F482005

General Info

Members Datasets Scaffolds Average Seq Length
815 426 1630 390

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000001|JGI25162J39368_1000001641
Length 412
Sequence MRNPETKTDSKQMNRDLRIPDRAASADPRPTPLQSRLPKVGTTIFTVMSTLASEKSAVNLGQGFPDFDCDPALVDAVSGAMKNGFNQYPPMPGVXXXRQAIAAKIKNVYGHSYDPATEITVTAGATQGILTAIMCAVHPGDEVIVIEPAYDSYVPSIELAGGKPVLVQMTLGADGYQVPWDRIAAAVSPRTRMIMVNSPHNPTGSVLKPADIAALKDIVRGTEILILSDEVYEHMVFDGARHESVCRDPELAARAFVVSSFGKTYHVTGWKIGYVAAPAMLSAEFRKVHQYNIFTVNTPVQHGIAQYMQNPAPYLELPAFYQRKRDLFRDGLKHTRFKLLPADGTYFLCVDYSAISSLSEADFAIWLTSEVGVAAIPVSAFYQSPRESGIVRFCFAKQDQTLQQALQRLAKI

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
157 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
167 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
168 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
169 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
290 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
303 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
304 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
305 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
310 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
311 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
315 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
316 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
317 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
318 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
319 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
320 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
321 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
322 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
323 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
324 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
325 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
326 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
327 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
328 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
329 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
330 2519103095 Burkholderia sp. KJ006 Isolate Nodule
331 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
332 2547132374 Acidovorax radicis N35 Isolate Unclassified
333 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
334 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
335 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
336 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
337 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
338 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
339 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
340 2643221570 Acidovorax sp. Root568 Isolate Unclassified
341 2643221638 Duganella sp. Root336D2 Isolate Unclassified
342 2643221652 Acidovorax sp. Root402 Isolate Unclassified
343 2643221664 Massilia sp. Root418 Isolate Unclassified
344 2643221717 Acidovorax sp. Root267 Isolate Unclassified
345 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
346 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
347 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
348 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
349 2738541280 Massilia sp. GV090 Isolate Unclassified
350 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
351 2738541297 Duganella sp. GV083 Isolate Unclassified
352 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
353 2738541300 Massilia sp. GV016 Isolate Unclassified
354 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
355 2738541357 Duganella sp. GV053 Isolate Unclassified
356 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
357 2738543003 Duganella sp. GV066 Isolate Unclassified
358 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
359 2738543018 Massilia sp. GV045 Isolate Unclassified
360 2738543026 Duganella sp. GV089 Isolate Unclassified
361 2738543029 Duganella sp. GV039 Isolate Unclassified
362 2738543030 Massilia sp. GV097 Isolate Unclassified
363 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
364 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
365 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
366 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
367 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
368 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
369 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
370 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
371 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
372 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
373 2818991436 Collimonas arenae 515 Isolate Unclassified
374 2818991450 Burkholderia sp. 604 Isolate Unclassified
375 2818991452 Burkholderia cepacia 561 Isolate Unclassified
376 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
377 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
378 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
379 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
380 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
381 2857558681 Duganella sp. R-74565 Isolate Unclassified
382 2857564685 Duganella sp. R-74599 Isolate Unclassified
383 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
384 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
385 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
386 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
387 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
388 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
389 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
390 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
391 2904424332 Duganella sp. 1411 Isolate Rhizosphere
392 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
393 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
394 2904564687 Burkholderia sp. 571 Isolate Unclassified
395 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
396 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
397 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
398 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
399 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
400 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
401 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
402 2928163908 Burkholderia sp. 567 Isolate Unclassified
403 2928170801 Burkholderia sp. 572 Isolate Unclassified
404 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
405 2928536128 Burkholderia sola 565 Isolate Unclassified
406 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
407 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
408 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
409 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
410 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
411 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
412 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
413 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
414 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
415 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
416 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
417 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
418 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
419 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
420 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
421 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
422 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
423 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
424 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
425 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
426 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.01
Metatranscriptomes 0.12
Isolates 13.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.71
Nodule 2.45
Rhizoplane 4.05
Rhizosphere 63.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000001 3300002737 Bacteria 740113
2 JGI24740J21852_10008374 3300001979 Bacteria 4122
3 JGI24739J22299_10002136 3300001989 Bacteria 7577
4 JGI24739J22299_10019359 3300001989 Bacteria 2436
5 JGI24735J21928_10000244 3300002067 Bacteria 19138
6 JGI24735J21928_10001284 3300002067 Bacteria 8912
7 JGI24735J21928_10016996 3300002067 Bacteria 2252
8 JGI25156J39149_1000669 3300002705 Bacteria 18535
9 JGI25154J39366_1000678 3300002738 Bacteria 15760
10 JGI25152J39213_1000005 3300002773 Bacteria 160019
11 JGI25150J39212_1000071 3300002774 Bacteria 61665
12 JGI25159J45721_1001569 3300002987 Bacteria 9357
13 JGI25159J45721_1007241 3300002987 Bacteria 3203
14 JGI25151J46595_10051495 3300003187 Bacteria 1393
15 JGI25165J46597_1000001 3300003214 Bacteria 1111887
16 JGI25165J46597_1001219 3300003214 Bacteria 15399
17 JGI25153J46596_10005435 3300003215 Bacteria 6687
18 rootL2_10007264 3300003322 Bacteria 2374
19 rootL2_10008705 3300003322 Bacteria 11118
20 rootL2_10026973 3300003322 Bacteria 15088
21 rootL2_10028055 3300003322 Bacteria 2201
22 rootL2_10050715 3300003322 Bacteria 8120
23 rootL2_10053525 3300003322 Bacteria 1970
24 JGI25160J50197_1000870 3300003354 Bacteria 15998
25 JGI25160J50197_1007831 3300003354 Bacteria 4134
26 JGI25161J50226_1000581 3300003374 Bacteria 15474
27 JGI25161J50226_1002931 3300003374 Bacteria 4141
28 Ga0055538_1000001 3300003751 Bacteria 1111887
29 Ga0055539_1000001 3300003752 Bacteria 1111887
30 Ga0055533_1000003 3300003756 Bacteria 1111887
31 Ga0055533_1000271 3300003756 Bacteria 28380
32 Ga0055533_1001132 3300003756 Bacteria 7560
33 Ga0055532_1000063 3300003758 Bacteria 147140
34 Ga0055532_1000635 3300003758 Bacteria 13624
35 Ga0055532_1001446 3300003758 Bacteria 6603
36 Ga0055532_1001456 3300003758 Bacteria 6577
37 Ga0055525_1000003 3300003759 Bacteria 962094
38 Ga0055527_1000049 3300003760 Bacteria 105168
39 Ga0055527_1000477 3300003760 Bacteria 14946
40 Ga0055527_1002732 3300003760 Bacteria 2861
41 Ga0055535_1000042 3300003761 Bacteria 147140
42 Ga0055535_1001183 3300003761 Bacteria 15072
43 Ga0055535_1001193 3300003761 Bacteria 14946
44 Ga0055542_1000071 3300003762 Bacteria 147140
45 Ga0055542_1001169 3300003762 Bacteria 15120
46 Ga0055529_1000081 3300003763 Bacteria 147140
47 Ga0055529_1000128 3300003763 Bacteria 108143
48 Ga0055529_1000780 3300003763 Bacteria 19809
49 Ga0055526_1000013 3300003771 Bacteria 233580
50 Ga0055526_1001685 3300003771 Bacteria 15474
51 Ga0055537_1005497 3300003773 Bacteria 3387
52 Ga0055524_1000224 3300003775 Bacteria 60133
53 Ga0055524_1001696 3300003775 Bacteria 12278
54 Ga0055524_1005207 3300003775 Bacteria 5848
55 Ga0055534_1001332 3300003784 Bacteria 9919
56 Ga0055528_1001644 3300003790 Bacteria 13157
57 Ga0055528_1006195 3300003790 Bacteria 5450
58 Ga0055530_10000552 3300003791 Bacteria 32453
59 Ga0055530_10003433 3300003791 Bacteria 9008
60 Ga0055531_10002900 3300003794 Bacteria 11166
61 Ga0055531_10021167 3300003794 Bacteria 2536
62 Ga0055541_1000001 3300003841 Bacteria 1111887
63 Ga0058692_1003994 3300003856 Bacteria 4445
64 Ga0055543_1001685 3300004625 Bacteria 8364
65 Ga0065165_1000559 3300005262 Bacteria 55415
66 Ga0065165_1002395 3300005262 Bacteria 16030
67 Ga0070658_10012862 3300005327 Bacteria 6718
68 Ga0070658_10022666 3300005327 Bacteria 5039
69 Ga0070658_10037577 3300005327 Bacteria 3904
70 Ga0070658_10101236 3300005327 Bacteria 2382
71 Ga0070683_100003543 3300005329 Bacteria 12705
72 Ga0070670_100000714 3300005331 Bacteria 25798
73 Ga0070677_10004146 3300005333 Bacteria 4711
74 Ga0068868_100012422 3300005338 Bacteria 6225
75 Ga0070660_100001483 3300005339 Bacteria 16064
76 Ga0070660_100002336 3300005339 Bacteria 13027
77 Ga0070660_100002371 3300005339 Bacteria 12942
78 Ga0070660_100157255 3300005339 Bacteria 1830
79 Ga0070661_100008886 3300005344 Bacteria 6954
80 Ga0070661_100015613 3300005344 Bacteria 5361
81 Ga0070661_100080763 3300005344 Bacteria 2400
82 Ga0070675_100000465 3300005354 Bacteria 27680
83 Ga0070671_100001721 3300005355 Bacteria 16617
84 Ga0070674_100057027 3300005356 Bacteria 2710
85 Ga0070673_100003268 3300005364 Bacteria 10059
86 Ga0070659_100000069 3300005366 Bacteria 81078
87 Ga0070667_100064290 3300005367 Bacteria 3113
88 Ga0070663_100000696 3300005455 Bacteria 18105
89 Ga0070663_100002505 3300005455 Bacteria 10360
90 Ga0070663_100120149 3300005455 Bacteria 1984
91 Ga0068867_100011101 3300005459 Bacteria 6354
92 Ga0070684_100012350 3300005535 Bacteria 6842
93 Ga0070672_100000119 3300005543 Bacteria 40242
94 Ga0068855_100004770 3300005563 Bacteria 16555
95 Ga0068855_100036153 3300005563 Bacteria 5880
96 Ga0070664_100002152 3300005564 Bacteria 15794
97 Ga0070664_100028976 3300005564 Bacteria 4612
98 Ga0068857_100287263 3300005577 Bacteria 1514
99 Ga0068854_100002231 3300005578 Bacteria 11923
100 Ga0068852_100005925 3300005616 Bacteria 8788
101 Ga0068852_100027502 3300005616 Bacteria 4636
102 Ga0068866_10017030 3300005718 Bacteria 3262
103 Ga0068851_10011665 3300005834 Bacteria 4124
104 Ga0068863_100063738 3300005841 Bacteria 3486
105 Ga0097621_100007013 3300006237 Bacteria 8025
106 Ga0068871_100011374 3300006358 Bacteria 6525
107 Ga0105251_10000250 3300009011 Bacteria 54231
108 Ga0105251_10001135 3300009011 Bacteria 23157
109 Ga0105244_10011494 3300009036 Bacteria 5301
110 Ga0105240_10008362 3300009093 Bacteria 14811
111 Ga0105240_10012664 3300009093 Bacteria 11626
112 Ga0105240_10046886 3300009093 Bacteria 5472
113 Ga0105240_10126548 3300009093 Bacteria 3070
114 Ga0105243_10010354 3300009148 Bacteria 7082
115 Ga0105248_10013799 3300009177 Bacteria 8890
116 Ga0105248_10097666 3300009177 Bacteria 3309
117 Ga0105237_10028648 3300009545 Bacteria 5670
118 Ga0105237_10033084 3300009545 Bacteria 5237
119 Ga0105238_10001371 3300009551 Bacteria 24426
120 Ga0105238_10041926 3300009551 Bacteria 4636
121 Ga0105238_10136887 3300009551 Bacteria 2427
122 Ga0105239_10005995 3300010375 Bacteria 14143
123 Ga0105239_10037464 3300010375 Bacteria 5315
124 Ga0105239_10088612 3300010375 Bacteria 3412
125 Ga0157373_10024520 3300013100 Bacteria 4368
126 Ga0157370_10011220 3300013104 Bacteria 9395
127 Ga0157370_10060740 3300013104 Bacteria 3587
128 Ga0157370_10141112 3300013104 Bacteria 2245
129 Ga0157369_10002854 3300013105 Bacteria 20639
130 Ga0157369_10003118 3300013105 Bacteria 19808
131 Ga0157369_10006997 3300013105 Bacteria 13013
132 Ga0157369_10010440 3300013105 Bacteria 10580
133 Ga0157369_10013968 3300013105 Bacteria 9075
134 Ga0157374_10000428 3300013296 Bacteria 38117
135 Ga0157374_10024145 3300013296 Bacteria 5447
136 Ga0157374_10293354 3300013296 Bacteria 1608
137 Ga0157372_10016699 3300013307 Bacteria 7879
138 Ga0157372_10345429 3300013307 Bacteria 1734
139 Ga0157375_10000644 3300013308 Bacteria 30997
140 Ga0157375_10354230 3300013308 Bacteria 1634
141 Ga0182008_10017166 3300014497 Bacteria 3756
142 Ga0157377_10000055 3300014745 Bacteria 88103
143 Ga0157376_10006100 3300014969 Bacteria 8480
144 Ga0182006_1012234 3300015261 Bacteria 3756
145 Ga0182007_10000032 3300015262 Bacteria 145577
146 Ga0182007_10000557 3300015262 Bacteria 22035
147 Ga0182007_10006335 3300015262 Bacteria 5088
148 Ga0182005_1000996 3300015265 Bacteria 12201
149 Ga0183361_10010 3300016635 Bacteria 204902
150 Ga0163161_10000153 3300017792 Bacteria 63614
151 Ga0213872_10000019 3300021361 Bacteria 172803
152 Ga0224712_10000046 3300022467 Bacteria 19115
153 Ga0209760_102499 3300025207 Bacteria 1714
154 Ga0209436_100358 3300025208 Bacteria 20628
155 Ga0209436_101573 3300025208 Bacteria 7715
156 Ga0209784_100004 3300025224 Bacteria 1378156
157 Ga0209566_100004 3300025225 Bacteria 1531866
158 Ga0209674_100006 3300025226 Bacteria 1531866
159 Ga0209674_100294 3300025226 Bacteria 35436
160 Ga0209674_100316 3300025226 Bacteria 31254
161 Ga0209672_100010 3300025228 Bacteria 873151
162 Ga0209672_100033 3300025228 Bacteria 315326
163 Ga0209672_100114 3300025228 Bacteria 90538
164 Ga0209672_100867 3300025228 Bacteria 13860
165 Ga0209147_100006 3300025229 Bacteria 873276
166 Ga0209147_100161 3300025229 Bacteria 90627
167 Ga0209147_100390 3300025229 Bacteria 30099
168 Ga0209147_100971 3300025229 Bacteria 12546
169 Ga0209563_100009 3300025230 Bacteria 1378156
170 Ga0209563_100715 3300025230 Bacteria 10353
171 Ga0207427_100293 3300025231 Bacteria 35384
172 Ga0207427_101889 3300025231 Bacteria 6567
173 Ga0209437_100004 3300025233 Bacteria 1378156
174 Ga0209258_100010 3300025242 Bacteria 873276
175 Ga0209258_100100 3300025242 Bacteria 214027
176 Ga0209258_100263 3300025242 Bacteria 90453
177 Ga0207425_1000001 3300025245 Bacteria 2525432
178 Ga0207425_1000056 3300025245 Bacteria 151802
179 Ga0207425_1000178 3300025245 Bacteria 52247
180 Ga0209646_1000007 3300025246 Bacteria 670994
181 Ga0209677_100005 3300025253 Bacteria 1378156
182 Ga0209148_1000018 3300025254 Bacteria 756247
183 Ga0209148_1000432 3300025254 Bacteria 46257
184 Ga0209148_1001019 3300025254 Bacteria 17617
185 Ga0209759_1000402 3300025256 Bacteria 53409
186 Ga0209759_1000403 3300025256 Bacteria 53279
187 Ga0209759_1000749 3300025256 Bacteria 28201
188 Ga0209759_1015281 3300025256 Bacteria 1987
189 Ga0209129_1000003 3300025258 Bacteria 903689
190 Ga0209129_1004265 3300025258 Bacteria 5715
191 Ga0209233_1000005 3300025261 Bacteria 1531866
192 Ga0209233_1000171 3300025261 Bacteria 146605
193 Ga0209565_1000900 3300025263 Bacteria 16075
194 Ga0209565_1001280 3300025263 Bacteria 11665
195 Ga0209565_1001370 3300025263 Bacteria 10960
196 Ga0209455_1000015 3300025272 Bacteria 756128
197 Ga0209455_1000026 3300025272 Bacteria 653778
198 Ga0209455_1000192 3300025272 Bacteria 90553
199 Ga0209673_1000332 3300025273 Bacteria 86973
200 Ga0209130_1002057 3300025284 Bacteria 10892
201 Ga0209130_1002724 3300025284 Bacteria 8375
202 Ga0209130_1008718 3300025284 Bacteria 2966
203 Ga0209130_1008763 3300025284 Bacteria 2953
204 Ga0209675_1003751 3300025291 Bacteria 7037
205 Ga0209675_1020010 3300025291 Bacteria 1826
206 Ga0209025_1004504 3300025294 Bacteria 12046
207 Ga0209564_1000002 3300025295 Bacteria 1636803
208 Ga0209564_1000272 3300025295 Bacteria 108384
209 Ga0209564_1002232 3300025295 Bacteria 15972
210 Ga0209564_1002542 3300025295 Bacteria 14060
211 Ga0209564_1003866 3300025295 Bacteria 9642
212 Ga0209564_1007040 3300025295 Bacteria 5893
213 Ga0209758_1000041 3300025297 Bacteria 410328
214 Ga0209758_1003222 3300025297 Bacteria 15199
215 Ga0209050_1000011 3300025298 Bacteria 914037
216 Ga0209050_1000089 3300025298 Bacteria 256212
217 Ga0209050_1000392 3300025298 Bacteria 82085
218 Ga0209050_1000470 3300025298 Bacteria 71502
219 Ga0209256_1000068 3300025299 Bacteria 246064
220 Ga0209256_1001080 3300025299 Bacteria 31504
221 Ga0209256_1005590 3300025299 Bacteria 7147
222 Ga0209256_1006044 3300025299 Bacteria 6611
223 Ga0207426_1000590 3300025302 Bacteria 47972
224 Ga0207426_1001589 3300025302 Bacteria 18204
225 Ga0207426_1006052 3300025302 Bacteria 5344
226 Ga0209257_1000003 3300025304 Bacteria 1702593
227 Ga0209257_1009608 3300025304 Bacteria 5129
228 Ga0207713_1000295 3300025735 Bacteria 57436
229 Ga0207713_1004921 3300025735 Bacteria 8536
230 Ga0207682_10006551 3300025893 Bacteria 4686
231 Ga0207642_10027835 3300025899 Bacteria 2319
232 Ga0207647_10000873 3300025904 Bacteria 23357
233 Ga0207647_10007060 3300025904 Bacteria 8144
234 Ga0207647_10023624 3300025904 Bacteria 4064
235 Ga0207647_10032109 3300025904 Bacteria 3376
236 Ga0207645_10041081 3300025907 Bacteria 2962
237 Ga0207705_10006147 3300025909 Bacteria 8934
238 Ga0207705_10022872 3300025909 Bacteria 4456
239 Ga0207705_10030495 3300025909 Bacteria 3848
240 Ga0207695_10006076 3300025913 Bacteria 15757
241 Ga0207695_10010079 3300025913 Bacteria 11603
242 Ga0207695_10020742 3300025913 Bacteria 7518
243 Ga0207695_10022418 3300025913 Bacteria 7168
244 Ga0207695_10279683 3300025913 Bacteria 1563
245 Ga0207657_10000068 3300025919 Bacteria 96575
246 Ga0207657_10002652 3300025919 Bacteria 19312
247 Ga0207649_10005421 3300025920 Bacteria 6905
248 Ga0207649_10017509 3300025920 Bacteria 4061
249 Ga0207649_10093231 3300025920 Bacteria 1976
250 Ga0207694_10001679 3300025924 Bacteria 18564
251 Ga0207694_10005655 3300025924 Bacteria 9593
252 Ga0207650_10007111 3300025925 Bacteria 7625
253 Ga0207659_10034247 3300025926 Bacteria 3500
254 Ga0207644_10004860 3300025931 Bacteria 8747
255 Ga0207690_10000027 3300025932 Bacteria 162225
256 Ga0207691_10001019 3300025940 Bacteria 27733
257 Ga0207711_10034875 3300025941 Bacteria 4262
258 Ga0207711_10041815 3300025941 Bacteria 3904
259 Ga0207661_10000776 3300025944 Bacteria 20749
260 Ga0207679_10001299 3300025945 Bacteria 15788
261 Ga0207679_10005708 3300025945 Bacteria 7806
262 Ga0207667_10013730 3300025949 Bacteria 9258
263 Ga0207667_10014270 3300025949 Bacteria 9062
264 Ga0207667_10058307 3300025949 Bacteria 4050
265 Ga0207651_10012089 3300025960 Bacteria 4864
266 Ga0207640_10027640 3300025981 Bacteria 3459
267 Ga0207640_10040511 3300025981 Bacteria 2955
268 Ga0207658_10044922 3300025986 Bacteria 3218
269 Ga0207677_10004786 3300026023 Bacteria 7306
270 Ga0207678_10007309 3300026067 Bacteria 9787
271 Ga0207678_10007657 3300026067 Bacteria 9538
272 Ga0207678_10236112 3300026067 Bacteria 1566
273 Ga0207641_10014106 3300026088 Bacteria 6550
274 Ga0207648_10002780 3300026089 Bacteria 18571
275 Ga0207648_10009324 3300026089 Bacteria 9406
276 Ga0207698_10017470 3300026142 Bacteria 4868
277 Ga0207698_10069109 3300026142 Bacteria 2791
278 Ga0209371_1000448 3300027312 Bacteria 41139
279 Ga0209974_10002343 3300027876 Bacteria 6868
280 Ga0265338_10000557 3300028800 Bacteria 65338
281 Ga0265338_10000657 3300028800 Bacteria 59844
282 Ga0268256_1000823 3300030500 Bacteria 22186
283 Ga0316181_1103375 3300030744 Bacteria 1753
284 Ga0307408_100000903 3300031548 Bacteria 23332
285 Ga0307408_100032710 3300031548 Bacteria 3627
286 Ga0316575_10000958 3300031665 Bacteria 8886
287 Ga0316579_10069219 3300031691 Bacteria 1670
288 Ga0316576_10001695 3300031727 Bacteria 12074
289 Ga0316578_10011975 3300031728 Bacteria 4562
290 Ga0316577_10010576 3300031733 Bacteria 4984
291 Ga0307412_10000005 3300031911 Bacteria 526194
292 Ga0316583_10001248 3300032133 Bacteria 8383
293 Ga0316585_10036894 3300032137 Bacteria 1550
294 Ga0316574_0000111 3300035398 Bacteria 24461
295 Ga0316582_0000515 3300036647 Bacteria 14625
296 Ga0316584_0000005 3300036712 Bacteria 71154
297 Ga0316584_0017187 3300036712 Bacteria 5196
298 Ga0395899_0000038 3300037312 Bacteria 272627
299 Ga0395899_0001610 3300037312 Bacteria 18879
300 Ga0395899_0005100 3300037312 Bacteria 10223
301 Ga0395900_0000030 3300037418 Bacteria 272630
302 Ga0395900_0002665 3300037418 Bacteria 19515
303 Ga0395900_0021117 3300037418 Bacteria 6654
304 Ga0395898_0003193 3300037466 Bacteria 18456
305 Ga0395898_0003953 3300037466 Bacteria 16336
306 Ga0395898_0078532 3300037466 Bacteria 3184
307 Ga0395905_0000465 3300037471 Bacteria 56226
308 Ga0395905_0068856 3300037471 Bacteria 3315
309 Ga0395905_0097168 3300037471 Bacteria 2765
310 Ga0395901_0000002 3300038443 Bacteria 761045
311 Ga0395901_0002176 3300038443 Bacteria 20005
312 Ga0395901_0004355 3300038443 Bacteria 14285
313 Ga0400485_21785 3300038735 Bacteria 4656
314 Ga0400488_07537 3300038741 Bacteria 13305
315 Ga0400488_08671 3300038741 Bacteria 2784
316 Ga0400488_27987 3300038741 Bacteria 2411
317 Ga0400486_16986 3300038742 Bacteria 12436
318 Ga0400486_30900 3300038742 Bacteria 19494
319 Ga0400483_281047 3300039062 Bacteria 31390
320 Ga0436361_0488537 3300039447 Bacteria 31066
321 Ga0439448_0000506 3300042005 Bacteria 8985
322 Ga0466969_0000291 3300044656 Bacteria 27353
323 Ga0466969_0004742 3300044656 Bacteria 7233
324 Ga0466969_0004860 3300044656 Bacteria 7156
325 Ga0466981_0106271 3300044669 Bacteria 1981
326 Ga0466965_0010904 3300044683 Bacteria 4251
327 Ga0466965_0021235 3300044683 Bacteria 3124
328 Ga0466966_0000660 3300044684 Bacteria 21979
329 Ga0466966_0006180 3300044684 Bacteria 7917
330 Ga0466966_0011747 3300044684 Bacteria 5805
331 Ga0466966_0036106 3300044684 Bacteria 3192
332 Ga0466961_0001333 3300044693 Bacteria 15210
333 Ga0466961_0007783 3300044693 Bacteria 6819
334 Ga0466961_0104506 3300044693 Bacteria 1783
335 Ga0466963_0001859 3300044694 Bacteria 11515
336 Ga0466963_0003635 3300044694 Bacteria 8860
337 Ga0466963_0014494 3300044694 Bacteria 4861
338 Ga0466964_0001584 3300044706 Bacteria 7841
339 Ga0466971_0001698 3300044719 Bacteria 9330
340 Ga0466968_0001715 3300044735 Bacteria 7905
341 Ga0466970_0013863 3300044765 Bacteria 4135
342 Ga0466970_0015009 3300044765 Bacteria 3983
343 Ga0466970_0017837 3300044765 Bacteria 3671
344 Ga0466970_0154387 3300044765 Bacteria 1268
345 Ga0466957_0002676 3300044842 Bacteria 9619
346 Ga0466957_0013803 3300044842 Bacteria 4694
347 Ga0466957_0052110 3300044842 Bacteria 2491
348 Ga0466957_0058997 3300044842 Bacteria 2351
349 Ga0466959_0002057 3300045049 Bacteria 12722
350 Ga0466959_0004690 3300045049 Bacteria 9203
351 Ga0466959_0160219 3300045049 Bacteria 1582
352 Ga0466958_0001243 3300045836 Bacteria 11949
353 Ga0466958_0003451 3300045836 Bacteria 8200
354 Ga0495617_001688 3300046452 Bacteria 9483
355 Ga0495617_069422 3300046452 Bacteria 1159
356 Ga0495592_0001309 3300046454 Bacteria 17282
357 Ga0495592_0005199 3300046454 Bacteria 9596
358 Ga0495592_0014906 3300046454 Bacteria 5899
359 Ga0495603_0002550 3300046455 Bacteria 10729
360 Ga0495603_0007938 3300046455 Bacteria 6404
361 Ga0495590_0008298 3300046457 Bacteria 3968
362 Ga0495629_0000556 3300046459 Bacteria 30482
363 Ga0495629_0001618 3300046459 Bacteria 17689
364 Ga0495638_0010860 3300046460 Bacteria 6297
365 Ga0495641_0038642 3300046461 Bacteria 2229
366 Ga0495651_0003393 3300046462 Bacteria 12222
367 Ga0495651_0034962 3300046462 Bacteria 3915
368 Ga0495651_0113132 3300046462 Bacteria 2004
369 Ga0495653_0007393 3300046463 Bacteria 8998
370 Ga0495653_0022373 3300046463 Bacteria 5116
371 Ga0495653_0037145 3300046463 Bacteria 3830
372 Ga0495653_0097680 3300046463 Bacteria 2133
373 Ga0495650_0000044 3300046471 Bacteria 355139
374 Ga0495650_0000490 3300046471 Bacteria 60177
375 Ga0495650_0001032 3300046471 Bacteria 31288
376 Ga0495650_0009016 3300046471 Bacteria 5729
377 Ga0495650_0012890 3300046471 Bacteria 4464
378 Ga0495650_0017632 3300046471 Bacteria 3574
379 Ga0495650_0036267 3300046471 Bacteria 2159
380 Ga0495580_0000144 3300046472 Bacteria 51193
381 Ga0495580_0012638 3300046472 Bacteria 6472
382 Ga0495580_0056735 3300046472 Bacteria 2757
383 Ga0495582_0000513 3300046473 Bacteria 21301
384 Ga0495582_0020172 3300046473 Bacteria 3647
385 Ga0495582_0041555 3300046473 Bacteria 2534
386 Ga0495582_0069711 3300046473 Bacteria 1944
387 Ga0495605_0000038 3300046474 Bacteria 197063
388 Ga0495605_0001237 3300046474 Bacteria 17019
389 Ga0495605_0003602 3300046474 Bacteria 9185
390 Ga0495605_0022373 3300046474 Bacteria 3339
391 Ga0495662_0023837 3300046476 Bacteria 2955
392 Ga0495664_0000407 3300046477 Bacteria 21029
393 Ga0495584_0000338 3300046491 Bacteria 32518
394 Ga0495584_0003766 3300046491 Bacteria 8267
395 Ga0495585_0001498 3300046492 Bacteria 18199
396 Ga0495585_0011079 3300046492 Bacteria 5352
397 Ga0495596_0001026 3300046500 Bacteria 16588
398 Ga0495607_0000154 3300046501 Bacteria 71955
399 Ga0495607_0006580 3300046501 Bacteria 8161
400 Ga0495607_0007294 3300046501 Bacteria 7668
401 Ga0495583_0001088 3300046506 Bacteria 30090
402 Ga0495583_0004034 3300046506 Bacteria 10806
403 Ga0495606_0000053 3300046507 Bacteria 200818
404 Ga0495606_0000202 3300046507 Bacteria 103924
405 Ga0495606_0001110 3300046507 Bacteria 38443
406 Ga0495606_0004632 3300046507 Bacteria 13607
407 Ga0495606_0010467 3300046507 Bacteria 7691
408 Ga0495606_0013808 3300046507 Bacteria 6350
409 Ga0495606_0071990 3300046507 Bacteria 2174
410 Ga0495608_0004410 3300046511 Bacteria 10082
411 Ga0495608_0038116 3300046511 Bacteria 3230
412 Ga0495610_0000008 3300046512 Bacteria 622732
413 Ga0495610_0000939 3300046512 Bacteria 27026
414 Ga0495610_0002169 3300046512 Bacteria 16680
415 Ga0495610_0010208 3300046512 Bacteria 5857
416 Ga0495610_0011620 3300046512 Bacteria 5367
417 Ga0495610_0013699 3300046512 Bacteria 4803
418 Ga0495616_0000297 3300046513 Bacteria 40103
419 Ga0495616_0000426 3300046513 Bacteria 32236
420 Ga0495616_0001146 3300046513 Bacteria 18708
421 Ga0495618_0004387 3300046514 Bacteria 8677
422 Ga0495618_0012550 3300046514 Bacteria 5147
423 Ga0495628_0008989 3300046516 Bacteria 8547
424 Ga0495628_0012513 3300046516 Bacteria 7151
425 Ga0495628_0024659 3300046516 Bacteria 4920
426 Ga0495628_0024929 3300046516 Bacteria 4891
427 Ga0495628_0030098 3300046516 Bacteria 4397
428 Ga0495628_0055132 3300046516 Bacteria 3131
429 Ga0495628_0226218 3300046516 Bacteria 1403
430 Ga0495630_0022066 3300046517 Bacteria 4703
431 Ga0495630_0026715 3300046517 Bacteria 4276
432 Ga0495630_0043101 3300046517 Bacteria 3370
433 Ga0495643_0000022 3300046522 Bacteria 289691
434 Ga0495643_0000544 3300046522 Bacteria 46631
435 Ga0495648_0002960 3300046524 Bacteria 15249
436 Ga0495648_0007231 3300046524 Bacteria 8918
437 Ga0495648_0014126 3300046524 Bacteria 5863
438 Ga0495648_0024460 3300046524 Bacteria 4112
439 Ga0495666_0003286 3300046526 Bacteria 8161
440 Ga0495666_0045527 3300046526 Bacteria 2116
441 Ga0495642_0037785 3300046528 Bacteria 1955
442 Ga0495652_0004070 3300046529 Bacteria 14124
443 Ga0495652_0011470 3300046529 Bacteria 8016
444 Ga0495652_0019851 3300046529 Bacteria 5980
445 Ga0495652_0073824 3300046529 Bacteria 2838
446 Ga0495652_0160741 3300046529 Bacteria 1744
447 Ga0495654_0017714 3300046530 Bacteria 3739
448 Ga0495665_0006851 3300046531 Bacteria 6147
449 Ga0495665_0014811 3300046531 Bacteria 4202
450 Ga0495665_0064986 3300046531 Bacteria 1926
451 Ga0495665_0107510 3300046531 Bacteria 1463
452 Ga0495665_0147531 3300046531 Bacteria 1228
453 Ga0495640_0004677 3300046533 Bacteria 10910
454 Ga0495640_0140133 3300046533 Bacteria 1559
455 Ga0495587_0006089 3300046536 Bacteria 7870
456 Ga0495609_0000001 3300046538 Bacteria 1060094
457 Ga0495609_0012187 3300046538 Bacteria 4079
458 Ga0495597_0003657 3300046542 Bacteria 8829
459 Ga0495597_0010571 3300046542 Bacteria 4503
460 Ga0495597_0019847 3300046542 Bacteria 3138
461 Ga0495597_0023658 3300046542 Bacteria 2841
462 Ga0495645_0002111 3300046543 Bacteria 13489
463 Ga0495645_0003064 3300046543 Bacteria 11325
464 Ga0495645_0068255 3300046543 Bacteria 2567
465 Ga0495622_0000009 3300046557 Bacteria 224622
466 Ga0495622_0002816 3300046557 Bacteria 8295
467 Ga0495622_0018809 3300046557 Bacteria 3217
468 Ga0495622_0049124 3300046557 Bacteria 1959
469 Ga0495622_0050181 3300046557 Bacteria 1937
470 Ga0495633_0000024 3300046558 Bacteria 225077
471 Ga0495633_0006180 3300046558 Bacteria 7157
472 Ga0495633_0008899 3300046558 Bacteria 5599
473 Ga0495633_0021964 3300046558 Bacteria 3184
474 Ga0495668_0000006 3300046616 Bacteria 553404
475 Ga0495668_0000027 3300046616 Bacteria 297194
476 Ga0495668_0000867 3300046616 Bacteria 34095
477 Ga0495668_0024662 3300046616 Bacteria 3420
478 Ga0495668_0091976 3300046616 Bacteria 1662
479 Ga0495634_0018589 3300046642 Bacteria 4944
480 Ga0495625_0001646 3300046660 Bacteria 26230
481 Ga0495625_0002007 3300046660 Bacteria 22954
482 Ga0495625_0013036 3300046660 Bacteria 6700
483 Ga0495625_0073669 3300046660 Bacteria 2393
484 Ga0495635_0002102 3300046663 Bacteria 13519
485 Ga0495635_0012611 3300046663 Bacteria 5928
486 Ga0495635_0025814 3300046663 Bacteria 4091
487 Ga0495635_0032176 3300046663 Bacteria 3639
488 Ga0495635_0116980 3300046663 Bacteria 1819
489 Ga0495659_0000141 3300046664 Bacteria 31709
490 Ga0495661_0000206 3300046665 Bacteria 68072
491 Ga0495661_0005113 3300046665 Bacteria 9351
492 Ga0495661_0008052 3300046665 Bacteria 7317
493 Ga0495661_0043523 3300046665 Bacteria 2759
494 Ga0495588_0011090 3300046674 Bacteria 4219
495 Ga0495588_0030376 3300046674 Bacteria 2716
496 Ga0495588_0081085 3300046674 Bacteria 1693
497 Ga0495657_0040197 3300046675 Bacteria 3210
498 Ga0495599_0003052 3300046678 Bacteria 9743
499 Ga0495599_0128463 3300046678 Bacteria 1574
500 Ga0495623_0010370 3300046679 Bacteria 6031
501 Ga0495623_0056971 3300046679 Bacteria 2459
502 Ga0495646_0000213 3300046680 Bacteria 28857
503 Ga0495646_0002043 3300046680 Bacteria 12237
504 Ga0495646_0007788 3300046680 Bacteria 6801
505 Ga0495646_0007923 3300046680 Bacteria 6748
506 Ga0495669_0019141 3300046684 Bacteria 2953
507 Ga0495613_0004229 3300046689 Bacteria 10754
508 Ga0495613_0013833 3300046689 Bacteria 5985
509 Ga0495624_0003163 3300046690 Bacteria 12265
510 Ga0495624_0008738 3300046690 Bacteria 7051
511 Ga0495624_0020031 3300046690 Bacteria 4456
512 Ga0495624_0024188 3300046690 Bacteria 3998
513 Ga0495624_0033834 3300046690 Bacteria 3309
514 Ga0495624_0041126 3300046690 Bacteria 2958
515 Ga0495670_0000681 3300046691 Bacteria 16145
516 Ga0495670_0035989 3300046691 Bacteria 2466
517 Ga0495670_0077610 3300046691 Bacteria 1688
518 Ga0495671_0000445 3300046692 Bacteria 32757
519 Ga0495671_0028010 3300046692 Bacteria 2905
520 Ga0495671_0042749 3300046692 Bacteria 2276
521 Ga0495649_0013822 3300046694 Bacteria 4644
522 Ga0495649_0014976 3300046694 Bacteria 4429
523 Ga0495649_0094379 3300046694 Bacteria 1592
524 Ga0495589_0000152 3300046794 Bacteria 64153
525 Ga0495589_0006169 3300046794 Bacteria 6328
526 Ga0495600_0000916 3300046809 Bacteria 15803
527 Ga0495600_0002306 3300046809 Bacteria 10891
528 Ga0495600_0003144 3300046809 Bacteria 9662
529 Ga0495660_0000489 3300046810 Bacteria 32927
530 Ga0495660_0005661 3300046810 Bacteria 7470
531 Ga0495660_0032031 3300046810 Bacteria 2954
532 Ga0495660_0097178 3300046810 Bacteria 1521
533 Ga0495581_0004887 3300047315 Bacteria 7751
534 Ga0495581_0024918 3300047315 Bacteria 3466
535 Ga0495581_0059305 3300047315 Bacteria 2211
536 Ga0495581_0073396 3300047315 Bacteria 1980
537 Ga0495604_0009621 3300047317 Bacteria 7645
538 Ga0495604_0012193 3300047317 Bacteria 6832
539 Ga0495604_0023802 3300047317 Bacteria 4887
540 Ga0495604_0099230 3300047317 Bacteria 2143
541 Ga0495636_0000678 3300047318 Bacteria 12474
542 Ga0495636_0082287 3300047318 Bacteria 1388
543 Ga0495674_0021507 3300047319 Bacteria 5966
544 Ga0495674_0028599 3300047319 Bacteria 5080
545 Ga0495674_0061179 3300047319 Bacteria 3283
546 Ga0495674_0152137 3300047319 Bacteria 1939
547 Ga0495674_0203066 3300047319 Bacteria 1643
548 Ga0495674_0210481 3300047319 Bacteria 1611
549 Ga0495672_0000219 3300047320 Bacteria 81635
550 Ga0495672_0000555 3300047320 Bacteria 42449
551 Ga0495672_0002308 3300047320 Bacteria 17690
552 Ga0495672_0002954 3300047320 Bacteria 14972
553 Ga0495672_0009592 3300047320 Bacteria 6993
554 Ga0495672_0021711 3300047320 Bacteria 4184
555 Ga0495676_0003912 3300047321 Bacteria 13544
556 Ga0495676_0136018 3300047321 Bacteria 1767
557 Ga0495680_0003015 3300047322 Bacteria 16791
558 Ga0495680_0016067 3300047322 Bacteria 6435
559 Ga0495680_0027379 3300047322 Bacteria 4685
560 Ga0495680_0035810 3300047322 Bacteria 3992
561 Ga0495680_0101153 3300047322 Bacteria 2147
562 Ga0495680_0119799 3300047322 Bacteria 1944
563 Ga0495683_0001515 3300047323 Bacteria 15041
564 Ga0495683_0001954 3300047323 Bacteria 12864
565 Ga0495683_0014791 3300047323 Bacteria 4063
566 Ga0495683_0031141 3300047323 Bacteria 2718
567 Ga0495687_000027 3300047443 Bacteria 299689
568 Ga0495687_000191 3300047443 Bacteria 88251
569 Ga0495687_001030 3300047443 Bacteria 27749
570 Ga0495687_026592 3300047443 Bacteria 2721
571 Ga0495675_0001420 3300047444 Bacteria 14509
572 Ga0495675_0021696 3300047444 Bacteria 4091
573 Ga0495675_0026601 3300047444 Bacteria 3689
574 Ga0495675_0085348 3300047444 Bacteria 1985
575 Ga0495677_0000001 3300047445 Bacteria 715000
576 Ga0495677_0009511 3300047445 Bacteria 3588
577 Ga0495679_000435 3300047446 Bacteria 30858
578 Ga0495679_001128 3300047446 Bacteria 16049
579 Ga0495679_003610 3300047446 Bacteria 7387
580 Ga0495685_000033 3300047447 Bacteria 57157
581 Ga0495673_0000005 3300047469 Bacteria 943364
582 Ga0495673_0000059 3300047469 Bacteria 233234
583 Ga0495673_0000067 3300047469 Bacteria 219908
584 Ga0495673_0004154 3300047469 Bacteria 9160
585 Ga0495686_0000032 3300047472 Bacteria 345132
586 Ga0495686_0000222 3300047472 Bacteria 104411
587 Ga0495686_0000231 3300047472 Bacteria 102239
588 Ga0495686_0000526 3300047472 Bacteria 55119
589 Ga0495686_0016623 3300047472 Bacteria 4984
590 Ga0495686_0050047 3300047472 Bacteria 2626
591 Ga0495686_0070711 3300047472 Bacteria 2150
592 Ga0495593_0008778 3300047673 Bacteria 5868
593 Ga0495593_0009853 3300047673 Bacteria 5544
594 Ga0495593_0028707 3300047673 Bacteria 3054
595 Ga0495593_0033969 3300047673 Bacteria 2775
596 Ga0495602_0006708 3300048088 Bacteria 12072
597 Ga0495602_0008763 3300048088 Bacteria 10559
598 Ga0495602_0028223 3300048088 Bacteria 5374
599 Ga0495602_0049579 3300048088 Bacteria 3759
600 Ga0495602_0128852 3300048088 Bacteria 2021
601 Ga0495614_0000073 3300048089 Bacteria 32790
602 Ga0495614_0008284 3300048089 Bacteria 4628
603 Ga0495626_0001295 3300048091 Bacteria 20411
604 Ga0495626_0051135 3300048091 Bacteria 1907
605 Ga0495626_0052589 3300048091 Bacteria 1877
606 Ga0496100_0001401 3300048903 Bacteria 11809
607 Ga0496100_0002872 3300048903 Bacteria 8831
608 Ga0496101_0001384 3300048904 Bacteria 14534
609 Ga0496101_0005450 3300048904 Bacteria 8111
610 Ga0496101_0093505 3300048904 Bacteria 2240
611 Ga0496102_0000101 3300048905 Bacteria 123198
612 Ga0496102_0000982 3300048905 Bacteria 26824
613 Ga0496102_0009879 3300048905 Bacteria 8205
614 Ga0496102_0009985 3300048905 Bacteria 8160
615 Ga0496102_0107099 3300048905 Bacteria 2602
616 Ga0496103_0000750 3300048906 Bacteria 23913
617 Ga0496103_0006830 3300048906 Bacteria 6811
618 Ga0496104_0044663 3300048907 Bacteria 4163
619 Ga0496104_0095818 3300048907 Bacteria 2839
620 Ga0496105_0022013 3300048908 Bacteria 5161
621 Ga0496106_0000389 3300048909 Bacteria 31317
622 Ga0496106_0209604 3300048909 Bacteria 1552
623 Ga0496106_0223756 3300048909 Bacteria 1501
624 Ga0496107_0021013 3300048910 Bacteria 4613
625 Ga0496108_0003010 3300048911 Bacteria 13546
626 Ga0496108_0093360 3300048911 Bacteria 2560
627 Ga0496109_0197940 3300048912 Bacteria 1889
628 Ga0496111_0036406 3300048914 Bacteria 3518
629 Ga0496111_0213448 3300048914 Bacteria 1433
630 Ga0496112_0014941 3300048915 Bacteria 7226
631 Ga0496113_0017568 3300048916 Bacteria 4968
632 Ga0496113_0194263 3300048916 Bacteria 1612
633 Ga0496115_0074067 3300048918 Bacteria 2764
634 Ga0496116_0015758 3300048919 Bacteria 5957
635 Ga0496117_0004045 3300048920 Bacteria 16486
636 Ga0496117_0006262 3300048920 Bacteria 12129
637 Ga0496117_0007374 3300048920 Bacteria 10766
638 Ga0496117_0024228 3300048920 Bacteria 4807
639 Ga0496117_0043033 3300048920 Bacteria 3289
640 Ga0496117_0060677 3300048920 Bacteria 2604
641 Ga0496118_0001803 3300048921 Bacteria 30867
642 Ga0496118_0002003 3300048921 Bacteria 28852
643 Ga0496118_0003491 3300048921 Bacteria 19721
644 Ga0496118_0005794 3300048921 Bacteria 13863
645 Ga0496118_0006944 3300048921 Bacteria 12238
646 Ga0496118_0015115 3300048921 Bacteria 7169
647 Ga0496118_0026844 3300048921 Bacteria 4892
648 Ga0496120_0135564 3300048923 Bacteria 1256
649 Ga0496121_0001722 3300048924 Bacteria 35754
650 Ga0496121_0001723 3300048924 Bacteria 35719
651 Ga0496121_0014969 3300048924 Bacteria 8170
652 Ga0496121_0024288 3300048924 Bacteria 5803
653 Ga0496121_0028218 3300048924 Bacteria 5230
654 Ga0496121_0037471 3300048924 Bacteria 4306
655 Ga0496122_0001320 3300048925 Bacteria 40653
656 Ga0496122_0029202 3300048925 Bacteria 4657
657 Ga0496122_0058149 3300048925 Bacteria 2865
658 Ga0496123_0005048 3300048926 Bacteria 13502
659 Ga0496123_0006703 3300048926 Bacteria 11092
660 Ga0496123_0014258 3300048926 Bacteria 6603
661 Ga0496124_0027051 3300048927 Bacteria 5159
662 Ga0496124_0029090 3300048927 Bacteria 4929
663 Ga0496124_0083882 3300048927 Bacteria 2614
664 Ga0496125_0034948 3300048928 Bacteria 4421
665 Ga0496126_0000034 3300048929 Bacteria 362440
666 Ga0496126_0001702 3300048929 Bacteria 32663
667 Ga0496126_0005654 3300048929 Bacteria 14205
668 Ga0496126_0019086 3300048929 Bacteria 6763
669 Ga0496126_0027494 3300048929 Bacteria 5432
670 Ga0495678_000071 3300049459 Bacteria 128709
671 Ga0495678_001563 3300049459 Bacteria 17582
672 Ga0495682_0001515 3300049460 Bacteria 12332
673 Ga0501031_0020072 3300049568 Bacteria 4356
674 Ga0501034_0151543 3300049571 Bacteria 2294
675 Ga0501038_0024604 3300049574 Bacteria 5370
676 Ga0501040_0003327 3300049576 Bacteria 10391
677 Ga0501041_0016641 3300049577 Bacteria 4376
678 Ga0501042_0000428 3300049578 Bacteria 21385
679 Ga0501043_0000010 3300049579 Bacteria 206374
680 Ga0501046_0000097 3300049580 Bacteria 93650
681 Ga0501047_0000026 3300049581 Bacteria 225296
682 Ga0501048_0003251 3300049582 Bacteria 12384
683 Ga0501048_0109283 3300049582 Bacteria 1952
684 Ga0501076_0087034 3300049592 Bacteria 2511
685 Ga0501249_004148 3300049679 Bacteria 2934
686 Ga0501234_006175 3300049707 Bacteria 1876
687 Ga0501269_000134 3300049766 Bacteria 23123
688 Ga0501279_001353 3300049775 Bacteria 3213
689 Ga0501045_0003305 3300049824 Bacteria 11020
690 Ga0501045_0011172 3300049824 Bacteria 6295
691 Ga0495601_0001280 3300053077 Bacteria 13791
692 Ga0500595_002958 3300053119 Bacteria 8092
693 Ga0500618_000187 3300053125 Bacteria 50730
694 Ga0500618_002400 3300053125 Bacteria 7130
695 Ga0500618_015507 3300053125 Bacteria 1925
696 Ga0500586_000139 3300053145 Bacteria 13174
697 Ga0500586_021842 3300053145 Bacteria 2024
698 Ga0500619_000189 3300053154 Bacteria 14544
699 Ga0501084_0002414 3300054114 Bacteria 15026
700 Ga0466962_0004561 3300061719 Bacteria 6648
701 Ga0466962_0004689 3300061719 Bacteria 6567
702 Ga0466962_0011403 3300061719 Bacteria 4280
703 2501075742 2501025501 Bacteria 7768574
704 2501076875 2501025502 Bacteria 9641094
705 2501411348 2501025504 Bacteria 8008976
706 2509130330 2508501125 Bacteria 7208311
707 2510250526 2510065045 Bacteria 7761063
708 2511088949 2510917013 Bacteria 9951648
709 2511100010 2510917014 Bacteria 8296963
710 2511103981 2510917015 Bacteria 7950052
711 2512348055 2512047030 Bacteria 9031815
712 2513552618 2513237082 Bacteria 8640282
713 2513565203 2513237083 Bacteria 8410967
714 2513963263 2513237151 Bacteria 6309801
715 2514053076 2513237166 Bacteria 10373764
716 2515678922 2515154122 Bacteria 8609520
717 2515688765 2515154123 Bacteria 6387382
718 2516021199 2515154189 Bacteria 9629850
719 2519459293 2519103095 Bacteria 6629912
720 2527077184 2526164713 Bacteria 6780608
721 2548497428 2547132374 Bacteria 5530232
722 2563062567 2562617112 Bacteria 10918404
723 2585294313 2582581311 Bacteria 6763856
724 2599738339 2599185239 Bacteria 8686614
725 2599746461 2599185240 Bacteria 7968121
726 2600208367 2599185355 Bacteria 7968906
727 2600813084 2600255067 Bacteria 6795583
728 2643792262 2643221554 Bacteria 6603920
729 2643866537 2643221570 Bacteria 5103772
730 2644212247 2643221638 Bacteria 6579467
731 2644294106 2643221652 Bacteria 5140275
732 2644354724 2643221664 Bacteria 7272945
733 2644646109 2643221717 Bacteria 5676132
734 2676745327 2675903129 Bacteria 7964495
735 2713477574 2711768613 Bacteria 11048459
736 2719639674 2718217991 Bacteria 7829542
737 2723877081 2721755763 Bacteria 4464185
738 2738739815 2738541280 Bacteria 6630198
739 2738823235 2738541296 Bacteria 7285013
740 2738828011 2738541297 Bacteria 6549566
741 2738835663 2738541298 Bacteria 7286732
742 2738842333 2738541300 Bacteria 6675882
743 2738877156 2738541306 Bacteria 7284992
744 2739151807 2738541357 Bacteria 6549408
745 2739188862 2738543002 Bacteria 7284546
746 2739194172 2738543003 Bacteria 6549560
747 2739223749 2738543008 Bacteria 7282815
748 2739274034 2738543018 Bacteria 6718814
749 2739320203 2738543026 Bacteria 6549408
750 2739338889 2738543029 Bacteria 6549249
751 2739343078 2738543030 Bacteria 6719714
752 2746091760 2744054900 Bacteria 8399525
753 2746097134 2744054901 Bacteria 8397047
754 2753568083 2751185846 Bacteria 7242164
755 2792833717 2791355137 Bacteria 9654227
756 2808971997 2808606384 Bacteria 8474373
757 2809006826 2808606390 Bacteria 8476311
758 2809013964 2808606391 Bacteria 8308166
759 2817261580 2816332253 Bacteria 6764532
760 2817279262 2816332256 Bacteria 6891714
761 2817454539 2816332286 Bacteria 6853759
762 2819540649 2818991436 Bacteria 5376622
763 2819622306 2818991450 Bacteria 6962147
764 2819633534 2818991452 Bacteria 8442785
765 2842329959 2842324504 Bacteria 9364110
766 2842356197 2842348783 Bacteria 9002918
767 2842457521 2842454564 Bacteria 8730687
768 2856294065 2856287931 Bacteria 7223934
769 2857362498 2857357740 Bacteria 9937880
770 2857560034 2857558681 Bacteria 6617694
771 2857566772 2857564685 Bacteria 6290584
772 2857578216 2857576091 Bacteria 5465855
773 2863425709 2863421361 Bacteria 7300805
774 2870070719 2870068957 Bacteria 8925310
775 2881102180 2881101125 Bacteria 4590519
776 2883094131 2883087390 Bacteria 9532701
777 2885273218 2885270888 Bacteria 9831543
778 2900635602 2900634093 Bacteria 10263517
779 2902688655 2902682994 Bacteria 8951596
780 2904426793 2904424332 Bacteria 7633521
781 2904435718 2904434214 Bacteria 6230908
782 2904487139 2904483920 Bacteria 7545285
783 2904569914 2904564687 Bacteria 7609577
784 2904577066 2904571731 Bacteria 7608790
785 2904619781 2904615490 Bacteria 10047340
786 2919528445 2919527303 Bacteria 7718827
787 2921653208 2921643360 Bacteria 11448031
788 2928113065 2928108538 Bacteria 7360024
789 2928140224 2928135762 Bacteria 7259641
790 2928161653 2928157003 Bacteria 7522202
791 2928168481 2928163908 Bacteria 7561269
792 2928174792 2928170801 Bacteria 8785406
793 2928507783 2928503688 Bacteria 7268108
794 2928542484 2928536128 Bacteria 7657547
795 2932425895 2932422444 Bacteria 4678430
796 2939636463 2939631187 Bacteria 6118131
797 2945936164 2945934425 Bacteria 7444609
798 2981993641 2981990288 Bacteria 7590678
799 2990709934 2990703756 Bacteria 7715990
800 642427200 641736151 Bacteria 7477263
801 642415158 641736154 Bacteria 7689995
802 642593774 642555112 Bacteria 8676562
803 642620933 642555113 Bacteria 8214658
804 8003961447 8003955200 Bacteria 8601927
805 8018850903 8018845410 Bacteria 8933938
806 8020810083 8020807995 Bacteria 6801506
807 8020940968 8020938398 Bacteria 7472757
808 8020952329 8020945358 Bacteria 8467355
809 8020958418 8020953355 Bacteria 7439080
810 8021125175 8021120328 Bacteria 8782274
811 8039103476 8039098773 Bacteria 6602928
812 8040170323 8040167225 Bacteria 6542727
813 8040175881 8040173305 Bacteria 6827067
814 8055271339 8055266321 Bacteria 7999742
815 8055306044 8055301274 Bacteria 8587385
816 JGI25162J39368_1000001
817 JGI24740J21852_10008374
818 JGI24739J22299_10002136
819 JGI24739J22299_10019359
820 JGI24735J21928_10000244
821 JGI24735J21928_10001284
822 JGI24735J21928_10016996
823 JGI25156J39149_1000669
824 JGI25154J39366_1000678
825 JGI25152J39213_1000005
826 JGI25150J39212_1000071
827 JGI25159J45721_1001569
828 JGI25159J45721_1007241
829 JGI25151J46595_10051495
830 JGI25165J46597_1000001
831 JGI25165J46597_1001219
832 JGI25153J46596_10005435
833 rootL2_10007264
834 rootL2_10008705
835 rootL2_10026973
836 rootL2_10028055
837 rootL2_10050715
838 rootL2_10053525
839 JGI25160J50197_1000870
840 JGI25160J50197_1007831
841 JGI25161J50226_1000581
842 JGI25161J50226_1002931
843 Ga0055538_1000001
844 Ga0055539_1000001
845 Ga0055533_1000003
846 Ga0055533_1000271
847 Ga0055533_1001132
848 Ga0055532_1000063
849 Ga0055532_1000635
850 Ga0055532_1001446
851 Ga0055532_1001456
852 Ga0055525_1000003
853 Ga0055527_1000049
854 Ga0055527_1000477
855 Ga0055527_1002732
856 Ga0055535_1000042
857 Ga0055535_1001183
858 Ga0055535_1001193
859 Ga0055542_1000071
860 Ga0055542_1001169
861 Ga0055529_1000081
862 Ga0055529_1000128
863 Ga0055529_1000780
864 Ga0055526_1000013
865 Ga0055526_1001685
866 Ga0055537_1005497
867 Ga0055524_1000224
868 Ga0055524_1001696
869 Ga0055524_1005207
870 Ga0055534_1001332
871 Ga0055528_1001644
872 Ga0055528_1006195
873 Ga0055530_10000552
874 Ga0055530_10003433
875 Ga0055531_10002900
876 Ga0055531_10021167
877 Ga0055541_1000001
878 Ga0058692_1003994
879 Ga0055543_1001685
880 Ga0065165_1000559
881 Ga0065165_1002395
882 Ga0070658_10012862
883 Ga0070658_10022666
884 Ga0070658_10037577
885 Ga0070658_10101236
886 Ga0070683_100003543
887 Ga0070670_100000714
888 Ga0070677_10004146
889 Ga0068868_100012422
890 Ga0070660_100001483
891 Ga0070660_100002336
892 Ga0070660_100002371
893 Ga0070660_100157255
894 Ga0070661_100008886
895 Ga0070661_100015613
896 Ga0070661_100080763
897 Ga0070675_100000465
898 Ga0070671_100001721
899 Ga0070674_100057027
900 Ga0070673_100003268
901 Ga0070659_100000069
902 Ga0070667_100064290
903 Ga0070663_100000696
904 Ga0070663_100002505
905 Ga0070663_100120149
906 Ga0068867_100011101
907 Ga0070684_100012350
908 Ga0070672_100000119
909 Ga0068855_100004770
910 Ga0068855_100036153
911 Ga0070664_100002152
912 Ga0070664_100028976
913 Ga0068857_100287263
914 Ga0068854_100002231
915 Ga0068852_100005925
916 Ga0068852_100027502
917 Ga0068866_10017030
918 Ga0068851_10011665
919 Ga0068863_100063738
920 Ga0097621_100007013
921 Ga0068871_100011374
922 Ga0105251_10000250
923 Ga0105251_10001135
924 Ga0105244_10011494
925 Ga0105240_10008362
926 Ga0105240_10012664
927 Ga0105240_10046886
928 Ga0105240_10126548
929 Ga0105243_10010354
930 Ga0105248_10013799
931 Ga0105248_10097666
932 Ga0105237_10028648
933 Ga0105237_10033084
934 Ga0105238_10001371
935 Ga0105238_10041926
936 Ga0105238_10136887
937 Ga0105239_10005995
938 Ga0105239_10037464
939 Ga0105239_10088612
940 Ga0157373_10024520
941 Ga0157370_10011220
942 Ga0157370_10060740
943 Ga0157370_10141112
944 Ga0157369_10002854
945 Ga0157369_10003118
946 Ga0157369_10006997
947 Ga0157369_10010440
948 Ga0157369_10013968
949 Ga0157374_10000428
950 Ga0157374_10024145
951 Ga0157374_10293354
952 Ga0157372_10016699
953 Ga0157372_10345429
954 Ga0157375_10000644
955 Ga0157375_10354230
956 Ga0182008_10017166
957 Ga0157377_10000055
958 Ga0157376_10006100
959 Ga0182006_1012234
960 Ga0182007_10000032
961 Ga0182007_10000557
962 Ga0182007_10006335
963 Ga0182005_1000996
964 Ga0183361_10010
965 Ga0163161_10000153
966 Ga0213872_10000019
967 Ga0224712_10000046
968 Ga0209760_102499
969 Ga0209436_100358
970 Ga0209436_101573
971 Ga0209784_100004
972 Ga0209566_100004
973 Ga0209674_100006
974 Ga0209674_100294
975 Ga0209674_100316
976 Ga0209672_100010
977 Ga0209672_100033
978 Ga0209672_100114
979 Ga0209672_100867
980 Ga0209147_100006
981 Ga0209147_100161
982 Ga0209147_100390
983 Ga0209147_100971
984 Ga0209563_100009
985 Ga0209563_100715
986 Ga0207427_100293
987 Ga0207427_101889
988 Ga0209437_100004
989 Ga0209258_100010
990 Ga0209258_100100
991 Ga0209258_100263
992 Ga0207425_1000001
993 Ga0207425_1000056
994 Ga0207425_1000178
995 Ga0209646_1000007
996 Ga0209677_100005
997 Ga0209148_1000018
998 Ga0209148_1000432
999 Ga0209148_1001019
1000 Ga0209759_1000402
1001 Ga0209759_1000403
1002 Ga0209759_1000749
1003 Ga0209759_1015281
1004 Ga0209129_1000003
1005 Ga0209129_1004265
1006 Ga0209233_1000005
1007 Ga0209233_1000171
1008 Ga0209565_1000900
1009 Ga0209565_1001280
1010 Ga0209565_1001370
1011 Ga0209455_1000015
1012 Ga0209455_1000026
1013 Ga0209455_1000192
1014 Ga0209673_1000332
1015 Ga0209130_1002057
1016 Ga0209130_1002724
1017 Ga0209130_1008718
1018 Ga0209130_1008763
1019 Ga0209675_1003751
1020 Ga0209675_1020010
1021 Ga0209025_1004504
1022 Ga0209564_1000002
1023 Ga0209564_1000272
1024 Ga0209564_1002232
1025 Ga0209564_1002542
1026 Ga0209564_1003866
1027 Ga0209564_1007040
1028 Ga0209758_1000041
1029 Ga0209758_1003222
1030 Ga0209050_1000011
1031 Ga0209050_1000089
1032 Ga0209050_1000392
1033 Ga0209050_1000470
1034 Ga0209256_1000068
1035 Ga0209256_1001080
1036 Ga0209256_1005590
1037 Ga0209256_1006044
1038 Ga0207426_1000590
1039 Ga0207426_1001589
1040 Ga0207426_1006052
1041 Ga0209257_1000003
1042 Ga0209257_1009608
1043 Ga0207713_1000295
1044 Ga0207713_1004921
1045 Ga0207682_10006551
1046 Ga0207642_10027835
1047 Ga0207647_10000873
1048 Ga0207647_10007060
1049 Ga0207647_10023624
1050 Ga0207647_10032109
1051 Ga0207645_10041081
1052 Ga0207705_10006147
1053 Ga0207705_10022872
1054 Ga0207705_10030495
1055 Ga0207695_10006076
1056 Ga0207695_10010079
1057 Ga0207695_10020742
1058 Ga0207695_10022418
1059 Ga0207695_10279683
1060 Ga0207657_10000068
1061 Ga0207657_10002652
1062 Ga0207649_10005421
1063 Ga0207649_10017509
1064 Ga0207649_10093231
1065 Ga0207694_10001679
1066 Ga0207694_10005655
1067 Ga0207650_10007111
1068 Ga0207659_10034247
1069 Ga0207644_10004860
1070 Ga0207690_10000027
1071 Ga0207691_10001019
1072 Ga0207711_10034875
1073 Ga0207711_10041815
1074 Ga0207661_10000776
1075 Ga0207679_10001299
1076 Ga0207679_10005708
1077 Ga0207667_10013730
1078 Ga0207667_10014270
1079 Ga0207667_10058307
1080 Ga0207651_10012089
1081 Ga0207640_10027640
1082 Ga0207640_10040511
1083 Ga0207658_10044922
1084 Ga0207677_10004786
1085 Ga0207678_10007309
1086 Ga0207678_10007657
1087 Ga0207678_10236112
1088 Ga0207641_10014106
1089 Ga0207648_10002780
1090 Ga0207648_10009324
1091 Ga0207698_10017470
1092 Ga0207698_10069109
1093 Ga0209371_1000448
1094 Ga0209974_10002343
1095 Ga0265338_10000557
1096 Ga0265338_10000657
1097 Ga0268256_1000823
1098 Ga0316181_1103375
1099 Ga0307408_100000903
1100 Ga0307408_100032710
1101 Ga0316575_10000958
1102 Ga0316579_10069219
1103 Ga0316576_10001695
1104 Ga0316578_10011975
1105 Ga0316577_10010576
1106 Ga0307412_10000005
1107 Ga0316583_10001248
1108 Ga0316585_10036894
1109 Ga0316574_0000111
1110 Ga0316582_0000515
1111 Ga0316584_0000005
1112 Ga0316584_0017187
1113 Ga0395899_0000038
1114 Ga0395899_0001610
1115 Ga0395899_0005100
1116 Ga0395900_0000030
1117 Ga0395900_0002665
1118 Ga0395900_0021117
1119 Ga0395898_0003193
1120 Ga0395898_0003953
1121 Ga0395898_0078532
1122 Ga0395905_0000465
1123 Ga0395905_0068856
1124 Ga0395905_0097168
1125 Ga0395901_0000002
1126 Ga0395901_0002176
1127 Ga0395901_0004355
1128 Ga0400485_21785
1129 Ga0400488_07537
1130 Ga0400488_08671
1131 Ga0400488_27987
1132 Ga0400486_16986
1133 Ga0400486_30900
1134 Ga0400483_281047
1135 Ga0436361_0488537
1136 Ga0439448_0000506
1137 Ga0466969_0000291
1138 Ga0466969_0004742
1139 Ga0466969_0004860
1140 Ga0466981_0106271
1141 Ga0466965_0010904
1142 Ga0466965_0021235
1143 Ga0466966_0000660
1144 Ga0466966_0006180
1145 Ga0466966_0011747
1146 Ga0466966_0036106
1147 Ga0466961_0001333
1148 Ga0466961_0007783
1149 Ga0466961_0104506
1150 Ga0466963_0001859
1151 Ga0466963_0003635
1152 Ga0466963_0014494
1153 Ga0466964_0001584
1154 Ga0466971_0001698
1155 Ga0466968_0001715
1156 Ga0466970_0013863
1157 Ga0466970_0015009
1158 Ga0466970_0017837
1159 Ga0466970_0154387
1160 Ga0466957_0002676
1161 Ga0466957_0013803
1162 Ga0466957_0052110
1163 Ga0466957_0058997
1164 Ga0466959_0002057
1165 Ga0466959_0004690
1166 Ga0466959_0160219
1167 Ga0466958_0001243
1168 Ga0466958_0003451
1169 Ga0495617_001688
1170 Ga0495617_069422
1171 Ga0495592_0001309
1172 Ga0495592_0005199
1173 Ga0495592_0014906
1174 Ga0495603_0002550
1175 Ga0495603_0007938
1176 Ga0495590_0008298
1177 Ga0495629_0000556
1178 Ga0495629_0001618
1179 Ga0495638_0010860
1180 Ga0495641_0038642
1181 Ga0495651_0003393
1182 Ga0495651_0034962
1183 Ga0495651_0113132
1184 Ga0495653_0007393
1185 Ga0495653_0022373
1186 Ga0495653_0037145
1187 Ga0495653_0097680
1188 Ga0495650_0000044
1189 Ga0495650_0000490
1190 Ga0495650_0001032
1191 Ga0495650_0009016
1192 Ga0495650_0012890
1193 Ga0495650_0017632
1194 Ga0495650_0036267
1195 Ga0495580_0000144
1196 Ga0495580_0012638
1197 Ga0495580_0056735
1198 Ga0495582_0000513
1199 Ga0495582_0020172
1200 Ga0495582_0041555
1201 Ga0495582_0069711
1202 Ga0495605_0000038
1203 Ga0495605_0001237
1204 Ga0495605_0003602
1205 Ga0495605_0022373
1206 Ga0495662_0023837
1207 Ga0495664_0000407
1208 Ga0495584_0000338
1209 Ga0495584_0003766
1210 Ga0495585_0001498
1211 Ga0495585_0011079
1212 Ga0495596_0001026
1213 Ga0495607_0000154
1214 Ga0495607_0006580
1215 Ga0495607_0007294
1216 Ga0495583_0001088
1217 Ga0495583_0004034
1218 Ga0495606_0000053
1219 Ga0495606_0000202
1220 Ga0495606_0001110
1221 Ga0495606_0004632
1222 Ga0495606_0010467
1223 Ga0495606_0013808
1224 Ga0495606_0071990
1225 Ga0495608_0004410
1226 Ga0495608_0038116
1227 Ga0495610_0000008
1228 Ga0495610_0000939
1229 Ga0495610_0002169
1230 Ga0495610_0010208
1231 Ga0495610_0011620
1232 Ga0495610_0013699
1233 Ga0495616_0000297
1234 Ga0495616_0000426
1235 Ga0495616_0001146
1236 Ga0495618_0004387
1237 Ga0495618_0012550
1238 Ga0495628_0008989
1239 Ga0495628_0012513
1240 Ga0495628_0024659
1241 Ga0495628_0024929
1242 Ga0495628_0030098
1243 Ga0495628_0055132
1244 Ga0495628_0226218
1245 Ga0495630_0022066
1246 Ga0495630_0026715
1247 Ga0495630_0043101
1248 Ga0495643_0000022
1249 Ga0495643_0000544
1250 Ga0495648_0002960
1251 Ga0495648_0007231
1252 Ga0495648_0014126
1253 Ga0495648_0024460
1254 Ga0495666_0003286
1255 Ga0495666_0045527
1256 Ga0495642_0037785
1257 Ga0495652_0004070
1258 Ga0495652_0011470
1259 Ga0495652_0019851
1260 Ga0495652_0073824
1261 Ga0495652_0160741
1262 Ga0495654_0017714
1263 Ga0495665_0006851
1264 Ga0495665_0014811
1265 Ga0495665_0064986
1266 Ga0495665_0107510
1267 Ga0495665_0147531
1268 Ga0495640_0004677
1269 Ga0495640_0140133
1270 Ga0495587_0006089
1271 Ga0495609_0000001
1272 Ga0495609_0012187
1273 Ga0495597_0003657
1274 Ga0495597_0010571
1275 Ga0495597_0019847
1276 Ga0495597_0023658
1277 Ga0495645_0002111
1278 Ga0495645_0003064
1279 Ga0495645_0068255
1280 Ga0495622_0000009
1281 Ga0495622_0002816
1282 Ga0495622_0018809
1283 Ga0495622_0049124
1284 Ga0495622_0050181
1285 Ga0495633_0000024
1286 Ga0495633_0006180
1287 Ga0495633_0008899
1288 Ga0495633_0021964
1289 Ga0495668_0000006
1290 Ga0495668_0000027
1291 Ga0495668_0000867
1292 Ga0495668_0024662
1293 Ga0495668_0091976
1294 Ga0495634_0018589
1295 Ga0495625_0001646
1296 Ga0495625_0002007
1297 Ga0495625_0013036
1298 Ga0495625_0073669
1299 Ga0495635_0002102
1300 Ga0495635_0012611
1301 Ga0495635_0025814
1302 Ga0495635_0032176
1303 Ga0495635_0116980
1304 Ga0495659_0000141
1305 Ga0495661_0000206
1306 Ga0495661_0005113
1307 Ga0495661_0008052
1308 Ga0495661_0043523
1309 Ga0495588_0011090
1310 Ga0495588_0030376
1311 Ga0495588_0081085
1312 Ga0495657_0040197
1313 Ga0495599_0003052
1314 Ga0495599_0128463
1315 Ga0495623_0010370
1316 Ga0495623_0056971
1317 Ga0495646_0000213
1318 Ga0495646_0002043
1319 Ga0495646_0007788
1320 Ga0495646_0007923
1321 Ga0495669_0019141
1322 Ga0495613_0004229
1323 Ga0495613_0013833
1324 Ga0495624_0003163
1325 Ga0495624_0008738
1326 Ga0495624_0020031
1327 Ga0495624_0024188
1328 Ga0495624_0033834
1329 Ga0495624_0041126
1330 Ga0495670_0000681
1331 Ga0495670_0035989
1332 Ga0495670_0077610
1333 Ga0495671_0000445
1334 Ga0495671_0028010
1335 Ga0495671_0042749
1336 Ga0495649_0013822
1337 Ga0495649_0014976
1338 Ga0495649_0094379
1339 Ga0495589_0000152
1340 Ga0495589_0006169
1341 Ga0495600_0000916
1342 Ga0495600_0002306
1343 Ga0495600_0003144
1344 Ga0495660_0000489
1345 Ga0495660_0005661
1346 Ga0495660_0032031
1347 Ga0495660_0097178
1348 Ga0495581_0004887
1349 Ga0495581_0024918
1350 Ga0495581_0059305
1351 Ga0495581_0073396
1352 Ga0495604_0009621
1353 Ga0495604_0012193
1354 Ga0495604_0023802
1355 Ga0495604_0099230
1356 Ga0495636_0000678
1357 Ga0495636_0082287
1358 Ga0495674_0021507
1359 Ga0495674_0028599
1360 Ga0495674_0061179
1361 Ga0495674_0152137
1362 Ga0495674_0203066
1363 Ga0495674_0210481
1364 Ga0495672_0000219
1365 Ga0495672_0000555
1366 Ga0495672_0002308
1367 Ga0495672_0002954
1368 Ga0495672_0009592
1369 Ga0495672_0021711
1370 Ga0495676_0003912
1371 Ga0495676_0136018
1372 Ga0495680_0003015
1373 Ga0495680_0016067
1374 Ga0495680_0027379
1375 Ga0495680_0035810
1376 Ga0495680_0101153
1377 Ga0495680_0119799
1378 Ga0495683_0001515
1379 Ga0495683_0001954
1380 Ga0495683_0014791
1381 Ga0495683_0031141
1382 Ga0495687_000027
1383 Ga0495687_000191
1384 Ga0495687_001030
1385 Ga0495687_026592
1386 Ga0495675_0001420
1387 Ga0495675_0021696
1388 Ga0495675_0026601
1389 Ga0495675_0085348
1390 Ga0495677_0000001
1391 Ga0495677_0009511
1392 Ga0495679_000435
1393 Ga0495679_001128
1394 Ga0495679_003610
1395 Ga0495685_000033
1396 Ga0495673_0000005
1397 Ga0495673_0000059
1398 Ga0495673_0000067
1399 Ga0495673_0004154
1400 Ga0495686_0000032
1401 Ga0495686_0000222
1402 Ga0495686_0000231
1403 Ga0495686_0000526
1404 Ga0495686_0016623
1405 Ga0495686_0050047
1406 Ga0495686_0070711
1407 Ga0495593_0008778
1408 Ga0495593_0009853
1409 Ga0495593_0028707
1410 Ga0495593_0033969
1411 Ga0495602_0006708
1412 Ga0495602_0008763
1413 Ga0495602_0028223
1414 Ga0495602_0049579
1415 Ga0495602_0128852
1416 Ga0495614_0000073
1417 Ga0495614_0008284
1418 Ga0495626_0001295
1419 Ga0495626_0051135
1420 Ga0495626_0052589
1421 Ga0496100_0001401
1422 Ga0496100_0002872
1423 Ga0496101_0001384
1424 Ga0496101_0005450
1425 Ga0496101_0093505
1426 Ga0496102_0000101
1427 Ga0496102_0000982
1428 Ga0496102_0009879
1429 Ga0496102_0009985
1430 Ga0496102_0107099
1431 Ga0496103_0000750
1432 Ga0496103_0006830
1433 Ga0496104_0044663
1434 Ga0496104_0095818
1435 Ga0496105_0022013
1436 Ga0496106_0000389
1437 Ga0496106_0209604
1438 Ga0496106_0223756
1439 Ga0496107_0021013
1440 Ga0496108_0003010
1441 Ga0496108_0093360
1442 Ga0496109_0197940
1443 Ga0496111_0036406
1444 Ga0496111_0213448
1445 Ga0496112_0014941
1446 Ga0496113_0017568
1447 Ga0496113_0194263
1448 Ga0496115_0074067
1449 Ga0496116_0015758
1450 Ga0496117_0004045
1451 Ga0496117_0006262
1452 Ga0496117_0007374
1453 Ga0496117_0024228
1454 Ga0496117_0043033
1455 Ga0496117_0060677
1456 Ga0496118_0001803
1457 Ga0496118_0002003
1458 Ga0496118_0003491
1459 Ga0496118_0005794
1460 Ga0496118_0006944
1461 Ga0496118_0015115
1462 Ga0496118_0026844
1463 Ga0496120_0135564
1464 Ga0496121_0001722
1465 Ga0496121_0001723
1466 Ga0496121_0014969
1467 Ga0496121_0024288
1468 Ga0496121_0028218
1469 Ga0496121_0037471
1470 Ga0496122_0001320
1471 Ga0496122_0029202
1472 Ga0496122_0058149
1473 Ga0496123_0005048
1474 Ga0496123_0006703
1475 Ga0496123_0014258
1476 Ga0496124_0027051
1477 Ga0496124_0029090
1478 Ga0496124_0083882
1479 Ga0496125_0034948
1480 Ga0496126_0000034
1481 Ga0496126_0001702
1482 Ga0496126_0005654
1483 Ga0496126_0019086
1484 Ga0496126_0027494
1485 Ga0495678_000071
1486 Ga0495678_001563
1487 Ga0495682_0001515
1488 Ga0501031_0020072
1489 Ga0501034_0151543
1490 Ga0501038_0024604
1491 Ga0501040_0003327
1492 Ga0501041_0016641
1493 Ga0501042_0000428
1494 Ga0501043_0000010
1495 Ga0501046_0000097
1496 Ga0501047_0000026
1497 Ga0501048_0003251
1498 Ga0501048_0109283
1499 Ga0501076_0087034
1500 Ga0501249_004148
1501 Ga0501234_006175
1502 Ga0501269_000134
1503 Ga0501279_001353
1504 Ga0501045_0003305
1505 Ga0501045_0011172
1506 Ga0495601_0001280
1507 Ga0500595_002958
1508 Ga0500618_000187
1509 Ga0500618_002400
1510 Ga0500618_015507
1511 Ga0500586_000139
1512 Ga0500586_021842
1513 Ga0500619_000189
1514 Ga0501084_0002414
1515 Ga0466962_0004561
1516 Ga0466962_0004689
1517 Ga0466962_0011403
1518 2501075742
1519 2501076875
1520 2501411348
1521 2509130330
1522 2510250526
1523 2511088949
1524 2511100010
1525 2511103981
1526 2512348055
1527 2513552618
1528 2513565203
1529 2513963263
1530 2514053076
1531 2515678922
1532 2515688765
1533 2516021199
1534 2519459293
1535 2527077184
1536 2548497428
1537 2563062567
1538 2585294313
1539 2599738339
1540 2599746461
1541 2600208367
1542 2600813084
1543 2643792262
1544 2643866537
1545 2644212247
1546 2644294106
1547 2644354724
1548 2644646109
1549 2676745327
1550 2713477574
1551 2719639674
1552 2723877081
1553 2738739815
1554 2738823235
1555 2738828011
1556 2738835663
1557 2738842333
1558 2738877156
1559 2739151807
1560 2739188862
1561 2739194172
1562 2739223749
1563 2739274034
1564 2739320203
1565 2739338889
1566 2739343078
1567 2746091760
1568 2746097134
1569 2753568083
1570 2792833717
1571 2808971997
1572 2809006826
1573 2809013964
1574 2817261580
1575 2817279262
1576 2817454539
1577 2819540649
1578 2819622306
1579 2819633534
1580 2842329959
1581 2842356197
1582 2842457521
1583 2856294065
1584 2857362498
1585 2857560034
1586 2857566772
1587 2857578216
1588 2863425709
1589 2870070719
1590 2881102180
1591 2883094131
1592 2885273218
1593 2900635602
1594 2902688655
1595 2904426793
1596 2904435718
1597 2904487139
1598 2904569914
1599 2904577066
1600 2904619781
1601 2919528445
1602 2921653208
1603 2928113065
1604 2928140224
1605 2928161653
1606 2928168481
1607 2928174792
1608 2928507783
1609 2928542484
1610 2932425895
1611 2939636463
1612 2945936164
1613 2981993641
1614 2990709934
1615 642427200
1616 642415158
1617 642593774
1618 642620933
1619 8003961447
1620 8018850903
1621 8020810083
1622 8020940968
1623 8020952329
1624 8020958418
1625 8021125175
1626 8039103476
1627 8040170323
1628 8040175881
1629 8055271339
1630 8055306044

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

55

409

0.94

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

104

232

0.85

PF00266

Aminotran_5

Aminotransferase class-V

96

239

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u08-assembly1.cif.gz_B crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9803 8 389
1u08-assembly1.cif.gz_A crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9796 8 389
1u08-assembly1.cif.gz_B crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9777 8 389
1u08-assembly1.cif.gz_A crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.977 8 389
2o0r-assembly1.cif.gz_B the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis 0.9568 12 388
ID Description Score Start End Superfamily
af_P77806_47_284_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9921 53 286 3.40.640.10
af_A0A1D6I5Q5_168_402_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9796 52 282 3.40.640.10
af_P77806_286_386_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9765 291 389 3.90.1150.10
af_P77806_47_284_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9714 53 286 3.40.640.10
af_Q54KM6_55_307_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9654 53 284 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A257JDI9-F1-model_v4 Methionine aminotransferase 0.9934 118 333 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A7X5N1V2-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.992 195 350 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-I3UHU5-F1-model_v4 Methionine aminotransferase 0.9918 29 389 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A6A5KY21-F1-model_v4 deleted 0.9899 13 382
AF-A0A257JDI9-F1-model_v4 Methionine aminotransferase 0.9889 118 333 GO:0005737
GO:0009058
GO:0016212
GO:0030170

Map