495654_0000079 | |||
| 1322 | Ga0495654_0005114 | |||
| 1323 | Ga0495654_0021836 | |||
| 1324 | Ga0495654_0054102 | |||
| 1325 | Ga0495654_0105631 | |||
| 1326 | Ga0495665_0020274 | |||
| 1327 | Ga0495640_0114021 | |||
| 1328 | Ga0495587_0001718 | |||
| 1329 | Ga0495621_0001317 | |||
| 1330 | Ga0495597_0001260 | |||
| 1331 | Ga0495597_0062640 | |||
| 1332 | Ga0495645_0016029 | |||
| 1333 | Ga0495622_0000011 | |||
| 1334 | Ga0495622_0001980 | |||
| 1335 | Ga0495633_0011667 | |||
| 1336 | Ga0495633_0076960 | |||
| 1337 | Ga0495633_0078976 | |||
| 1338 | Ga0495633_0143891 | |||
| 1339 | Ga0495667_0000215 | |||
| 1340 | Ga0495656_0015779 | |||
| 1341 | Ga0495668_0002790 | |||
| 1342 | Ga0495668_0007922 | |||
| 1343 | Ga0495668_0025823 | |||
| 1344 | Ga0495668_0065237 | |||
| 1345 | Ga0495634_0000347 | |||
| 1346 | Ga0495611_0001754 | |||
| 1347 | Ga0495611_0006671 | |||
| 1348 | Ga0495611_0054525 | |||
| 1349 | Ga0495625_0001743 | |||
| 1350 | Ga0495625_0003377 | |||
| 1351 | Ga0495625_0005641 | |||
| 1352 | Ga0495625_0005925 | |||
| 1353 | Ga0495625_0015936 | |||
| 1354 | Ga0495625_0245233 | |||
| 1355 | Ga0495635_0046015 | |||
| 1356 | Ga0495661_0000861 | |||
| 1357 | Ga0495588_0001410 | |||
| 1358 | Ga0495657_0006599 | |||
| 1359 | Ga0495599_0078903 | |||
| 1360 | Ga0495623_0002958 | |||
| 1361 | Ga0495623_0011387 | |||
| 1362 | Ga0495646_0023944 | |||
| 1363 | Ga0495646_0046615 | |||
| 1364 | Ga0495613_0102040 | |||
| 1365 | Ga0495624_0016322 | |||
| 1366 | Ga0495624_0028114 | |||
| 1367 | Ga0495670_0004284 | |||
| 1368 | Ga0495670_0004799 | |||
| 1369 | Ga0495671_0000446 | |||
| 1370 | Ga0495671_0002224 | |||
| 1371 | Ga0495671_0074469 | |||
| 1372 | Ga0495649_0000245 | |||
| 1373 | Ga0495649_0006297 | |||
| 1374 | Ga0495649_0008701 | |||
| 1375 | Ga0495649_0019004 | |||
| 1376 | Ga0495649_0021669 | |||
| 1377 | Ga0495649_0025203 | |||
| 1378 | Ga0495649_0188377 | |||
| 1379 | Ga0495589_0011590 | |||
| 1380 | Ga0495589_0024759 | |||
| 1381 | Ga0495589_0046180 | |||
| 1382 | Ga0495600_0029338 | |||
| 1383 | Ga0495660_0000016 | |||
| 1384 | Ga0495660_0000153 | |||
| 1385 | Ga0495660_0000302 | |||
| 1386 | Ga0495660_0002788 | |||
| 1387 | Ga0495660_0020164 | |||
| 1388 | Ga0495660_0022024 | |||
| 1389 | Ga0495660_0053672 | |||
| 1390 | Ga0495660_0095053 | |||
| 1391 | Ga0495604_0019379 | |||
| 1392 | Ga0495604_0022082 | |||
| 1393 | Ga0495604_0057310 | |||
| 1394 | Ga0495674_0000271 | |||
| 1395 | Ga0495674_0008422 | |||
| 1396 | Ga0495674_0017477 | |||
| 1397 | Ga0495674_0048003 | |||
| 1398 | Ga0495672_0000001 | |||
| 1399 | Ga0495672_0000037 | |||
| 1400 | Ga0495672_0000062 | |||
| 1401 | Ga0495672_0002052 | |||
| 1402 | Ga0495680_0002950 | |||
| 1403 | Ga0495680_0029851 | |||
| 1404 | Ga0495683_0002439 | |||
| 1405 | Ga0495687_013230 | |||
| 1406 | Ga0495687_027145 | |||
| 1407 | Ga0495675_0000354 | |||
| 1408 | Ga0495675_0046475 | |||
| 1409 | Ga0495679_000590 | |||
| 1410 | Ga0495679_017874 | |||
| 1411 | Ga0495679_022488 | |||
| 1412 | Ga0495673_0000191 | |||
| 1413 | Ga0495673_0000358 | |||
| 1414 | Ga0495673_0000753 | |||
| 1415 | Ga0495681_0000527 | |||
| 1416 | Ga0495681_0006810 | |||
| 1417 | Ga0495681_0009252 | |||
| 1418 | Ga0495681_0017092 | |||
| 1419 | Ga0495684_0002068 | |||
| 1420 | Ga0495684_0020764 | |||
| 1421 | Ga0495686_0000047 | |||
| 1422 | Ga0495686_0002819 | |||
| 1423 | Ga0495593_0013628 | |||
| 1424 | Ga0495602_0059737 | |||
| 1425 | Ga0495626_0000057 | |||
| 1426 | Ga0495626_0000374 | |||
| 1427 | Ga0495626_0005649 | |||
| 1428 | Ga0496100_0024105 | |||
| 1429 | Ga0496100_0065169 | |||
| 1430 | Ga0496101_0008350 | |||
| 1431 | Ga0496101_0022200 | |||
| 1432 | Ga0496101_0051243 | |||
| 1433 | Ga0496101_0089574 | |||
| 1434 | Ga0496102_0000444 | |||
| 1435 | Ga0496102_0005013 | |||
| 1436 | Ga0496102_0059670 | |||
| 1437 | Ga0496102_0119593 | |||
| 1438 | Ga0496102_0281788 | |||
| 1439 | Ga0496102_0331593 | |||
| 1440 | Ga0496103_0000290 | |||
| 1441 | Ga0496103_0046510 | |||
| 1442 | Ga0496104_0006840 | |||
| 1443 | Ga0496104_0202072 | |||
| 1444 | Ga0496105_0049651 | |||
| 1445 | Ga0496105_0179163 | |||
| 1446 | Ga0496105_0252066 | |||
| 1447 | Ga0496106_0090721 | |||
| 1448 | Ga0496107_0011893 | |||
| 1449 | Ga0496107_0028942 | |||
| 1450 | Ga0496107_0162996 | |||
| 1451 | Ga0496108_0069625 | |||
| 1452 | Ga0496108_0349892 | |||
| 1453 | Ga0496109_0010551 | |||
| 1454 | Ga0496109_0422889 | |||
| 1455 | Ga0496110_0010902 | |||
| 1456 | Ga0496110_0016914 | |||
| 1457 | Ga0496110_0153019 | |||
| 1458 | Ga0496114_0021179 | |||
| 1459 | Ga0496114_0095352 | |||
| 1460 | Ga0496114_0132976 | |||
| 1461 | Ga0496114_0161162 | |||
| 1462 | Ga0496115_0001021 | |||
| 1463 | Ga0496115_0015041 | |||
| 1464 | Ga0496115_0109155 | |||
| 1465 | Ga0496116_0000394 | |||
| 1466 | Ga0496116_0015807 | |||
| 1467 | Ga0496116_0035428 | |||
| 1468 | Ga0496116_0055403 | |||
| 1469 | Ga0496117_0001290 | |||
| 1470 | Ga0496117_0002386 | |||
| 1471 | Ga0496117_0008509 | |||
| 1472 | Ga0496117_0032627 | |||
| 1473 | Ga0496117_0062710 | |||
| 1474 | Ga0496118_0000048 | |||
| 1475 | Ga0496118_0000491 | |||
| 1476 | Ga0496118_0005120 | |||
| 1477 | Ga0496118_0039071 | |||
| 1478 | Ga0496118_0082682 | |||
| 1479 | Ga0496119_0005301 | |||
| 1480 | Ga0496120_0085256 | |||
| 1481 | Ga0496121_0000055 | |||
| 1482 | Ga0496121_0001253 | |||
| 1483 | Ga0496121_0008653 | |||
| 1484 | Ga0496122_0000810 | |||
| 1485 | Ga0496123_0001426 | |||
| 1486 | Ga0496124_0000390 | |||
| 1487 | Ga0496124_0000445 | |||
| 1488 | Ga0496124_0000634 | |||
| 1489 | Ga0496124_0005976 | |||
| 1490 | Ga0496124_0006685 | |||
| 1491 | Ga0496124_0009020 | |||
| 1492 | Ga0496124_0010485 | |||
| 1493 | Ga0496124_0023815 | |||
| 1494 | Ga0496125_0000232 | |||
| 1495 | Ga0496125_0005805 | |||
| 1496 | Ga0496125_0009714 | |||
| 1497 | Ga0496125_0011442 | |||
| 1498 | Ga0496125_0101591 | |||
| 1499 | Ga0496126_0069447 | |||
| 1500 | Ga0496126_0073802 | |||
| 1501 | Ga0496126_0120620 | |||
| 1502 | Ga0496126_0161928 | |||
| 1503 | Ga0496126_0299154 | |||
| 1504 | Ga0495678_000091 | |||
| 1505 | Ga0495678_002781 | |||
| 1506 | Ga0495678_027486 | |||
| 1507 | Ga0495682_0000001 | |||
| 1508 | Ga0495682_0000152 | |||
| 1509 | Ga0495682_0000232 | |||
| 1510 | Ga0495682_0004828 | |||
| 1511 | Ga0495682_0007557 | |||
| 1512 | Ga0495682_0023301 | |||
| 1513 | Ga0495682_0051776 | |||
| 1514 | Ga0501034_0101163 | |||
| 1515 | Ga0501037_0176986 | |||
| 1516 | Ga0501046_0350519 | |||
| 1517 | Ga0501047_0228330 | |||
| 1518 | Ga0501070_0040644 | |||
| 1519 | Ga0501070_0166386 | |||
| 1520 | Ga0501249_000065 | |||
| 1521 | Ga0501080_0033932 | |||
| 1522 | Ga0501080_0313469 | |||
| 1523 | Ga0501083_0105627 | |||
| 1524 | Ga0501044_0160648 | |||
| 1525 | Ga0501204_003614 | |||
| 1526 | nmdc:mga00v17_4678_c1 | |||
| 1527 | nmdc:mga05p37_3097_c1 | |||
| 1528 | nmdc:mga05p37_4683_c1 | |||
| 1529 | nmdc:mga09592_14038_c1 | |||
| 1530 | nmdc:mga0n895_104802_c1 | |||
| 1531 | nmdc:mga0n895_352619_c1 | |||
| 1532 | nmdc:mga0rr50_38934_c1 | |||
| 1533 | nmdc:mga08x19_17316_c1 | |||
| 1534 | nmdc:mga08x19_25250_c1 | |||
| 1535 | nmdc:mga08x19_34963_c1 | |||
| 1536 | Ga0495601_0076363 | |||
| 1537 | Ga0500610_0075796 | |||
| 1538 | Ga0495619_0036206 | |||
| 1539 | Ga0500578_0131726 | |||
| 1540 | Ga0500643_000024 | |||
| 1541 | Ga0500644_0000126 | |||
| 1542 | Ga0500555_020364 | |||
| 1543 | Ga0500569_016973 | |||
| 1544 | Ga0500594_0000563 | |||
| 1545 | Ga0500594_0000661 | |||
| 1546 | Ga0500594_0003332 | |||
| 1547 | Ga0500618_000116 | |||
| 1548 | Ga0500618_000269 | |||
| 1549 | Ga0500618_000344 | |||
| 1550 | Ga0500621_000002 | |||
| 1551 | Ga0500658_0046104 | |||
| 1552 | Ga0500659_0004513 | |||
| 1553 | Ga0500559_0061927 | |||
| 1554 | Ga0500568_0000168 | |||
| 1555 | Ga0500568_0053025 | |||
| 1556 | Ga0500616_0001366 | |||
| 1557 | Ga0500634_0000185 | |||
| 1558 | Ga0500636_0001796 | |||
| 1559 | Ga0500636_0028376 | |||
| 1560 | Ga0500609_000501 | |||
| 1561 | Ga0500661_003130 | |||
| 1562 | 2969082261 | |||
| 1563 | 2511131630 | |||
| 1564 | 2511195577 | |||
| 1565 | 2511257805 | |||
| 1566 | 2511371659 | |||
| 1567 | 2511433105 | |||
| 1568 | 2511437259 | |||
| 1569 | 2511825122 | |||
| 1570 | 2513868976 | |||
| 1571 | 2524452122 | |||
| 1572 | 2585275104 | |||
| 1573 | 2585553970 | |||
| 1574 | 2585555122 | |||
| 1575 | 2585561182 | |||
| 1576 | 2585563712 | |||
| 1577 | 2585848029 | |||
| 1578 | 2585900045 | |||
| 1579 | 2585908224 | |||
| 1580 | 2587983741 | |||
| 1581 | 2599409392 | |||
| 1582 | 2601643728 | |||
| 1583 | 2601663552 | |||
| 1584 | 2601696567 | |||
| 1585 | 2601701184 | |||
| 1586 | 2601721591 | |||
| 1587 | 2601739932 | |||
| 1588 | 2601750421 | |||
| 1589 | 2602017674 | |||
| 1590 | 2603660938 | |||
| 1591 | 2603666212 | |||
| 1592 | 2603697914 | |||
| 1593 | 2603877025 | |||
| 1594 | 2606070645 | |||
| 1595 | 2637225288 | |||
| 1596 | 2644003296 | |||
| 1597 | 2644089906 | |||
| 1598 | 2644319751 | |||
| 1599 | 2644498200 | |||
| 1600 | 2676406537 | |||
| 1601 | 2739793002 | |||
| 1602 | 2807176779 | |||
| 1603 | 2819683018 | |||
| 1604 | 2842875173 | |||
| 1605 | 2842925267 | |||
| 1606 | 2844529751 | |||
| 1607 | 2852108096 | |||
| 1608 | 2855387097 | |||
| 1609 | 2857567803 | |||
| 1610 | 2857743625 | |||
| 1611 | 2865014704 | |||
| 1612 | 2888374792 | |||
| 1613 | 2889421354 | |||
| 1614 | 2904500801 | |||
| 1615 | 2904508657 | |||
| 1616 | 2908673891 | |||
| 1617 | 2910812536 | |||
| 1618 | 2919461241 | |||
| 1619 | 2939573338 | |||
| 1620 | 2939675912 | |||
| 1621 | 3007614439 | |||
| 1622 | 643603760 | |||
| 1623 | 8018179758 | |||
| 1624 | 8018222226 | |||
| 1625 | 8055090080 | |||
| 1626 | 8055093110 | |||
| 1627 | 8055695740 | |||
| 1628 | 8056182471 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9395 | 1 | 306 |
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9312 | 1 | 309 |
| 1pz1-assembly2.cif.gz_B | structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) | 0.9075 | 1 | 318 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.907 | 1 | 306 |
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9069 | 3 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09923_6_337_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9486 | 4 | 326 | 3.20.20.100 |
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9475 | 1 | 319 | 3.20.20.100 |
| af_A0A1D6KUU8_358_629_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9435 | 73 | 327 | 3.20.20.100 |
| af_A0A0R0ETH2_7_234_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9409 | 1 | 223 | 3.20.20.100 |
| 3v0uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9395 | 1 | 306 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328TDJ7-F1-model_v4 | Aldo/keto reductase family protein | 1.002 | 121 | 204 |
GO:0004033
GO:0005737 |
| AF-A0A2V9HFB4-F1-model_v4 | Aldo/keto reductase | 0.9891 | 1 | 324 |
GO:0004033
GO:0005737 |
| AF-A0A3B9ANH9-F1-model_v4 | Aldo/keto reductase | 0.9888 | 77 | 317 |
GO:0004033
GO:0005737 |
| AF-A0A2V5YE55-F1-model_v4 | Aldo/keto reductase | 0.9871 | 1 | 327 |
GO:0004033
GO:0005737 |
| AF-A0A7X1W0Z7-F1-model_v4 | deleted | 0.9855 | 1 | 327 |
|