F482005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 815 | 426 | 1630 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300002737|JGI25162J39368_1000001|JGI25162J39368_1000001641 |
| Length | 412 |
| Sequence | MRNPETKTDSKQMNRDLRIPDRAASADPRPTPLQSRLPKVGTTIFTVMSTLASEKSAVNLGQGFPDFDCDPALVDAVSGAMKNGFNQYPPMPGVXXXRQAIAAKIKNVYGHSYDPATEITVTAGATQGILTAIMCAVHPGDEVIVIEPAYDSYVPSIELAGGKPVLVQMTLGADGYQVPWDRIAAAVSPRTRMIMVNSPHNPTGSVLKPADIAALKDIVRGTEILILSDEVYEHMVFDGARHESVCRDPELAARAFVVSSFGKTYHVTGWKIGYVAAPAMLSAEFRKVHQYNIFTVNTPVQHGIAQYMQNPAPYLELPAFYQRKRDLFRDGLKHTRFKLLPADGTYFLCVDYSAISSLSEADFAIWLTSEVGVAAIPVSAFYQSPRESGIVRFCFAKQDQTLQQALQRLAKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 151 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 154 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 157 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 158 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 159 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 160 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 167 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 168 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 169 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 170 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 173 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 280 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 285 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 286 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 287 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 288 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 289 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 311 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 314 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 315 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 316 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 317 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 318 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 319 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 320 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 321 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 322 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 323 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 324 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 325 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 326 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 327 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 328 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 329 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 330 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 331 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 332 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 333 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 334 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 335 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 336 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 337 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 338 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 339 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 340 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 341 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 342 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 343 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 344 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 345 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 346 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 347 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 348 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 349 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 350 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 351 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 352 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 353 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 354 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 355 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 356 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 357 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 358 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 359 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 360 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 361 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 362 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 363 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 364 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 365 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 366 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 367 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 368 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 369 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 370 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 371 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 372 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 373 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 374 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 375 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 376 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 377 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 378 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 379 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 380 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 381 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 382 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 383 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 384 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 385 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 386 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 387 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 388 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 389 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 390 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 391 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 392 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 393 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 394 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 395 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 396 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 397 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 398 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 399 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 400 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 401 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 402 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 403 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 404 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 405 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 406 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 407 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 408 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 409 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 410 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 411 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 412 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 413 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 414 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 415 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 416 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 417 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 418 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 419 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 420 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 421 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 422 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 423 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 424 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 425 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 426 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.01 |
| Metatranscriptomes | 0.12 |
| Isolates | 13.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.71 |
| Nodule | 2.45 |
| Rhizoplane | 4.05 |
| Rhizosphere | 63.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 2 | JGI24740J21852_10008374 | 3300001979 | Bacteria | 4122 |
| 3 | JGI24739J22299_10002136 | 3300001989 | Bacteria | 7577 |
| 4 | JGI24739J22299_10019359 | 3300001989 | Bacteria | 2436 |
| 5 | JGI24735J21928_10000244 | 3300002067 | Bacteria | 19138 |
| 6 | JGI24735J21928_10001284 | 3300002067 | Bacteria | 8912 |
| 7 | JGI24735J21928_10016996 | 3300002067 | Bacteria | 2252 |
| 8 | JGI25156J39149_1000669 | 3300002705 | Bacteria | 18535 |
| 9 | JGI25154J39366_1000678 | 3300002738 | Bacteria | 15760 |
| 10 | JGI25152J39213_1000005 | 3300002773 | Bacteria | 160019 |
| 11 | JGI25150J39212_1000071 | 3300002774 | Bacteria | 61665 |
| 12 | JGI25159J45721_1001569 | 3300002987 | Bacteria | 9357 |
| 13 | JGI25159J45721_1007241 | 3300002987 | Bacteria | 3203 |
| 14 | JGI25151J46595_10051495 | 3300003187 | Bacteria | 1393 |
| 15 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 16 | JGI25165J46597_1001219 | 3300003214 | Bacteria | 15399 |
| 17 | JGI25153J46596_10005435 | 3300003215 | Bacteria | 6687 |
| 18 | rootL2_10007264 | 3300003322 | Bacteria | 2374 |
| 19 | rootL2_10008705 | 3300003322 | Bacteria | 11118 |
| 20 | rootL2_10026973 | 3300003322 | Bacteria | 15088 |
| 21 | rootL2_10028055 | 3300003322 | Bacteria | 2201 |
| 22 | rootL2_10050715 | 3300003322 | Bacteria | 8120 |
| 23 | rootL2_10053525 | 3300003322 | Bacteria | 1970 |
| 24 | JGI25160J50197_1000870 | 3300003354 | Bacteria | 15998 |
| 25 | JGI25160J50197_1007831 | 3300003354 | Bacteria | 4134 |
| 26 | JGI25161J50226_1000581 | 3300003374 | Bacteria | 15474 |
| 27 | JGI25161J50226_1002931 | 3300003374 | Bacteria | 4141 |
| 28 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 29 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 30 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 31 | Ga0055533_1000271 | 3300003756 | Bacteria | 28380 |
| 32 | Ga0055533_1001132 | 3300003756 | Bacteria | 7560 |
| 33 | Ga0055532_1000063 | 3300003758 | Bacteria | 147140 |
| 34 | Ga0055532_1000635 | 3300003758 | Bacteria | 13624 |
| 35 | Ga0055532_1001446 | 3300003758 | Bacteria | 6603 |
| 36 | Ga0055532_1001456 | 3300003758 | Bacteria | 6577 |
| 37 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 38 | Ga0055527_1000049 | 3300003760 | Bacteria | 105168 |
| 39 | Ga0055527_1000477 | 3300003760 | Bacteria | 14946 |
| 40 | Ga0055527_1002732 | 3300003760 | Bacteria | 2861 |
| 41 | Ga0055535_1000042 | 3300003761 | Bacteria | 147140 |
| 42 | Ga0055535_1001183 | 3300003761 | Bacteria | 15072 |
| 43 | Ga0055535_1001193 | 3300003761 | Bacteria | 14946 |
| 44 | Ga0055542_1000071 | 3300003762 | Bacteria | 147140 |
| 45 | Ga0055542_1001169 | 3300003762 | Bacteria | 15120 |
| 46 | Ga0055529_1000081 | 3300003763 | Bacteria | 147140 |
| 47 | Ga0055529_1000128 | 3300003763 | Bacteria | 108143 |
| 48 | Ga0055529_1000780 | 3300003763 | Bacteria | 19809 |
| 49 | Ga0055526_1000013 | 3300003771 | Bacteria | 233580 |
| 50 | Ga0055526_1001685 | 3300003771 | Bacteria | 15474 |
| 51 | Ga0055537_1005497 | 3300003773 | Bacteria | 3387 |
| 52 | Ga0055524_1000224 | 3300003775 | Bacteria | 60133 |
| 53 | Ga0055524_1001696 | 3300003775 | Bacteria | 12278 |
| 54 | Ga0055524_1005207 | 3300003775 | Bacteria | 5848 |
| 55 | Ga0055534_1001332 | 3300003784 | Bacteria | 9919 |
| 56 | Ga0055528_1001644 | 3300003790 | Bacteria | 13157 |
| 57 | Ga0055528_1006195 | 3300003790 | Bacteria | 5450 |
| 58 | Ga0055530_10000552 | 3300003791 | Bacteria | 32453 |
| 59 | Ga0055530_10003433 | 3300003791 | Bacteria | 9008 |
| 60 | Ga0055531_10002900 | 3300003794 | Bacteria | 11166 |
| 61 | Ga0055531_10021167 | 3300003794 | Bacteria | 2536 |
| 62 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 63 | Ga0058692_1003994 | 3300003856 | Bacteria | 4445 |
| 64 | Ga0055543_1001685 | 3300004625 | Bacteria | 8364 |
| 65 | Ga0065165_1000559 | 3300005262 | Bacteria | 55415 |
| 66 | Ga0065165_1002395 | 3300005262 | Bacteria | 16030 |
| 67 | Ga0070658_10012862 | 3300005327 | Bacteria | 6718 |
| 68 | Ga0070658_10022666 | 3300005327 | Bacteria | 5039 |
| 69 | Ga0070658_10037577 | 3300005327 | Bacteria | 3904 |
| 70 | Ga0070658_10101236 | 3300005327 | Bacteria | 2382 |
| 71 | Ga0070683_100003543 | 3300005329 | Bacteria | 12705 |
| 72 | Ga0070670_100000714 | 3300005331 | Bacteria | 25798 |
| 73 | Ga0070677_10004146 | 3300005333 | Bacteria | 4711 |
| 74 | Ga0068868_100012422 | 3300005338 | Bacteria | 6225 |
| 75 | Ga0070660_100001483 | 3300005339 | Bacteria | 16064 |
| 76 | Ga0070660_100002336 | 3300005339 | Bacteria | 13027 |
| 77 | Ga0070660_100002371 | 3300005339 | Bacteria | 12942 |
| 78 | Ga0070660_100157255 | 3300005339 | Bacteria | 1830 |
| 79 | Ga0070661_100008886 | 3300005344 | Bacteria | 6954 |
| 80 | Ga0070661_100015613 | 3300005344 | Bacteria | 5361 |
| 81 | Ga0070661_100080763 | 3300005344 | Bacteria | 2400 |
| 82 | Ga0070675_100000465 | 3300005354 | Bacteria | 27680 |
| 83 | Ga0070671_100001721 | 3300005355 | Bacteria | 16617 |
| 84 | Ga0070674_100057027 | 3300005356 | Bacteria | 2710 |
| 85 | Ga0070673_100003268 | 3300005364 | Bacteria | 10059 |
| 86 | Ga0070659_100000069 | 3300005366 | Bacteria | 81078 |
| 87 | Ga0070667_100064290 | 3300005367 | Bacteria | 3113 |
| 88 | Ga0070663_100000696 | 3300005455 | Bacteria | 18105 |
| 89 | Ga0070663_100002505 | 3300005455 | Bacteria | 10360 |
| 90 | Ga0070663_100120149 | 3300005455 | Bacteria | 1984 |
| 91 | Ga0068867_100011101 | 3300005459 | Bacteria | 6354 |
| 92 | Ga0070684_100012350 | 3300005535 | Bacteria | 6842 |
| 93 | Ga0070672_100000119 | 3300005543 | Bacteria | 40242 |
| 94 | Ga0068855_100004770 | 3300005563 | Bacteria | 16555 |
| 95 | Ga0068855_100036153 | 3300005563 | Bacteria | 5880 |
| 96 | Ga0070664_100002152 | 3300005564 | Bacteria | 15794 |
| 97 | Ga0070664_100028976 | 3300005564 | Bacteria | 4612 |
| 98 | Ga0068857_100287263 | 3300005577 | Bacteria | 1514 |
| 99 | Ga0068854_100002231 | 3300005578 | Bacteria | 11923 |
| 100 | Ga0068852_100005925 | 3300005616 | Bacteria | 8788 |
| 101 | Ga0068852_100027502 | 3300005616 | Bacteria | 4636 |
| 102 | Ga0068866_10017030 | 3300005718 | Bacteria | 3262 |
| 103 | Ga0068851_10011665 | 3300005834 | Bacteria | 4124 |
| 104 | Ga0068863_100063738 | 3300005841 | Bacteria | 3486 |
| 105 | Ga0097621_100007013 | 3300006237 | Bacteria | 8025 |
| 106 | Ga0068871_100011374 | 3300006358 | Bacteria | 6525 |
| 107 | Ga0105251_10000250 | 3300009011 | Bacteria | 54231 |
| 108 | Ga0105251_10001135 | 3300009011 | Bacteria | 23157 |
| 109 | Ga0105244_10011494 | 3300009036 | Bacteria | 5301 |
| 110 | Ga0105240_10008362 | 3300009093 | Bacteria | 14811 |
| 111 | Ga0105240_10012664 | 3300009093 | Bacteria | 11626 |
| 112 | Ga0105240_10046886 | 3300009093 | Bacteria | 5472 |
| 113 | Ga0105240_10126548 | 3300009093 | Bacteria | 3070 |
| 114 | Ga0105243_10010354 | 3300009148 | Bacteria | 7082 |
| 115 | Ga0105248_10013799 | 3300009177 | Bacteria | 8890 |
| 116 | Ga0105248_10097666 | 3300009177 | Bacteria | 3309 |
| 117 | Ga0105237_10028648 | 3300009545 | Bacteria | 5670 |
| 118 | Ga0105237_10033084 | 3300009545 | Bacteria | 5237 |
| 119 | Ga0105238_10001371 | 3300009551 | Bacteria | 24426 |
| 120 | Ga0105238_10041926 | 3300009551 | Bacteria | 4636 |
| 121 | Ga0105238_10136887 | 3300009551 | Bacteria | 2427 |
| 122 | Ga0105239_10005995 | 3300010375 | Bacteria | 14143 |
| 123 | Ga0105239_10037464 | 3300010375 | Bacteria | 5315 |
| 124 | Ga0105239_10088612 | 3300010375 | Bacteria | 3412 |
| 125 | Ga0157373_10024520 | 3300013100 | Bacteria | 4368 |
| 126 | Ga0157370_10011220 | 3300013104 | Bacteria | 9395 |
| 127 | Ga0157370_10060740 | 3300013104 | Bacteria | 3587 |
| 128 | Ga0157370_10141112 | 3300013104 | Bacteria | 2245 |
| 129 | Ga0157369_10002854 | 3300013105 | Bacteria | 20639 |
| 130 | Ga0157369_10003118 | 3300013105 | Bacteria | 19808 |
| 131 | Ga0157369_10006997 | 3300013105 | Bacteria | 13013 |
| 132 | Ga0157369_10010440 | 3300013105 | Bacteria | 10580 |
| 133 | Ga0157369_10013968 | 3300013105 | Bacteria | 9075 |
| 134 | Ga0157374_10000428 | 3300013296 | Bacteria | 38117 |
| 135 | Ga0157374_10024145 | 3300013296 | Bacteria | 5447 |
| 136 | Ga0157374_10293354 | 3300013296 | Bacteria | 1608 |
| 137 | Ga0157372_10016699 | 3300013307 | Bacteria | 7879 |
| 138 | Ga0157372_10345429 | 3300013307 | Bacteria | 1734 |
| 139 | Ga0157375_10000644 | 3300013308 | Bacteria | 30997 |
| 140 | Ga0157375_10354230 | 3300013308 | Bacteria | 1634 |
| 141 | Ga0182008_10017166 | 3300014497 | Bacteria | 3756 |
| 142 | Ga0157377_10000055 | 3300014745 | Bacteria | 88103 |
| 143 | Ga0157376_10006100 | 3300014969 | Bacteria | 8480 |
| 144 | Ga0182006_1012234 | 3300015261 | Bacteria | 3756 |
| 145 | Ga0182007_10000032 | 3300015262 | Bacteria | 145577 |
| 146 | Ga0182007_10000557 | 3300015262 | Bacteria | 22035 |
| 147 | Ga0182007_10006335 | 3300015262 | Bacteria | 5088 |
| 148 | Ga0182005_1000996 | 3300015265 | Bacteria | 12201 |
| 149 | Ga0183361_10010 | 3300016635 | Bacteria | 204902 |
| 150 | Ga0163161_10000153 | 3300017792 | Bacteria | 63614 |
| 151 | Ga0213872_10000019 | 3300021361 | Bacteria | 172803 |
| 152 | Ga0224712_10000046 | 3300022467 | Bacteria | 19115 |
| 153 | Ga0209760_102499 | 3300025207 | Bacteria | 1714 |
| 154 | Ga0209436_100358 | 3300025208 | Bacteria | 20628 |
| 155 | Ga0209436_101573 | 3300025208 | Bacteria | 7715 |
| 156 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 157 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 158 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 159 | Ga0209674_100294 | 3300025226 | Bacteria | 35436 |
| 160 | Ga0209674_100316 | 3300025226 | Bacteria | 31254 |
| 161 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 162 | Ga0209672_100033 | 3300025228 | Bacteria | 315326 |
| 163 | Ga0209672_100114 | 3300025228 | Bacteria | 90538 |
| 164 | Ga0209672_100867 | 3300025228 | Bacteria | 13860 |
| 165 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 166 | Ga0209147_100161 | 3300025229 | Bacteria | 90627 |
| 167 | Ga0209147_100390 | 3300025229 | Bacteria | 30099 |
| 168 | Ga0209147_100971 | 3300025229 | Bacteria | 12546 |
| 169 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 170 | Ga0209563_100715 | 3300025230 | Bacteria | 10353 |
| 171 | Ga0207427_100293 | 3300025231 | Bacteria | 35384 |
| 172 | Ga0207427_101889 | 3300025231 | Bacteria | 6567 |
| 173 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 174 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 175 | Ga0209258_100100 | 3300025242 | Bacteria | 214027 |
| 176 | Ga0209258_100263 | 3300025242 | Bacteria | 90453 |
| 177 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 178 | Ga0207425_1000056 | 3300025245 | Bacteria | 151802 |
| 179 | Ga0207425_1000178 | 3300025245 | Bacteria | 52247 |
| 180 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 181 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 182 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 183 | Ga0209148_1000432 | 3300025254 | Bacteria | 46257 |
| 184 | Ga0209148_1001019 | 3300025254 | Bacteria | 17617 |
| 185 | Ga0209759_1000402 | 3300025256 | Bacteria | 53409 |
| 186 | Ga0209759_1000403 | 3300025256 | Bacteria | 53279 |
| 187 | Ga0209759_1000749 | 3300025256 | Bacteria | 28201 |
| 188 | Ga0209759_1015281 | 3300025256 | Bacteria | 1987 |
| 189 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 190 | Ga0209129_1004265 | 3300025258 | Bacteria | 5715 |
| 191 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 192 | Ga0209233_1000171 | 3300025261 | Bacteria | 146605 |
| 193 | Ga0209565_1000900 | 3300025263 | Bacteria | 16075 |
| 194 | Ga0209565_1001280 | 3300025263 | Bacteria | 11665 |
| 195 | Ga0209565_1001370 | 3300025263 | Bacteria | 10960 |
| 196 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 197 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 198 | Ga0209455_1000192 | 3300025272 | Bacteria | 90553 |
| 199 | Ga0209673_1000332 | 3300025273 | Bacteria | 86973 |
| 200 | Ga0209130_1002057 | 3300025284 | Bacteria | 10892 |
| 201 | Ga0209130_1002724 | 3300025284 | Bacteria | 8375 |
| 202 | Ga0209130_1008718 | 3300025284 | Bacteria | 2966 |
| 203 | Ga0209130_1008763 | 3300025284 | Bacteria | 2953 |
| 204 | Ga0209675_1003751 | 3300025291 | Bacteria | 7037 |
| 205 | Ga0209675_1020010 | 3300025291 | Bacteria | 1826 |
| 206 | Ga0209025_1004504 | 3300025294 | Bacteria | 12046 |
| 207 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 208 | Ga0209564_1000272 | 3300025295 | Bacteria | 108384 |
| 209 | Ga0209564_1002232 | 3300025295 | Bacteria | 15972 |
| 210 | Ga0209564_1002542 | 3300025295 | Bacteria | 14060 |
| 211 | Ga0209564_1003866 | 3300025295 | Bacteria | 9642 |
| 212 | Ga0209564_1007040 | 3300025295 | Bacteria | 5893 |
| 213 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 214 | Ga0209758_1003222 | 3300025297 | Bacteria | 15199 |
| 215 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 216 | Ga0209050_1000089 | 3300025298 | Bacteria | 256212 |
| 217 | Ga0209050_1000392 | 3300025298 | Bacteria | 82085 |
| 218 | Ga0209050_1000470 | 3300025298 | Bacteria | 71502 |
| 219 | Ga0209256_1000068 | 3300025299 | Bacteria | 246064 |
| 220 | Ga0209256_1001080 | 3300025299 | Bacteria | 31504 |
| 221 | Ga0209256_1005590 | 3300025299 | Bacteria | 7147 |
| 222 | Ga0209256_1006044 | 3300025299 | Bacteria | 6611 |
| 223 | Ga0207426_1000590 | 3300025302 | Bacteria | 47972 |
| 224 | Ga0207426_1001589 | 3300025302 | Bacteria | 18204 |
| 225 | Ga0207426_1006052 | 3300025302 | Bacteria | 5344 |
| 226 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 227 | Ga0209257_1009608 | 3300025304 | Bacteria | 5129 |
| 228 | Ga0207713_1000295 | 3300025735 | Bacteria | 57436 |
| 229 | Ga0207713_1004921 | 3300025735 | Bacteria | 8536 |
| 230 | Ga0207682_10006551 | 3300025893 | Bacteria | 4686 |
| 231 | Ga0207642_10027835 | 3300025899 | Bacteria | 2319 |
| 232 | Ga0207647_10000873 | 3300025904 | Bacteria | 23357 |
| 233 | Ga0207647_10007060 | 3300025904 | Bacteria | 8144 |
| 234 | Ga0207647_10023624 | 3300025904 | Bacteria | 4064 |
| 235 | Ga0207647_10032109 | 3300025904 | Bacteria | 3376 |
| 236 | Ga0207645_10041081 | 3300025907 | Bacteria | 2962 |
| 237 | Ga0207705_10006147 | 3300025909 | Bacteria | 8934 |
| 238 | Ga0207705_10022872 | 3300025909 | Bacteria | 4456 |
| 239 | Ga0207705_10030495 | 3300025909 | Bacteria | 3848 |
| 240 | Ga0207695_10006076 | 3300025913 | Bacteria | 15757 |
| 241 | Ga0207695_10010079 | 3300025913 | Bacteria | 11603 |
| 242 | Ga0207695_10020742 | 3300025913 | Bacteria | 7518 |
| 243 | Ga0207695_10022418 | 3300025913 | Bacteria | 7168 |
| 244 | Ga0207695_10279683 | 3300025913 | Bacteria | 1563 |
| 245 | Ga0207657_10000068 | 3300025919 | Bacteria | 96575 |
| 246 | Ga0207657_10002652 | 3300025919 | Bacteria | 19312 |
| 247 | Ga0207649_10005421 | 3300025920 | Bacteria | 6905 |
| 248 | Ga0207649_10017509 | 3300025920 | Bacteria | 4061 |
| 249 | Ga0207649_10093231 | 3300025920 | Bacteria | 1976 |
| 250 | Ga0207694_10001679 | 3300025924 | Bacteria | 18564 |
| 251 | Ga0207694_10005655 | 3300025924 | Bacteria | 9593 |
| 252 | Ga0207650_10007111 | 3300025925 | Bacteria | 7625 |
| 253 | Ga0207659_10034247 | 3300025926 | Bacteria | 3500 |
| 254 | Ga0207644_10004860 | 3300025931 | Bacteria | 8747 |
| 255 | Ga0207690_10000027 | 3300025932 | Bacteria | 162225 |
| 256 | Ga0207691_10001019 | 3300025940 | Bacteria | 27733 |
| 257 | Ga0207711_10034875 | 3300025941 | Bacteria | 4262 |
| 258 | Ga0207711_10041815 | 3300025941 | Bacteria | 3904 |
| 259 | Ga0207661_10000776 | 3300025944 | Bacteria | 20749 |
| 260 | Ga0207679_10001299 | 3300025945 | Bacteria | 15788 |
| 261 | Ga0207679_10005708 | 3300025945 | Bacteria | 7806 |
| 262 | Ga0207667_10013730 | 3300025949 | Bacteria | 9258 |
| 263 | Ga0207667_10014270 | 3300025949 | Bacteria | 9062 |
| 264 | Ga0207667_10058307 | 3300025949 | Bacteria | 4050 |
| 265 | Ga0207651_10012089 | 3300025960 | Bacteria | 4864 |
| 266 | Ga0207640_10027640 | 3300025981 | Bacteria | 3459 |
| 267 | Ga0207640_10040511 | 3300025981 | Bacteria | 2955 |
| 268 | Ga0207658_10044922 | 3300025986 | Bacteria | 3218 |
| 269 | Ga0207677_10004786 | 3300026023 | Bacteria | 7306 |
| 270 | Ga0207678_10007309 | 3300026067 | Bacteria | 9787 |
| 271 | Ga0207678_10007657 | 3300026067 | Bacteria | 9538 |
| 272 | Ga0207678_10236112 | 3300026067 | Bacteria | 1566 |
| 273 | Ga0207641_10014106 | 3300026088 | Bacteria | 6550 |
| 274 | Ga0207648_10002780 | 3300026089 | Bacteria | 18571 |
| 275 | Ga0207648_10009324 | 3300026089 | Bacteria | 9406 |
| 276 | Ga0207698_10017470 | 3300026142 | Bacteria | 4868 |
| 277 | Ga0207698_10069109 | 3300026142 | Bacteria | 2791 |
| 278 | Ga0209371_1000448 | 3300027312 | Bacteria | 41139 |
| 279 | Ga0209974_10002343 | 3300027876 | Bacteria | 6868 |
| 280 | Ga0265338_10000557 | 3300028800 | Bacteria | 65338 |
| 281 | Ga0265338_10000657 | 3300028800 | Bacteria | 59844 |
| 282 | Ga0268256_1000823 | 3300030500 | Bacteria | 22186 |
| 283 | Ga0316181_1103375 | 3300030744 | Bacteria | 1753 |
| 284 | Ga0307408_100000903 | 3300031548 | Bacteria | 23332 |
| 285 | Ga0307408_100032710 | 3300031548 | Bacteria | 3627 |
| 286 | Ga0316575_10000958 | 3300031665 | Bacteria | 8886 |
| 287 | Ga0316579_10069219 | 3300031691 | Bacteria | 1670 |
| 288 | Ga0316576_10001695 | 3300031727 | Bacteria | 12074 |
| 289 | Ga0316578_10011975 | 3300031728 | Bacteria | 4562 |
| 290 | Ga0316577_10010576 | 3300031733 | Bacteria | 4984 |
| 291 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 292 | Ga0316583_10001248 | 3300032133 | Bacteria | 8383 |
| 293 | Ga0316585_10036894 | 3300032137 | Bacteria | 1550 |
| 294 | Ga0316574_0000111 | 3300035398 | Bacteria | 24461 |
| 295 | Ga0316582_0000515 | 3300036647 | Bacteria | 14625 |
| 296 | Ga0316584_0000005 | 3300036712 | Bacteria | 71154 |
| 297 | Ga0316584_0017187 | 3300036712 | Bacteria | 5196 |
| 298 | Ga0395899_0000038 | 3300037312 | Bacteria | 272627 |
| 299 | Ga0395899_0001610 | 3300037312 | Bacteria | 18879 |
| 300 | Ga0395899_0005100 | 3300037312 | Bacteria | 10223 |
| 301 | Ga0395900_0000030 | 3300037418 | Bacteria | 272630 |
| 302 | Ga0395900_0002665 | 3300037418 | Bacteria | 19515 |
| 303 | Ga0395900_0021117 | 3300037418 | Bacteria | 6654 |
| 304 | Ga0395898_0003193 | 3300037466 | Bacteria | 18456 |
| 305 | Ga0395898_0003953 | 3300037466 | Bacteria | 16336 |
| 306 | Ga0395898_0078532 | 3300037466 | Bacteria | 3184 |
| 307 | Ga0395905_0000465 | 3300037471 | Bacteria | 56226 |
| 308 | Ga0395905_0068856 | 3300037471 | Bacteria | 3315 |
| 309 | Ga0395905_0097168 | 3300037471 | Bacteria | 2765 |
| 310 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 311 | Ga0395901_0002176 | 3300038443 | Bacteria | 20005 |
| 312 | Ga0395901_0004355 | 3300038443 | Bacteria | 14285 |
| 313 | Ga0400485_21785 | 3300038735 | Bacteria | 4656 |
| 314 | Ga0400488_07537 | 3300038741 | Bacteria | 13305 |
| 315 | Ga0400488_08671 | 3300038741 | Bacteria | 2784 |
| 316 | Ga0400488_27987 | 3300038741 | Bacteria | 2411 |
| 317 | Ga0400486_16986 | 3300038742 | Bacteria | 12436 |
| 318 | Ga0400486_30900 | 3300038742 | Bacteria | 19494 |
| 319 | Ga0400483_281047 | 3300039062 | Bacteria | 31390 |
| 320 | Ga0436361_0488537 | 3300039447 | Bacteria | 31066 |
| 321 | Ga0439448_0000506 | 3300042005 | Bacteria | 8985 |
| 322 | Ga0466969_0000291 | 3300044656 | Bacteria | 27353 |
| 323 | Ga0466969_0004742 | 3300044656 | Bacteria | 7233 |
| 324 | Ga0466969_0004860 | 3300044656 | Bacteria | 7156 |
| 325 | Ga0466981_0106271 | 3300044669 | Bacteria | 1981 |
| 326 | Ga0466965_0010904 | 3300044683 | Bacteria | 4251 |
| 327 | Ga0466965_0021235 | 3300044683 | Bacteria | 3124 |
| 328 | Ga0466966_0000660 | 3300044684 | Bacteria | 21979 |
| 329 | Ga0466966_0006180 | 3300044684 | Bacteria | 7917 |
| 330 | Ga0466966_0011747 | 3300044684 | Bacteria | 5805 |
| 331 | Ga0466966_0036106 | 3300044684 | Bacteria | 3192 |
| 332 | Ga0466961_0001333 | 3300044693 | Bacteria | 15210 |
| 333 | Ga0466961_0007783 | 3300044693 | Bacteria | 6819 |
| 334 | Ga0466961_0104506 | 3300044693 | Bacteria | 1783 |
| 335 | Ga0466963_0001859 | 3300044694 | Bacteria | 11515 |
| 336 | Ga0466963_0003635 | 3300044694 | Bacteria | 8860 |
| 337 | Ga0466963_0014494 | 3300044694 | Bacteria | 4861 |
| 338 | Ga0466964_0001584 | 3300044706 | Bacteria | 7841 |
| 339 | Ga0466971_0001698 | 3300044719 | Bacteria | 9330 |
| 340 | Ga0466968_0001715 | 3300044735 | Bacteria | 7905 |
| 341 | Ga0466970_0013863 | 3300044765 | Bacteria | 4135 |
| 342 | Ga0466970_0015009 | 3300044765 | Bacteria | 3983 |
| 343 | Ga0466970_0017837 | 3300044765 | Bacteria | 3671 |
| 344 | Ga0466970_0154387 | 3300044765 | Bacteria | 1268 |
| 345 | Ga0466957_0002676 | 3300044842 | Bacteria | 9619 |
| 346 | Ga0466957_0013803 | 3300044842 | Bacteria | 4694 |
| 347 | Ga0466957_0052110 | 3300044842 | Bacteria | 2491 |
| 348 | Ga0466957_0058997 | 3300044842 | Bacteria | 2351 |
| 349 | Ga0466959_0002057 | 3300045049 | Bacteria | 12722 |
| 350 | Ga0466959_0004690 | 3300045049 | Bacteria | 9203 |
| 351 | Ga0466959_0160219 | 3300045049 | Bacteria | 1582 |
| 352 | Ga0466958_0001243 | 3300045836 | Bacteria | 11949 |
| 353 | Ga0466958_0003451 | 3300045836 | Bacteria | 8200 |
| 354 | Ga0495617_001688 | 3300046452 | Bacteria | 9483 |
| 355 | Ga0495617_069422 | 3300046452 | Bacteria | 1159 |
| 356 | Ga0495592_0001309 | 3300046454 | Bacteria | 17282 |
| 357 | Ga0495592_0005199 | 3300046454 | Bacteria | 9596 |
| 358 | Ga0495592_0014906 | 3300046454 | Bacteria | 5899 |
| 359 | Ga0495603_0002550 | 3300046455 | Bacteria | 10729 |
| 360 | Ga0495603_0007938 | 3300046455 | Bacteria | 6404 |
| 361 | Ga0495590_0008298 | 3300046457 | Bacteria | 3968 |
| 362 | Ga0495629_0000556 | 3300046459 | Bacteria | 30482 |
| 363 | Ga0495629_0001618 | 3300046459 | Bacteria | 17689 |
| 364 | Ga0495638_0010860 | 3300046460 | Bacteria | 6297 |
| 365 | Ga0495641_0038642 | 3300046461 | Bacteria | 2229 |
| 366 | Ga0495651_0003393 | 3300046462 | Bacteria | 12222 |
| 367 | Ga0495651_0034962 | 3300046462 | Bacteria | 3915 |
| 368 | Ga0495651_0113132 | 3300046462 | Bacteria | 2004 |
| 369 | Ga0495653_0007393 | 3300046463 | Bacteria | 8998 |
| 370 | Ga0495653_0022373 | 3300046463 | Bacteria | 5116 |
| 371 | Ga0495653_0037145 | 3300046463 | Bacteria | 3830 |
| 372 | Ga0495653_0097680 | 3300046463 | Bacteria | 2133 |
| 373 | Ga0495650_0000044 | 3300046471 | Bacteria | 355139 |
| 374 | Ga0495650_0000490 | 3300046471 | Bacteria | 60177 |
| 375 | Ga0495650_0001032 | 3300046471 | Bacteria | 31288 |
| 376 | Ga0495650_0009016 | 3300046471 | Bacteria | 5729 |
| 377 | Ga0495650_0012890 | 3300046471 | Bacteria | 4464 |
| 378 | Ga0495650_0017632 | 3300046471 | Bacteria | 3574 |
| 379 | Ga0495650_0036267 | 3300046471 | Bacteria | 2159 |
| 380 | Ga0495580_0000144 | 3300046472 | Bacteria | 51193 |
| 381 | Ga0495580_0012638 | 3300046472 | Bacteria | 6472 |
| 382 | Ga0495580_0056735 | 3300046472 | Bacteria | 2757 |
| 383 | Ga0495582_0000513 | 3300046473 | Bacteria | 21301 |
| 384 | Ga0495582_0020172 | 3300046473 | Bacteria | 3647 |
| 385 | Ga0495582_0041555 | 3300046473 | Bacteria | 2534 |
| 386 | Ga0495582_0069711 | 3300046473 | Bacteria | 1944 |
| 387 | Ga0495605_0000038 | 3300046474 | Bacteria | 197063 |
| 388 | Ga0495605_0001237 | 3300046474 | Bacteria | 17019 |
| 389 | Ga0495605_0003602 | 3300046474 | Bacteria | 9185 |
| 390 | Ga0495605_0022373 | 3300046474 | Bacteria | 3339 |
| 391 | Ga0495662_0023837 | 3300046476 | Bacteria | 2955 |
| 392 | Ga0495664_0000407 | 3300046477 | Bacteria | 21029 |
| 393 | Ga0495584_0000338 | 3300046491 | Bacteria | 32518 |
| 394 | Ga0495584_0003766 | 3300046491 | Bacteria | 8267 |
| 395 | Ga0495585_0001498 | 3300046492 | Bacteria | 18199 |
| 396 | Ga0495585_0011079 | 3300046492 | Bacteria | 5352 |
| 397 | Ga0495596_0001026 | 3300046500 | Bacteria | 16588 |
| 398 | Ga0495607_0000154 | 3300046501 | Bacteria | 71955 |
| 399 | Ga0495607_0006580 | 3300046501 | Bacteria | 8161 |
| 400 | Ga0495607_0007294 | 3300046501 | Bacteria | 7668 |
| 401 | Ga0495583_0001088 | 3300046506 | Bacteria | 30090 |
| 402 | Ga0495583_0004034 | 3300046506 | Bacteria | 10806 |
| 403 | Ga0495606_0000053 | 3300046507 | Bacteria | 200818 |
| 404 | Ga0495606_0000202 | 3300046507 | Bacteria | 103924 |
| 405 | Ga0495606_0001110 | 3300046507 | Bacteria | 38443 |
| 406 | Ga0495606_0004632 | 3300046507 | Bacteria | 13607 |
| 407 | Ga0495606_0010467 | 3300046507 | Bacteria | 7691 |
| 408 | Ga0495606_0013808 | 3300046507 | Bacteria | 6350 |
| 409 | Ga0495606_0071990 | 3300046507 | Bacteria | 2174 |
| 410 | Ga0495608_0004410 | 3300046511 | Bacteria | 10082 |
| 411 | Ga0495608_0038116 | 3300046511 | Bacteria | 3230 |
| 412 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 413 | Ga0495610_0000939 | 3300046512 | Bacteria | 27026 |
| 414 | Ga0495610_0002169 | 3300046512 | Bacteria | 16680 |
| 415 | Ga0495610_0010208 | 3300046512 | Bacteria | 5857 |
| 416 | Ga0495610_0011620 | 3300046512 | Bacteria | 5367 |
| 417 | Ga0495610_0013699 | 3300046512 | Bacteria | 4803 |
| 418 | Ga0495616_0000297 | 3300046513 | Bacteria | 40103 |
| 419 | Ga0495616_0000426 | 3300046513 | Bacteria | 32236 |
| 420 | Ga0495616_0001146 | 3300046513 | Bacteria | 18708 |
| 421 | Ga0495618_0004387 | 3300046514 | Bacteria | 8677 |
| 422 | Ga0495618_0012550 | 3300046514 | Bacteria | 5147 |
| 423 | Ga0495628_0008989 | 3300046516 | Bacteria | 8547 |
| 424 | Ga0495628_0012513 | 3300046516 | Bacteria | 7151 |
| 425 | Ga0495628_0024659 | 3300046516 | Bacteria | 4920 |
| 426 | Ga0495628_0024929 | 3300046516 | Bacteria | 4891 |
| 427 | Ga0495628_0030098 | 3300046516 | Bacteria | 4397 |
| 428 | Ga0495628_0055132 | 3300046516 | Bacteria | 3131 |
| 429 | Ga0495628_0226218 | 3300046516 | Bacteria | 1403 |
| 430 | Ga0495630_0022066 | 3300046517 | Bacteria | 4703 |
| 431 | Ga0495630_0026715 | 3300046517 | Bacteria | 4276 |
| 432 | Ga0495630_0043101 | 3300046517 | Bacteria | 3370 |
| 433 | Ga0495643_0000022 | 3300046522 | Bacteria | 289691 |
| 434 | Ga0495643_0000544 | 3300046522 | Bacteria | 46631 |
| 435 | Ga0495648_0002960 | 3300046524 | Bacteria | 15249 |
| 436 | Ga0495648_0007231 | 3300046524 | Bacteria | 8918 |
| 437 | Ga0495648_0014126 | 3300046524 | Bacteria | 5863 |
| 438 | Ga0495648_0024460 | 3300046524 | Bacteria | 4112 |
| 439 | Ga0495666_0003286 | 3300046526 | Bacteria | 8161 |
| 440 | Ga0495666_0045527 | 3300046526 | Bacteria | 2116 |
| 441 | Ga0495642_0037785 | 3300046528 | Bacteria | 1955 |
| 442 | Ga0495652_0004070 | 3300046529 | Bacteria | 14124 |
| 443 | Ga0495652_0011470 | 3300046529 | Bacteria | 8016 |
| 444 | Ga0495652_0019851 | 3300046529 | Bacteria | 5980 |
| 445 | Ga0495652_0073824 | 3300046529 | Bacteria | 2838 |
| 446 | Ga0495652_0160741 | 3300046529 | Bacteria | 1744 |
| 447 | Ga0495654_0017714 | 3300046530 | Bacteria | 3739 |
| 448 | Ga0495665_0006851 | 3300046531 | Bacteria | 6147 |
| 449 | Ga0495665_0014811 | 3300046531 | Bacteria | 4202 |
| 450 | Ga0495665_0064986 | 3300046531 | Bacteria | 1926 |
| 451 | Ga0495665_0107510 | 3300046531 | Bacteria | 1463 |
| 452 | Ga0495665_0147531 | 3300046531 | Bacteria | 1228 |
| 453 | Ga0495640_0004677 | 3300046533 | Bacteria | 10910 |
| 454 | Ga0495640_0140133 | 3300046533 | Bacteria | 1559 |
| 455 | Ga0495587_0006089 | 3300046536 | Bacteria | 7870 |
| 456 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 457 | Ga0495609_0012187 | 3300046538 | Bacteria | 4079 |
| 458 | Ga0495597_0003657 | 3300046542 | Bacteria | 8829 |
| 459 | Ga0495597_0010571 | 3300046542 | Bacteria | 4503 |
| 460 | Ga0495597_0019847 | 3300046542 | Bacteria | 3138 |
| 461 | Ga0495597_0023658 | 3300046542 | Bacteria | 2841 |
| 462 | Ga0495645_0002111 | 3300046543 | Bacteria | 13489 |
| 463 | Ga0495645_0003064 | 3300046543 | Bacteria | 11325 |
| 464 | Ga0495645_0068255 | 3300046543 | Bacteria | 2567 |
| 465 | Ga0495622_0000009 | 3300046557 | Bacteria | 224622 |
| 466 | Ga0495622_0002816 | 3300046557 | Bacteria | 8295 |
| 467 | Ga0495622_0018809 | 3300046557 | Bacteria | 3217 |
| 468 | Ga0495622_0049124 | 3300046557 | Bacteria | 1959 |
| 469 | Ga0495622_0050181 | 3300046557 | Bacteria | 1937 |
| 470 | Ga0495633_0000024 | 3300046558 | Bacteria | 225077 |
| 471 | Ga0495633_0006180 | 3300046558 | Bacteria | 7157 |
| 472 | Ga0495633_0008899 | 3300046558 | Bacteria | 5599 |
| 473 | Ga0495633_0021964 | 3300046558 | Bacteria | 3184 |
| 474 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 475 | Ga0495668_0000027 | 3300046616 | Bacteria | 297194 |
| 476 | Ga0495668_0000867 | 3300046616 | Bacteria | 34095 |
| 477 | Ga0495668_0024662 | 3300046616 | Bacteria | 3420 |
| 478 | Ga0495668_0091976 | 3300046616 | Bacteria | 1662 |
| 479 | Ga0495634_0018589 | 3300046642 | Bacteria | 4944 |
| 480 | Ga0495625_0001646 | 3300046660 | Bacteria | 26230 |
| 481 | Ga0495625_0002007 | 3300046660 | Bacteria | 22954 |
| 482 | Ga0495625_0013036 | 3300046660 | Bacteria | 6700 |
| 483 | Ga0495625_0073669 | 3300046660 | Bacteria | 2393 |
| 484 | Ga0495635_0002102 | 3300046663 | Bacteria | 13519 |
| 485 | Ga0495635_0012611 | 3300046663 | Bacteria | 5928 |
| 486 | Ga0495635_0025814 | 3300046663 | Bacteria | 4091 |
| 487 | Ga0495635_0032176 | 3300046663 | Bacteria | 3639 |
| 488 | Ga0495635_0116980 | 3300046663 | Bacteria | 1819 |
| 489 | Ga0495659_0000141 | 3300046664 | Bacteria | 31709 |
| 490 | Ga0495661_0000206 | 3300046665 | Bacteria | 68072 |
| 491 | Ga0495661_0005113 | 3300046665 | Bacteria | 9351 |
| 492 | Ga0495661_0008052 | 3300046665 | Bacteria | 7317 |
| 493 | Ga0495661_0043523 | 3300046665 | Bacteria | 2759 |
| 494 | Ga0495588_0011090 | 3300046674 | Bacteria | 4219 |
| 495 | Ga0495588_0030376 | 3300046674 | Bacteria | 2716 |
| 496 | Ga0495588_0081085 | 3300046674 | Bacteria | 1693 |
| 497 | Ga0495657_0040197 | 3300046675 | Bacteria | 3210 |
| 498 | Ga0495599_0003052 | 3300046678 | Bacteria | 9743 |
| 499 | Ga0495599_0128463 | 3300046678 | Bacteria | 1574 |
| 500 | Ga0495623_0010370 | 3300046679 | Bacteria | 6031 |
| 501 | Ga0495623_0056971 | 3300046679 | Bacteria | 2459 |
| 502 | Ga0495646_0000213 | 3300046680 | Bacteria | 28857 |
| 503 | Ga0495646_0002043 | 3300046680 | Bacteria | 12237 |
| 504 | Ga0495646_0007788 | 3300046680 | Bacteria | 6801 |
| 505 | Ga0495646_0007923 | 3300046680 | Bacteria | 6748 |
| 506 | Ga0495669_0019141 | 3300046684 | Bacteria | 2953 |
| 507 | Ga0495613_0004229 | 3300046689 | Bacteria | 10754 |
| 508 | Ga0495613_0013833 | 3300046689 | Bacteria | 5985 |
| 509 | Ga0495624_0003163 | 3300046690 | Bacteria | 12265 |
| 510 | Ga0495624_0008738 | 3300046690 | Bacteria | 7051 |
| 511 | Ga0495624_0020031 | 3300046690 | Bacteria | 4456 |
| 512 | Ga0495624_0024188 | 3300046690 | Bacteria | 3998 |
| 513 | Ga0495624_0033834 | 3300046690 | Bacteria | 3309 |
| 514 | Ga0495624_0041126 | 3300046690 | Bacteria | 2958 |
| 515 | Ga0495670_0000681 | 3300046691 | Bacteria | 16145 |
| 516 | Ga0495670_0035989 | 3300046691 | Bacteria | 2466 |
| 517 | Ga0495670_0077610 | 3300046691 | Bacteria | 1688 |
| 518 | Ga0495671_0000445 | 3300046692 | Bacteria | 32757 |
| 519 | Ga0495671_0028010 | 3300046692 | Bacteria | 2905 |
| 520 | Ga0495671_0042749 | 3300046692 | Bacteria | 2276 |
| 521 | Ga0495649_0013822 | 3300046694 | Bacteria | 4644 |
| 522 | Ga0495649_0014976 | 3300046694 | Bacteria | 4429 |
| 523 | Ga0495649_0094379 | 3300046694 | Bacteria | 1592 |
| 524 | Ga0495589_0000152 | 3300046794 | Bacteria | 64153 |
| 525 | Ga0495589_0006169 | 3300046794 | Bacteria | 6328 |
| 526 | Ga0495600_0000916 | 3300046809 | Bacteria | 15803 |
| 527 | Ga0495600_0002306 | 3300046809 | Bacteria | 10891 |
| 528 | Ga0495600_0003144 | 3300046809 | Bacteria | 9662 |
| 529 | Ga0495660_0000489 | 3300046810 | Bacteria | 32927 |
| 530 | Ga0495660_0005661 | 3300046810 | Bacteria | 7470 |
| 531 | Ga0495660_0032031 | 3300046810 | Bacteria | 2954 |
| 532 | Ga0495660_0097178 | 3300046810 | Bacteria | 1521 |
| 533 | Ga0495581_0004887 | 3300047315 | Bacteria | 7751 |
| 534 | Ga0495581_0024918 | 3300047315 | Bacteria | 3466 |
| 535 | Ga0495581_0059305 | 3300047315 | Bacteria | 2211 |
| 536 | Ga0495581_0073396 | 3300047315 | Bacteria | 1980 |
| 537 | Ga0495604_0009621 | 3300047317 | Bacteria | 7645 |
| 538 | Ga0495604_0012193 | 3300047317 | Bacteria | 6832 |
| 539 | Ga0495604_0023802 | 3300047317 | Bacteria | 4887 |
| 540 | Ga0495604_0099230 | 3300047317 | Bacteria | 2143 |
| 541 | Ga0495636_0000678 | 3300047318 | Bacteria | 12474 |
| 542 | Ga0495636_0082287 | 3300047318 | Bacteria | 1388 |
| 543 | Ga0495674_0021507 | 3300047319 | Bacteria | 5966 |
| 544 | Ga0495674_0028599 | 3300047319 | Bacteria | 5080 |
| 545 | Ga0495674_0061179 | 3300047319 | Bacteria | 3283 |
| 546 | Ga0495674_0152137 | 3300047319 | Bacteria | 1939 |
| 547 | Ga0495674_0203066 | 3300047319 | Bacteria | 1643 |
| 548 | Ga0495674_0210481 | 3300047319 | Bacteria | 1611 |
| 549 | Ga0495672_0000219 | 3300047320 | Bacteria | 81635 |
| 550 | Ga0495672_0000555 | 3300047320 | Bacteria | 42449 |
| 551 | Ga0495672_0002308 | 3300047320 | Bacteria | 17690 |
| 552 | Ga0495672_0002954 | 3300047320 | Bacteria | 14972 |
| 553 | Ga0495672_0009592 | 3300047320 | Bacteria | 6993 |
| 554 | Ga0495672_0021711 | 3300047320 | Bacteria | 4184 |
| 555 | Ga0495676_0003912 | 3300047321 | Bacteria | 13544 |
| 556 | Ga0495676_0136018 | 3300047321 | Bacteria | 1767 |
| 557 | Ga0495680_0003015 | 3300047322 | Bacteria | 16791 |
| 558 | Ga0495680_0016067 | 3300047322 | Bacteria | 6435 |
| 559 | Ga0495680_0027379 | 3300047322 | Bacteria | 4685 |
| 560 | Ga0495680_0035810 | 3300047322 | Bacteria | 3992 |
| 561 | Ga0495680_0101153 | 3300047322 | Bacteria | 2147 |
| 562 | Ga0495680_0119799 | 3300047322 | Bacteria | 1944 |
| 563 | Ga0495683_0001515 | 3300047323 | Bacteria | 15041 |
| 564 | Ga0495683_0001954 | 3300047323 | Bacteria | 12864 |
| 565 | Ga0495683_0014791 | 3300047323 | Bacteria | 4063 |
| 566 | Ga0495683_0031141 | 3300047323 | Bacteria | 2718 |
| 567 | Ga0495687_000027 | 3300047443 | Bacteria | 299689 |
| 568 | Ga0495687_000191 | 3300047443 | Bacteria | 88251 |
| 569 | Ga0495687_001030 | 3300047443 | Bacteria | 27749 |
| 570 | Ga0495687_026592 | 3300047443 | Bacteria | 2721 |
| 571 | Ga0495675_0001420 | 3300047444 | Bacteria | 14509 |
| 572 | Ga0495675_0021696 | 3300047444 | Bacteria | 4091 |
| 573 | Ga0495675_0026601 | 3300047444 | Bacteria | 3689 |
| 574 | Ga0495675_0085348 | 3300047444 | Bacteria | 1985 |
| 575 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 576 | Ga0495677_0009511 | 3300047445 | Bacteria | 3588 |
| 577 | Ga0495679_000435 | 3300047446 | Bacteria | 30858 |
| 578 | Ga0495679_001128 | 3300047446 | Bacteria | 16049 |
| 579 | Ga0495679_003610 | 3300047446 | Bacteria | 7387 |
| 580 | Ga0495685_000033 | 3300047447 | Bacteria | 57157 |
| 581 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 582 | Ga0495673_0000059 | 3300047469 | Bacteria | 233234 |
| 583 | Ga0495673_0000067 | 3300047469 | Bacteria | 219908 |
| 584 | Ga0495673_0004154 | 3300047469 | Bacteria | 9160 |
| 585 | Ga0495686_0000032 | 3300047472 | Bacteria | 345132 |
| 586 | Ga0495686_0000222 | 3300047472 | Bacteria | 104411 |
| 587 | Ga0495686_0000231 | 3300047472 | Bacteria | 102239 |
| 588 | Ga0495686_0000526 | 3300047472 | Bacteria | 55119 |
| 589 | Ga0495686_0016623 | 3300047472 | Bacteria | 4984 |
| 590 | Ga0495686_0050047 | 3300047472 | Bacteria | 2626 |
| 591 | Ga0495686_0070711 | 3300047472 | Bacteria | 2150 |
| 592 | Ga0495593_0008778 | 3300047673 | Bacteria | 5868 |
| 593 | Ga0495593_0009853 | 3300047673 | Bacteria | 5544 |
| 594 | Ga0495593_0028707 | 3300047673 | Bacteria | 3054 |
| 595 | Ga0495593_0033969 | 3300047673 | Bacteria | 2775 |
| 596 | Ga0495602_0006708 | 3300048088 | Bacteria | 12072 |
| 597 | Ga0495602_0008763 | 3300048088 | Bacteria | 10559 |
| 598 | Ga0495602_0028223 | 3300048088 | Bacteria | 5374 |
| 599 | Ga0495602_0049579 | 3300048088 | Bacteria | 3759 |
| 600 | Ga0495602_0128852 | 3300048088 | Bacteria | 2021 |
| 601 | Ga0495614_0000073 | 3300048089 | Bacteria | 32790 |
| 602 | Ga0495614_0008284 | 3300048089 | Bacteria | 4628 |
| 603 | Ga0495626_0001295 | 3300048091 | Bacteria | 20411 |
| 604 | Ga0495626_0051135 | 3300048091 | Bacteria | 1907 |
| 605 | Ga0495626_0052589 | 3300048091 | Bacteria | 1877 |
| 606 | Ga0496100_0001401 | 3300048903 | Bacteria | 11809 |
| 607 | Ga0496100_0002872 | 3300048903 | Bacteria | 8831 |
| 608 | Ga0496101_0001384 | 3300048904 | Bacteria | 14534 |
| 609 | Ga0496101_0005450 | 3300048904 | Bacteria | 8111 |
| 610 | Ga0496101_0093505 | 3300048904 | Bacteria | 2240 |
| 611 | Ga0496102_0000101 | 3300048905 | Bacteria | 123198 |
| 612 | Ga0496102_0000982 | 3300048905 | Bacteria | 26824 |
| 613 | Ga0496102_0009879 | 3300048905 | Bacteria | 8205 |
| 614 | Ga0496102_0009985 | 3300048905 | Bacteria | 8160 |
| 615 | Ga0496102_0107099 | 3300048905 | Bacteria | 2602 |
| 616 | Ga0496103_0000750 | 3300048906 | Bacteria | 23913 |
| 617 | Ga0496103_0006830 | 3300048906 | Bacteria | 6811 |
| 618 | Ga0496104_0044663 | 3300048907 | Bacteria | 4163 |
| 619 | Ga0496104_0095818 | 3300048907 | Bacteria | 2839 |
| 620 | Ga0496105_0022013 | 3300048908 | Bacteria | 5161 |
| 621 | Ga0496106_0000389 | 3300048909 | Bacteria | 31317 |
| 622 | Ga0496106_0209604 | 3300048909 | Bacteria | 1552 |
| 623 | Ga0496106_0223756 | 3300048909 | Bacteria | 1501 |
| 624 | Ga0496107_0021013 | 3300048910 | Bacteria | 4613 |
| 625 | Ga0496108_0003010 | 3300048911 | Bacteria | 13546 |
| 626 | Ga0496108_0093360 | 3300048911 | Bacteria | 2560 |
| 627 | Ga0496109_0197940 | 3300048912 | Bacteria | 1889 |
| 628 | Ga0496111_0036406 | 3300048914 | Bacteria | 3518 |
| 629 | Ga0496111_0213448 | 3300048914 | Bacteria | 1433 |
| 630 | Ga0496112_0014941 | 3300048915 | Bacteria | 7226 |
| 631 | Ga0496113_0017568 | 3300048916 | Bacteria | 4968 |
| 632 | Ga0496113_0194263 | 3300048916 | Bacteria | 1612 |
| 633 | Ga0496115_0074067 | 3300048918 | Bacteria | 2764 |
| 634 | Ga0496116_0015758 | 3300048919 | Bacteria | 5957 |
| 635 | Ga0496117_0004045 | 3300048920 | Bacteria | 16486 |
| 636 | Ga0496117_0006262 | 3300048920 | Bacteria | 12129 |
| 637 | Ga0496117_0007374 | 3300048920 | Bacteria | 10766 |
| 638 | Ga0496117_0024228 | 3300048920 | Bacteria | 4807 |
| 639 | Ga0496117_0043033 | 3300048920 | Bacteria | 3289 |
| 640 | Ga0496117_0060677 | 3300048920 | Bacteria | 2604 |
| 641 | Ga0496118_0001803 | 3300048921 | Bacteria | 30867 |
| 642 | Ga0496118_0002003 | 3300048921 | Bacteria | 28852 |
| 643 | Ga0496118_0003491 | 3300048921 | Bacteria | 19721 |
| 644 | Ga0496118_0005794 | 3300048921 | Bacteria | 13863 |
| 645 | Ga0496118_0006944 | 3300048921 | Bacteria | 12238 |
| 646 | Ga0496118_0015115 | 3300048921 | Bacteria | 7169 |
| 647 | Ga0496118_0026844 | 3300048921 | Bacteria | 4892 |
| 648 | Ga0496120_0135564 | 3300048923 | Bacteria | 1256 |
| 649 | Ga0496121_0001722 | 3300048924 | Bacteria | 35754 |
| 650 | Ga0496121_0001723 | 3300048924 | Bacteria | 35719 |
| 651 | Ga0496121_0014969 | 3300048924 | Bacteria | 8170 |
| 652 | Ga0496121_0024288 | 3300048924 | Bacteria | 5803 |
| 653 | Ga0496121_0028218 | 3300048924 | Bacteria | 5230 |
| 654 | Ga0496121_0037471 | 3300048924 | Bacteria | 4306 |
| 655 | Ga0496122_0001320 | 3300048925 | Bacteria | 40653 |
| 656 | Ga0496122_0029202 | 3300048925 | Bacteria | 4657 |
| 657 | Ga0496122_0058149 | 3300048925 | Bacteria | 2865 |
| 658 | Ga0496123_0005048 | 3300048926 | Bacteria | 13502 |
| 659 | Ga0496123_0006703 | 3300048926 | Bacteria | 11092 |
| 660 | Ga0496123_0014258 | 3300048926 | Bacteria | 6603 |
| 661 | Ga0496124_0027051 | 3300048927 | Bacteria | 5159 |
| 662 | Ga0496124_0029090 | 3300048927 | Bacteria | 4929 |
| 663 | Ga0496124_0083882 | 3300048927 | Bacteria | 2614 |
| 664 | Ga0496125_0034948 | 3300048928 | Bacteria | 4421 |
| 665 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 666 | Ga0496126_0001702 | 3300048929 | Bacteria | 32663 |
| 667 | Ga0496126_0005654 | 3300048929 | Bacteria | 14205 |
| 668 | Ga0496126_0019086 | 3300048929 | Bacteria | 6763 |
| 669 | Ga0496126_0027494 | 3300048929 | Bacteria | 5432 |
| 670 | Ga0495678_000071 | 3300049459 | Bacteria | 128709 |
| 671 | Ga0495678_001563 | 3300049459 | Bacteria | 17582 |
| 672 | Ga0495682_0001515 | 3300049460 | Bacteria | 12332 |
| 673 | Ga0501031_0020072 | 3300049568 | Bacteria | 4356 |
| 674 | Ga0501034_0151543 | 3300049571 | Bacteria | 2294 |
| 675 | Ga0501038_0024604 | 3300049574 | Bacteria | 5370 |
| 676 | Ga0501040_0003327 | 3300049576 | Bacteria | 10391 |
| 677 | Ga0501041_0016641 | 3300049577 | Bacteria | 4376 |
| 678 | Ga0501042_0000428 | 3300049578 | Bacteria | 21385 |
| 679 | Ga0501043_0000010 | 3300049579 | Bacteria | 206374 |
| 680 | Ga0501046_0000097 | 3300049580 | Bacteria | 93650 |
| 681 | Ga0501047_0000026 | 3300049581 | Bacteria | 225296 |
| 682 | Ga0501048_0003251 | 3300049582 | Bacteria | 12384 |
| 683 | Ga0501048_0109283 | 3300049582 | Bacteria | 1952 |
| 684 | Ga0501076_0087034 | 3300049592 | Bacteria | 2511 |
| 685 | Ga0501249_004148 | 3300049679 | Bacteria | 2934 |
| 686 | Ga0501234_006175 | 3300049707 | Bacteria | 1876 |
| 687 | Ga0501269_000134 | 3300049766 | Bacteria | 23123 |
| 688 | Ga0501279_001353 | 3300049775 | Bacteria | 3213 |
| 689 | Ga0501045_0003305 | 3300049824 | Bacteria | 11020 |
| 690 | Ga0501045_0011172 | 3300049824 | Bacteria | 6295 |
| 691 | Ga0495601_0001280 | 3300053077 | Bacteria | 13791 |
| 692 | Ga0500595_002958 | 3300053119 | Bacteria | 8092 |
| 693 | Ga0500618_000187 | 3300053125 | Bacteria | 50730 |
| 694 | Ga0500618_002400 | 3300053125 | Bacteria | 7130 |
| 695 | Ga0500618_015507 | 3300053125 | Bacteria | 1925 |
| 696 | Ga0500586_000139 | 3300053145 | Bacteria | 13174 |
| 697 | Ga0500586_021842 | 3300053145 | Bacteria | 2024 |
| 698 | Ga0500619_000189 | 3300053154 | Bacteria | 14544 |
| 699 | Ga0501084_0002414 | 3300054114 | Bacteria | 15026 |
| 700 | Ga0466962_0004561 | 3300061719 | Bacteria | 6648 |
| 701 | Ga0466962_0004689 | 3300061719 | Bacteria | 6567 |
| 702 | Ga0466962_0011403 | 3300061719 | Bacteria | 4280 |
| 703 | 2501075742 | 2501025501 | Bacteria | 7768574 |
| 704 | 2501076875 | 2501025502 | Bacteria | 9641094 |
| 705 | 2501411348 | 2501025504 | Bacteria | 8008976 |
| 706 | 2509130330 | 2508501125 | Bacteria | 7208311 |
| 707 | 2510250526 | 2510065045 | Bacteria | 7761063 |
| 708 | 2511088949 | 2510917013 | Bacteria | 9951648 |
| 709 | 2511100010 | 2510917014 | Bacteria | 8296963 |
| 710 | 2511103981 | 2510917015 | Bacteria | 7950052 |
| 711 | 2512348055 | 2512047030 | Bacteria | 9031815 |
| 712 | 2513552618 | 2513237082 | Bacteria | 8640282 |
| 713 | 2513565203 | 2513237083 | Bacteria | 8410967 |
| 714 | 2513963263 | 2513237151 | Bacteria | 6309801 |
| 715 | 2514053076 | 2513237166 | Bacteria | 10373764 |
| 716 | 2515678922 | 2515154122 | Bacteria | 8609520 |
| 717 | 2515688765 | 2515154123 | Bacteria | 6387382 |
| 718 | 2516021199 | 2515154189 | Bacteria | 9629850 |
| 719 | 2519459293 | 2519103095 | Bacteria | 6629912 |
| 720 | 2527077184 | 2526164713 | Bacteria | 6780608 |
| 721 | 2548497428 | 2547132374 | Bacteria | 5530232 |
| 722 | 2563062567 | 2562617112 | Bacteria | 10918404 |
| 723 | 2585294313 | 2582581311 | Bacteria | 6763856 |
| 724 | 2599738339 | 2599185239 | Bacteria | 8686614 |
| 725 | 2599746461 | 2599185240 | Bacteria | 7968121 |
| 726 | 2600208367 | 2599185355 | Bacteria | 7968906 |
| 727 | 2600813084 | 2600255067 | Bacteria | 6795583 |
| 728 | 2643792262 | 2643221554 | Bacteria | 6603920 |
| 729 | 2643866537 | 2643221570 | Bacteria | 5103772 |
| 730 | 2644212247 | 2643221638 | Bacteria | 6579467 |
| 731 | 2644294106 | 2643221652 | Bacteria | 5140275 |
| 732 | 2644354724 | 2643221664 | Bacteria | 7272945 |
| 733 | 2644646109 | 2643221717 | Bacteria | 5676132 |
| 734 | 2676745327 | 2675903129 | Bacteria | 7964495 |
| 735 | 2713477574 | 2711768613 | Bacteria | 11048459 |
| 736 | 2719639674 | 2718217991 | Bacteria | 7829542 |
| 737 | 2723877081 | 2721755763 | Bacteria | 4464185 |
| 738 | 2738739815 | 2738541280 | Bacteria | 6630198 |
| 739 | 2738823235 | 2738541296 | Bacteria | 7285013 |
| 740 | 2738828011 | 2738541297 | Bacteria | 6549566 |
| 741 | 2738835663 | 2738541298 | Bacteria | 7286732 |
| 742 | 2738842333 | 2738541300 | Bacteria | 6675882 |
| 743 | 2738877156 | 2738541306 | Bacteria | 7284992 |
| 744 | 2739151807 | 2738541357 | Bacteria | 6549408 |
| 745 | 2739188862 | 2738543002 | Bacteria | 7284546 |
| 746 | 2739194172 | 2738543003 | Bacteria | 6549560 |
| 747 | 2739223749 | 2738543008 | Bacteria | 7282815 |
| 748 | 2739274034 | 2738543018 | Bacteria | 6718814 |
| 749 | 2739320203 | 2738543026 | Bacteria | 6549408 |
| 750 | 2739338889 | 2738543029 | Bacteria | 6549249 |
| 751 | 2739343078 | 2738543030 | Bacteria | 6719714 |
| 752 | 2746091760 | 2744054900 | Bacteria | 8399525 |
| 753 | 2746097134 | 2744054901 | Bacteria | 8397047 |
| 754 | 2753568083 | 2751185846 | Bacteria | 7242164 |
| 755 | 2792833717 | 2791355137 | Bacteria | 9654227 |
| 756 | 2808971997 | 2808606384 | Bacteria | 8474373 |
| 757 | 2809006826 | 2808606390 | Bacteria | 8476311 |
| 758 | 2809013964 | 2808606391 | Bacteria | 8308166 |
| 759 | 2817261580 | 2816332253 | Bacteria | 6764532 |
| 760 | 2817279262 | 2816332256 | Bacteria | 6891714 |
| 761 | 2817454539 | 2816332286 | Bacteria | 6853759 |
| 762 | 2819540649 | 2818991436 | Bacteria | 5376622 |
| 763 | 2819622306 | 2818991450 | Bacteria | 6962147 |
| 764 | 2819633534 | 2818991452 | Bacteria | 8442785 |
| 765 | 2842329959 | 2842324504 | Bacteria | 9364110 |
| 766 | 2842356197 | 2842348783 | Bacteria | 9002918 |
| 767 | 2842457521 | 2842454564 | Bacteria | 8730687 |
| 768 | 2856294065 | 2856287931 | Bacteria | 7223934 |
| 769 | 2857362498 | 2857357740 | Bacteria | 9937880 |
| 770 | 2857560034 | 2857558681 | Bacteria | 6617694 |
| 771 | 2857566772 | 2857564685 | Bacteria | 6290584 |
| 772 | 2857578216 | 2857576091 | Bacteria | 5465855 |
| 773 | 2863425709 | 2863421361 | Bacteria | 7300805 |
| 774 | 2870070719 | 2870068957 | Bacteria | 8925310 |
| 775 | 2881102180 | 2881101125 | Bacteria | 4590519 |
| 776 | 2883094131 | 2883087390 | Bacteria | 9532701 |
| 777 | 2885273218 | 2885270888 | Bacteria | 9831543 |
| 778 | 2900635602 | 2900634093 | Bacteria | 10263517 |
| 779 | 2902688655 | 2902682994 | Bacteria | 8951596 |
| 780 | 2904426793 | 2904424332 | Bacteria | 7633521 |
| 781 | 2904435718 | 2904434214 | Bacteria | 6230908 |
| 782 | 2904487139 | 2904483920 | Bacteria | 7545285 |
| 783 | 2904569914 | 2904564687 | Bacteria | 7609577 |
| 784 | 2904577066 | 2904571731 | Bacteria | 7608790 |
| 785 | 2904619781 | 2904615490 | Bacteria | 10047340 |
| 786 | 2919528445 | 2919527303 | Bacteria | 7718827 |
| 787 | 2921653208 | 2921643360 | Bacteria | 11448031 |
| 788 | 2928113065 | 2928108538 | Bacteria | 7360024 |
| 789 | 2928140224 | 2928135762 | Bacteria | 7259641 |
| 790 | 2928161653 | 2928157003 | Bacteria | 7522202 |
| 791 | 2928168481 | 2928163908 | Bacteria | 7561269 |
| 792 | 2928174792 | 2928170801 | Bacteria | 8785406 |
| 793 | 2928507783 | 2928503688 | Bacteria | 7268108 |
| 794 | 2928542484 | 2928536128 | Bacteria | 7657547 |
| 795 | 2932425895 | 2932422444 | Bacteria | 4678430 |
| 796 | 2939636463 | 2939631187 | Bacteria | 6118131 |
| 797 | 2945936164 | 2945934425 | Bacteria | 7444609 |
| 798 | 2981993641 | 2981990288 | Bacteria | 7590678 |
| 799 | 2990709934 | 2990703756 | Bacteria | 7715990 |
| 800 | 642427200 | 641736151 | Bacteria | 7477263 |
| 801 | 642415158 | 641736154 | Bacteria | 7689995 |
| 802 | 642593774 | 642555112 | Bacteria | 8676562 |
| 803 | 642620933 | 642555113 | Bacteria | 8214658 |
| 804 | 8003961447 | 8003955200 | Bacteria | 8601927 |
| 805 | 8018850903 | 8018845410 | Bacteria | 8933938 |
| 806 | 8020810083 | 8020807995 | Bacteria | 6801506 |
| 807 | 8020940968 | 8020938398 | Bacteria | 7472757 |
| 808 | 8020952329 | 8020945358 | Bacteria | 8467355 |
| 809 | 8020958418 | 8020953355 | Bacteria | 7439080 |
| 810 | 8021125175 | 8021120328 | Bacteria | 8782274 |
| 811 | 8039103476 | 8039098773 | Bacteria | 6602928 |
| 812 | 8040170323 | 8040167225 | Bacteria | 6542727 |
| 813 | 8040175881 | 8040173305 | Bacteria | 6827067 |
| 814 | 8055271339 | 8055266321 | Bacteria | 7999742 |
| 815 | 8055306044 | 8055301274 | Bacteria | 8587385 |
| 816 | JGI25162J39368_1000001 | |||
| 817 | JGI24740J21852_10008374 | |||
| 818 | JGI24739J22299_10002136 | |||
| 819 | JGI24739J22299_10019359 | |||
| 820 | JGI24735J21928_10000244 | |||
| 821 | JGI24735J21928_10001284 | |||
| 822 | JGI24735J21928_10016996 | |||
| 823 | JGI25156J39149_1000669 | |||
| 824 | JGI25154J39366_1000678 | |||
| 825 | JGI25152J39213_1000005 | |||
| 826 | JGI25150J39212_1000071 | |||
| 827 | JGI25159J45721_1001569 | |||
| 828 | JGI25159J45721_1007241 | |||
| 829 | JGI25151J46595_10051495 | |||
| 830 | JGI25165J46597_1000001 | |||
| 831 | JGI25165J46597_1001219 | |||
| 832 | JGI25153J46596_10005435 | |||
| 833 | rootL2_10007264 | |||
| 834 | rootL2_10008705 | |||
| 835 | rootL2_10026973 | |||
| 836 | rootL2_10028055 | |||
| 837 | rootL2_10050715 | |||
| 838 | rootL2_10053525 | |||
| 839 | JGI25160J50197_1000870 | |||
| 840 | JGI25160J50197_1007831 | |||
| 841 | JGI25161J50226_1000581 | |||
| 842 | JGI25161J50226_1002931 | |||
| 843 | Ga0055538_1000001 | |||
| 844 | Ga0055539_1000001 | |||
| 845 | Ga0055533_1000003 | |||
| 846 | Ga0055533_1000271 | |||
| 847 | Ga0055533_1001132 | |||
| 848 | Ga0055532_1000063 | |||
| 849 | Ga0055532_1000635 | |||
| 850 | Ga0055532_1001446 | |||
| 851 | Ga0055532_1001456 | |||
| 852 | Ga0055525_1000003 | |||
| 853 | Ga0055527_1000049 | |||
| 854 | Ga0055527_1000477 | |||
| 855 | Ga0055527_1002732 | |||
| 856 | Ga0055535_1000042 | |||
| 857 | Ga0055535_1001183 | |||
| 858 | Ga0055535_1001193 | |||
| 859 | Ga0055542_1000071 | |||
| 860 | Ga0055542_1001169 | |||
| 861 | Ga0055529_1000081 | |||
| 862 | Ga0055529_1000128 | |||
| 863 | Ga0055529_1000780 | |||
| 864 | Ga0055526_1000013 | |||
| 865 | Ga0055526_1001685 | |||
| 866 | Ga0055537_1005497 | |||
| 867 | Ga0055524_1000224 | |||
| 868 | Ga0055524_1001696 | |||
| 869 | Ga0055524_1005207 | |||
| 870 | Ga0055534_1001332 | |||
| 871 | Ga0055528_1001644 | |||
| 872 | Ga0055528_1006195 | |||
| 873 | Ga0055530_10000552 | |||
| 874 | Ga0055530_10003433 | |||
| 875 | Ga0055531_10002900 | |||
| 876 | Ga0055531_10021167 | |||
| 877 | Ga0055541_1000001 | |||
| 878 | Ga0058692_1003994 | |||
| 879 | Ga0055543_1001685 | |||
| 880 | Ga0065165_1000559 | |||
| 881 | Ga0065165_1002395 | |||
| 882 | Ga0070658_10012862 | |||
| 883 | Ga0070658_10022666 | |||
| 884 | Ga0070658_10037577 | |||
| 885 | Ga0070658_10101236 | |||
| 886 | Ga0070683_100003543 | |||
| 887 | Ga0070670_100000714 | |||
| 888 | Ga0070677_10004146 | |||
| 889 | Ga0068868_100012422 | |||
| 890 | Ga0070660_100001483 | |||
| 891 | Ga0070660_100002336 | |||
| 892 | Ga0070660_100002371 | |||
| 893 | Ga0070660_100157255 | |||
| 894 | Ga0070661_100008886 | |||
| 895 | Ga0070661_100015613 | |||
| 896 | Ga0070661_100080763 | |||
| 897 | Ga0070675_100000465 | |||
| 898 | Ga0070671_100001721 | |||
| 899 | Ga0070674_100057027 | |||
| 900 | Ga0070673_100003268 | |||
| 901 | Ga0070659_100000069 | |||
| 902 | Ga0070667_100064290 | |||
| 903 | Ga0070663_100000696 | |||
| 904 | Ga0070663_100002505 | |||
| 905 | Ga0070663_100120149 | |||
| 906 | Ga0068867_100011101 | |||
| 907 | Ga0070684_100012350 | |||
| 908 | Ga0070672_100000119 | |||
| 909 | Ga0068855_100004770 | |||
| 910 | Ga0068855_100036153 | |||
| 911 | Ga0070664_100002152 | |||
| 912 | Ga0070664_100028976 | |||
| 913 | Ga0068857_100287263 | |||
| 914 | Ga0068854_100002231 | |||
| 915 | Ga0068852_100005925 | |||
| 916 | Ga0068852_100027502 | |||
| 917 | Ga0068866_10017030 | |||
| 918 | Ga0068851_10011665 | |||
| 919 | Ga0068863_100063738 | |||
| 920 | Ga0097621_100007013 | |||
| 921 | Ga0068871_100011374 | |||
| 922 | Ga0105251_10000250 | |||
| 923 | Ga0105251_10001135 | |||
| 924 | Ga0105244_10011494 | |||
| 925 | Ga0105240_10008362 | |||
| 926 | Ga0105240_10012664 | |||
| 927 | Ga0105240_10046886 | |||
| 928 | Ga0105240_10126548 | |||
| 929 | Ga0105243_10010354 | |||
| 930 | Ga0105248_10013799 | |||
| 931 | Ga0105248_10097666 | |||
| 932 | Ga0105237_10028648 | |||
| 933 | Ga0105237_10033084 | |||
| 934 | Ga0105238_10001371 | |||
| 935 | Ga0105238_10041926 | |||
| 936 | Ga0105238_10136887 | |||
| 937 | Ga0105239_10005995 | |||
| 938 | Ga0105239_10037464 | |||
| 939 | Ga0105239_10088612 | |||
| 940 | Ga0157373_10024520 | |||
| 941 | Ga0157370_10011220 | |||
| 942 | Ga0157370_10060740 | |||
| 943 | Ga0157370_10141112 | |||
| 944 | Ga0157369_10002854 | |||
| 945 | Ga0157369_10003118 | |||
| 946 | Ga0157369_10006997 | |||
| 947 | Ga0157369_10010440 | |||
| 948 | Ga0157369_10013968 | |||
| 949 | Ga0157374_10000428 | |||
| 950 | Ga0157374_10024145 | |||
| 951 | Ga0157374_10293354 | |||
| 952 | Ga0157372_10016699 | |||
| 953 | Ga0157372_10345429 | |||
| 954 | Ga0157375_10000644 | |||
| 955 | Ga0157375_10354230 | |||
| 956 | Ga0182008_10017166 | |||
| 957 | Ga0157377_10000055 | |||
| 958 | Ga0157376_10006100 | |||
| 959 | Ga0182006_1012234 | |||
| 960 | Ga0182007_10000032 | |||
| 961 | Ga0182007_10000557 | |||
| 962 | Ga0182007_10006335 | |||
| 963 | Ga0182005_1000996 | |||
| 964 | Ga0183361_10010 | |||
| 965 | Ga0163161_10000153 | |||
| 966 | Ga0213872_10000019 | |||
| 967 | Ga0224712_10000046 | |||
| 968 | Ga0209760_102499 | |||
| 969 | Ga0209436_100358 | |||
| 970 | Ga0209436_101573 | |||
| 971 | Ga0209784_100004 | |||
| 972 | Ga0209566_100004 | |||
| 973 | Ga0209674_100006 | |||
| 974 | Ga0209674_100294 | |||
| 975 | Ga0209674_100316 | |||
| 976 | Ga0209672_100010 | |||
| 977 | Ga0209672_100033 | |||
| 978 | Ga0209672_100114 | |||
| 979 | Ga0209672_100867 | |||
| 980 | Ga0209147_100006 | |||
| 981 | Ga0209147_100161 | |||
| 982 | Ga0209147_100390 | |||
| 983 | Ga0209147_100971 | |||
| 984 | Ga0209563_100009 | |||
| 985 | Ga0209563_100715 | |||
| 986 | Ga0207427_100293 | |||
| 987 | Ga0207427_101889 | |||
| 988 | Ga0209437_100004 | |||
| 989 | Ga0209258_100010 | |||
| 990 | Ga0209258_100100 | |||
| 991 | Ga0209258_100263 | |||
| 992 | Ga0207425_1000001 | |||
| 993 | Ga0207425_1000056 | |||
| 994 | Ga0207425_1000178 | |||
| 995 | Ga0209646_1000007 | |||
| 996 | Ga0209677_100005 | |||
| 997 | Ga0209148_1000018 | |||
| 998 | Ga0209148_1000432 | |||
| 999 | Ga0209148_1001019 | |||
| 1000 | Ga0209759_1000402 | |||
| 1001 | Ga0209759_1000403 | |||
| 1002 | Ga0209759_1000749 | |||
| 1003 | Ga0209759_1015281 | |||
| 1004 | Ga0209129_1000003 | |||
| 1005 | Ga0209129_1004265 | |||
| 1006 | Ga0209233_1000005 | |||
| 1007 | Ga0209233_1000171 | |||
| 1008 | Ga0209565_1000900 | |||
| 1009 | Ga0209565_1001280 | |||
| 1010 | Ga0209565_1001370 | |||
| 1011 | Ga0209455_1000015 | |||
| 1012 | Ga0209455_1000026 | |||
| 1013 | Ga0209455_1000192 | |||
| 1014 | Ga0209673_1000332 | |||
| 1015 | Ga0209130_1002057 | |||
| 1016 | Ga0209130_1002724 | |||
| 1017 | Ga0209130_1008718 | |||
| 1018 | Ga0209130_1008763 | |||
| 1019 | Ga0209675_1003751 | |||
| 1020 | Ga0209675_1020010 | |||
| 1021 | Ga0209025_1004504 | |||
| 1022 | Ga0209564_1000002 | |||
| 1023 | Ga0209564_1000272 | |||
| 1024 | Ga0209564_1002232 | |||
| 1025 | Ga0209564_1002542 | |||
| 1026 | Ga0209564_1003866 | |||
| 1027 | Ga0209564_1007040 | |||
| 1028 | Ga0209758_1000041 | |||
| 1029 | Ga0209758_1003222 | |||
| 1030 | Ga0209050_1000011 | |||
| 1031 | Ga0209050_1000089 | |||
| 1032 | Ga0209050_1000392 | |||
| 1033 | Ga0209050_1000470 | |||
| 1034 | Ga0209256_1000068 | |||
| 1035 | Ga0209256_1001080 | |||
| 1036 | Ga0209256_1005590 | |||
| 1037 | Ga0209256_1006044 | |||
| 1038 | Ga0207426_1000590 | |||
| 1039 | Ga0207426_1001589 | |||
| 1040 | Ga0207426_1006052 | |||
| 1041 | Ga0209257_1000003 | |||
| 1042 | Ga0209257_1009608 | |||
| 1043 | Ga0207713_1000295 | |||
| 1044 | Ga0207713_1004921 | |||
| 1045 | Ga0207682_10006551 | |||
| 1046 | Ga0207642_10027835 | |||
| 1047 | Ga0207647_10000873 | |||
| 1048 | Ga0207647_10007060 | |||
| 1049 | Ga0207647_10023624 | |||
| 1050 | Ga0207647_10032109 | |||
| 1051 | Ga0207645_10041081 | |||
| 1052 | Ga0207705_10006147 | |||
| 1053 | Ga0207705_10022872 | |||
| 1054 | Ga0207705_10030495 | |||
| 1055 | Ga0207695_10006076 | |||
| 1056 | Ga0207695_10010079 | |||
| 1057 | Ga0207695_10020742 | |||
| 1058 | Ga0207695_10022418 | |||
| 1059 | Ga0207695_10279683 | |||
| 1060 | Ga0207657_10000068 | |||
| 1061 | Ga0207657_10002652 | |||
| 1062 | Ga0207649_10005421 | |||
| 1063 | Ga0207649_10017509 | |||
| 1064 | Ga0207649_10093231 | |||
| 1065 | Ga0207694_10001679 | |||
| 1066 | Ga0207694_10005655 | |||
| 1067 | Ga0207650_10007111 | |||
| 1068 | Ga0207659_10034247 | |||
| 1069 | Ga0207644_10004860 | |||
| 1070 | Ga0207690_10000027 | |||
| 1071 | Ga0207691_10001019 | |||
| 1072 | Ga0207711_10034875 | |||
| 1073 | Ga0207711_10041815 | |||
| 1074 | Ga0207661_10000776 | |||
| 1075 | Ga0207679_10001299 | |||
| 1076 | Ga0207679_10005708 | |||
| 1077 | Ga0207667_10013730 | |||
| 1078 | Ga0207667_10014270 | |||
| 1079 | Ga0207667_10058307 | |||
| 1080 | Ga0207651_10012089 | |||
| 1081 | Ga0207640_10027640 | |||
| 1082 | Ga0207640_10040511 | |||
| 1083 | Ga0207658_10044922 | |||
| 1084 | Ga0207677_10004786 | |||
| 1085 | Ga0207678_10007309 | |||
| 1086 | Ga0207678_10007657 | |||
| 1087 | Ga0207678_10236112 | |||
| 1088 | Ga0207641_10014106 | |||
| 1089 | Ga0207648_10002780 | |||
| 1090 | Ga0207648_10009324 | |||
| 1091 | Ga0207698_10017470 | |||
| 1092 | Ga0207698_10069109 | |||
| 1093 | Ga0209371_1000448 | |||
| 1094 | Ga0209974_10002343 | |||
| 1095 | Ga0265338_10000557 | |||
| 1096 | Ga0265338_10000657 | |||
| 1097 | Ga0268256_1000823 | |||
| 1098 | Ga0316181_1103375 | |||
| 1099 | Ga0307408_100000903 | |||
| 1100 | Ga0307408_100032710 | |||
| 1101 | Ga0316575_10000958 | |||
| 1102 | Ga0316579_10069219 | |||
| 1103 | Ga0316576_10001695 | |||
| 1104 | Ga0316578_10011975 | |||
| 1105 | Ga0316577_10010576 | |||
| 1106 | Ga0307412_10000005 | |||
| 1107 | Ga0316583_10001248 | |||
| 1108 | Ga0316585_10036894 | |||
| 1109 | Ga0316574_0000111 | |||
| 1110 | Ga0316582_0000515 | |||
| 1111 | Ga0316584_0000005 | |||
| 1112 | Ga0316584_0017187 | |||
| 1113 | Ga0395899_0000038 | |||
| 1114 | Ga0395899_0001610 | |||
| 1115 | Ga0395899_0005100 | |||
| 1116 | Ga0395900_0000030 | |||
| 1117 | Ga0395900_0002665 | |||
| 1118 | Ga0395900_0021117 | |||
| 1119 | Ga0395898_0003193 | |||
| 1120 | Ga0395898_0003953 | |||
| 1121 | Ga0395898_0078532 | |||
| 1122 | Ga0395905_0000465 | |||
| 1123 | Ga0395905_0068856 | |||
| 1124 | Ga0395905_0097168 | |||
| 1125 | Ga0395901_0000002 | |||
| 1126 | Ga0395901_0002176 | |||
| 1127 | Ga0395901_0004355 | |||
| 1128 | Ga0400485_21785 | |||
| 1129 | Ga0400488_07537 | |||
| 1130 | Ga0400488_08671 | |||
| 1131 | Ga0400488_27987 | |||
| 1132 | Ga0400486_16986 | |||
| 1133 | Ga0400486_30900 | |||
| 1134 | Ga0400483_281047 | |||
| 1135 | Ga0436361_0488537 | |||
| 1136 | Ga0439448_0000506 | |||
| 1137 | Ga0466969_0000291 | |||
| 1138 | Ga0466969_0004742 | |||
| 1139 | Ga0466969_0004860 | |||
| 1140 | Ga0466981_0106271 | |||
| 1141 | Ga0466965_0010904 | |||
| 1142 | Ga0466965_0021235 | |||
| 1143 | Ga0466966_0000660 | |||
| 1144 | Ga0466966_0006180 | |||
| 1145 | Ga0466966_0011747 | |||
| 1146 | Ga0466966_0036106 | |||
| 1147 | Ga0466961_0001333 | |||
| 1148 | Ga0466961_0007783 | |||
| 1149 | Ga0466961_0104506 | |||
| 1150 | Ga0466963_0001859 | |||
| 1151 | Ga0466963_0003635 | |||
| 1152 | Ga0466963_0014494 | |||
| 1153 | Ga0466964_0001584 | |||
| 1154 | Ga0466971_0001698 | |||
| 1155 | Ga0466968_0001715 | |||
| 1156 | Ga0466970_0013863 | |||
| 1157 | Ga0466970_0015009 | |||
| 1158 | Ga0466970_0017837 | |||
| 1159 | Ga0466970_0154387 | |||
| 1160 | Ga0466957_0002676 | |||
| 1161 | Ga0466957_0013803 | |||
| 1162 | Ga0466957_0052110 | |||
| 1163 | Ga0466957_0058997 | |||
| 1164 | Ga0466959_0002057 | |||
| 1165 | Ga0466959_0004690 | |||
| 1166 | Ga0466959_0160219 | |||
| 1167 | Ga0466958_0001243 | |||
| 1168 | Ga0466958_0003451 | |||
| 1169 | Ga0495617_001688 | |||
| 1170 | Ga0495617_069422 | |||
| 1171 | Ga0495592_0001309 | |||
| 1172 | Ga0495592_0005199 | |||
| 1173 | Ga0495592_0014906 | |||
| 1174 | Ga0495603_0002550 | |||
| 1175 | Ga0495603_0007938 | |||
| 1176 | Ga0495590_0008298 | |||
| 1177 | Ga0495629_0000556 | |||
| 1178 | Ga0495629_0001618 | |||
| 1179 | Ga0495638_0010860 | |||
| 1180 | Ga0495641_0038642 | |||
| 1181 | Ga0495651_0003393 | |||
| 1182 | Ga0495651_0034962 | |||
| 1183 | Ga0495651_0113132 | |||
| 1184 | Ga0495653_0007393 | |||
| 1185 | Ga0495653_0022373 | |||
| 1186 | Ga0495653_0037145 | |||
| 1187 | Ga0495653_0097680 | |||
| 1188 | Ga0495650_0000044 | |||
| 1189 | Ga0495650_0000490 | |||
| 1190 | Ga0495650_0001032 | |||
| 1191 | Ga0495650_0009016 | |||
| 1192 | Ga0495650_0012890 | |||
| 1193 | Ga0495650_0017632 | |||
| 1194 | Ga0495650_0036267 | |||
| 1195 | Ga0495580_0000144 | |||
| 1196 | Ga0495580_0012638 | |||
| 1197 | Ga0495580_0056735 | |||
| 1198 | Ga0495582_0000513 | |||
| 1199 | Ga0495582_0020172 | |||
| 1200 | Ga0495582_0041555 | |||
| 1201 | Ga0495582_0069711 | |||
| 1202 | Ga0495605_0000038 | |||
| 1203 | Ga0495605_0001237 | |||
| 1204 | Ga0495605_0003602 | |||
| 1205 | Ga0495605_0022373 | |||
| 1206 | Ga0495662_0023837 | |||
| 1207 | Ga0495664_0000407 | |||
| 1208 | Ga0495584_0000338 | |||
| 1209 | Ga0495584_0003766 | |||
| 1210 | Ga0495585_0001498 | |||
| 1211 | Ga0495585_0011079 | |||
| 1212 | Ga0495596_0001026 | |||
| 1213 | Ga0495607_0000154 | |||
| 1214 | Ga0495607_0006580 | |||
| 1215 | Ga0495607_0007294 | |||
| 1216 | Ga0495583_0001088 | |||
| 1217 | Ga0495583_0004034 | |||
| 1218 | Ga0495606_0000053 | |||
| 1219 | Ga0495606_0000202 | |||
| 1220 | Ga0495606_0001110 | |||
| 1221 | Ga0495606_0004632 | |||
| 1222 | Ga0495606_0010467 | |||
| 1223 | Ga0495606_0013808 | |||
| 1224 | Ga0495606_0071990 | |||
| 1225 | Ga0495608_0004410 | |||
| 1226 | Ga0495608_0038116 | |||
| 1227 | Ga0495610_0000008 | |||
| 1228 | Ga0495610_0000939 | |||
| 1229 | Ga0495610_0002169 | |||
| 1230 | Ga0495610_0010208 | |||
| 1231 | Ga0495610_0011620 | |||
| 1232 | Ga0495610_0013699 | |||
| 1233 | Ga0495616_0000297 | |||
| 1234 | Ga0495616_0000426 | |||
| 1235 | Ga0495616_0001146 | |||
| 1236 | Ga0495618_0004387 | |||
| 1237 | Ga0495618_0012550 | |||
| 1238 | Ga0495628_0008989 | |||
| 1239 | Ga0495628_0012513 | |||
| 1240 | Ga0495628_0024659 | |||
| 1241 | Ga0495628_0024929 | |||
| 1242 | Ga0495628_0030098 | |||
| 1243 | Ga0495628_0055132 | |||
| 1244 | Ga0495628_0226218 | |||
| 1245 | Ga0495630_0022066 | |||
| 1246 | Ga0495630_0026715 | |||
| 1247 | Ga0495630_0043101 | |||
| 1248 | Ga0495643_0000022 | |||
| 1249 | Ga0495643_0000544 | |||
| 1250 | Ga0495648_0002960 | |||
| 1251 | Ga0495648_0007231 | |||
| 1252 | Ga0495648_0014126 | |||
| 1253 | Ga0495648_0024460 | |||
| 1254 | Ga0495666_0003286 | |||
| 1255 | Ga0495666_0045527 | |||
| 1256 | Ga0495642_0037785 | |||
| 1257 | Ga0495652_0004070 | |||
| 1258 | Ga0495652_0011470 | |||
| 1259 | Ga0495652_0019851 | |||
| 1260 | Ga0495652_0073824 | |||
| 1261 | Ga0495652_0160741 | |||
| 1262 | Ga0495654_0017714 | |||
| 1263 | Ga0495665_0006851 | |||
| 1264 | Ga0495665_0014811 | |||
| 1265 | Ga0495665_0064986 | |||
| 1266 | Ga0495665_0107510 | |||
| 1267 | Ga0495665_0147531 | |||
| 1268 | Ga0495640_0004677 | |||
| 1269 | Ga0495640_0140133 | |||
| 1270 | Ga0495587_0006089 | |||
| 1271 | Ga0495609_0000001 | |||
| 1272 | Ga0495609_0012187 | |||
| 1273 | Ga0495597_0003657 | |||
| 1274 | Ga0495597_0010571 | |||
| 1275 | Ga0495597_0019847 | |||
| 1276 | Ga0495597_0023658 | |||
| 1277 | Ga0495645_0002111 | |||
| 1278 | Ga0495645_0003064 | |||
| 1279 | Ga0495645_0068255 | |||
| 1280 | Ga0495622_0000009 | |||
| 1281 | Ga0495622_0002816 | |||
| 1282 | Ga0495622_0018809 | |||
| 1283 | Ga0495622_0049124 | |||
| 1284 | Ga0495622_0050181 | |||
| 1285 | Ga0495633_0000024 | |||
| 1286 | Ga0495633_0006180 | |||
| 1287 | Ga0495633_0008899 | |||
| 1288 | Ga0495633_0021964 | |||
| 1289 | Ga0495668_0000006 | |||
| 1290 | Ga0495668_0000027 | |||
| 1291 | Ga0495668_0000867 | |||
| 1292 | Ga0495668_0024662 | |||
| 1293 | Ga0495668_0091976 | |||
| 1294 | Ga0495634_0018589 | |||
| 1295 | Ga0495625_0001646 | |||
| 1296 | Ga0495625_0002007 | |||
| 1297 | Ga0495625_0013036 | |||
| 1298 | Ga0495625_0073669 | |||
| 1299 | Ga0495635_0002102 | |||
| 1300 | Ga0495635_0012611 | |||
| 1301 | Ga0495635_0025814 | |||
| 1302 | Ga0495635_0032176 | |||
| 1303 | Ga0495635_0116980 | |||
| 1304 | Ga0495659_0000141 | |||
| 1305 | Ga0495661_0000206 | |||
| 1306 | Ga0495661_0005113 | |||
| 1307 | Ga0495661_0008052 | |||
| 1308 | Ga0495661_0043523 | |||
| 1309 | Ga0495588_0011090 | |||
| 1310 | Ga0495588_0030376 | |||
| 1311 | Ga0495588_0081085 | |||
| 1312 | Ga0495657_0040197 | |||
| 1313 | Ga0495599_0003052 | |||
| 1314 | Ga0495599_0128463 | |||
| 1315 | Ga0495623_0010370 | |||
| 1316 | Ga0495623_0056971 | |||
| 1317 | Ga0495646_0000213 | |||
| 1318 | Ga0495646_0002043 | |||
| 1319 | Ga0495646_0007788 | |||
| 1320 | Ga0495646_0007923 | |||
| 1321 | Ga0495669_0019141 | |||
| 1322 | Ga0495613_0004229 | |||
| 1323 | Ga0495613_0013833 | |||
| 1324 | Ga0495624_0003163 | |||
| 1325 | Ga0495624_0008738 | |||
| 1326 | Ga0495624_0020031 | |||
| 1327 | Ga0495624_0024188 | |||
| 1328 | Ga0495624_0033834 | |||
| 1329 | Ga0495624_0041126 | |||
| 1330 | Ga0495670_0000681 | |||
| 1331 | Ga0495670_0035989 | |||
| 1332 | Ga0495670_0077610 | |||
| 1333 | Ga0495671_0000445 | |||
| 1334 | Ga0495671_0028010 | |||
| 1335 | Ga0495671_0042749 | |||
| 1336 | Ga0495649_0013822 | |||
| 1337 | Ga0495649_0014976 | |||
| 1338 | Ga0495649_0094379 | |||
| 1339 | Ga0495589_0000152 | |||
| 1340 | Ga0495589_0006169 | |||
| 1341 | Ga0495600_0000916 | |||
| 1342 | Ga0495600_0002306 | |||
| 1343 | Ga0495600_0003144 | |||
| 1344 | Ga0495660_0000489 | |||
| 1345 | Ga0495660_0005661 | |||
| 1346 | Ga0495660_0032031 | |||
| 1347 | Ga0495660_0097178 | |||
| 1348 | Ga0495581_0004887 | |||
| 1349 | Ga0495581_0024918 | |||
| 1350 | Ga0495581_0059305 | |||
| 1351 | Ga0495581_0073396 | |||
| 1352 | Ga0495604_0009621 | |||
| 1353 | Ga0495604_0012193 | |||
| 1354 | Ga0495604_0023802 | |||
| 1355 | Ga0495604_0099230 | |||
| 1356 | Ga0495636_0000678 | |||
| 1357 | Ga0495636_0082287 | |||
| 1358 | Ga0495674_0021507 | |||
| 1359 | Ga0495674_0028599 | |||
| 1360 | Ga0495674_0061179 | |||
| 1361 | Ga0495674_0152137 | |||
| 1362 | Ga0495674_0203066 | |||
| 1363 | Ga0495674_0210481 | |||
| 1364 | Ga0495672_0000219 | |||
| 1365 | Ga0495672_0000555 | |||
| 1366 | Ga0495672_0002308 | |||
| 1367 | Ga0495672_0002954 | |||
| 1368 | Ga0495672_0009592 | |||
| 1369 | Ga0495672_0021711 | |||
| 1370 | Ga0495676_0003912 | |||
| 1371 | Ga0495676_0136018 | |||
| 1372 | Ga0495680_0003015 | |||
| 1373 | Ga0495680_0016067 | |||
| 1374 | Ga0495680_0027379 | |||
| 1375 | Ga0495680_0035810 | |||
| 1376 | Ga0495680_0101153 | |||
| 1377 | Ga0495680_0119799 | |||
| 1378 | Ga0495683_0001515 | |||
| 1379 | Ga0495683_0001954 | |||
| 1380 | Ga0495683_0014791 | |||
| 1381 | Ga0495683_0031141 | |||
| 1382 | Ga0495687_000027 | |||
| 1383 | Ga0495687_000191 | |||
| 1384 | Ga0495687_001030 | |||
| 1385 | Ga0495687_026592 | |||
| 1386 | Ga0495675_0001420 | |||
| 1387 | Ga0495675_0021696 | |||
| 1388 | Ga0495675_0026601 | |||
| 1389 | Ga0495675_0085348 | |||
| 1390 | Ga0495677_0000001 | |||
| 1391 | Ga0495677_0009511 | |||
| 1392 | Ga0495679_000435 | |||
| 1393 | Ga0495679_001128 | |||
| 1394 | Ga0495679_003610 | |||
| 1395 | Ga0495685_000033 | |||
| 1396 | Ga0495673_0000005 | |||
| 1397 | Ga0495673_0000059 | |||
| 1398 | Ga0495673_0000067 | |||
| 1399 | Ga0495673_0004154 | |||
| 1400 | Ga0495686_0000032 | |||
| 1401 | Ga0495686_0000222 | |||
| 1402 | Ga0495686_0000231 | |||
| 1403 | Ga0495686_0000526 | |||
| 1404 | Ga0495686_0016623 | |||
| 1405 | Ga0495686_0050047 | |||
| 1406 | Ga0495686_0070711 | |||
| 1407 | Ga0495593_0008778 | |||
| 1408 | Ga0495593_0009853 | |||
| 1409 | Ga0495593_0028707 | |||
| 1410 | Ga0495593_0033969 | |||
| 1411 | Ga0495602_0006708 | |||
| 1412 | Ga0495602_0008763 | |||
| 1413 | Ga0495602_0028223 | |||
| 1414 | Ga0495602_0049579 | |||
| 1415 | Ga0495602_0128852 | |||
| 1416 | Ga0495614_0000073 | |||
| 1417 | Ga0495614_0008284 | |||
| 1418 | Ga0495626_0001295 | |||
| 1419 | Ga0495626_0051135 | |||
| 1420 | Ga0495626_0052589 | |||
| 1421 | Ga0496100_0001401 | |||
| 1422 | Ga0496100_0002872 | |||
| 1423 | Ga0496101_0001384 | |||
| 1424 | Ga0496101_0005450 | |||
| 1425 | Ga0496101_0093505 | |||
| 1426 | Ga0496102_0000101 | |||
| 1427 | Ga0496102_0000982 | |||
| 1428 | Ga0496102_0009879 | |||
| 1429 | Ga0496102_0009985 | |||
| 1430 | Ga0496102_0107099 | |||
| 1431 | Ga0496103_0000750 | |||
| 1432 | Ga0496103_0006830 | |||
| 1433 | Ga0496104_0044663 | |||
| 1434 | Ga0496104_0095818 | |||
| 1435 | Ga0496105_0022013 | |||
| 1436 | Ga0496106_0000389 | |||
| 1437 | Ga0496106_0209604 | |||
| 1438 | Ga0496106_0223756 | |||
| 1439 | Ga0496107_0021013 | |||
| 1440 | Ga0496108_0003010 | |||
| 1441 | Ga0496108_0093360 | |||
| 1442 | Ga0496109_0197940 | |||
| 1443 | Ga0496111_0036406 | |||
| 1444 | Ga0496111_0213448 | |||
| 1445 | Ga0496112_0014941 | |||
| 1446 | Ga0496113_0017568 | |||
| 1447 | Ga0496113_0194263 | |||
| 1448 | Ga0496115_0074067 | |||
| 1449 | Ga0496116_0015758 | |||
| 1450 | Ga0496117_0004045 | |||
| 1451 | Ga0496117_0006262 | |||
| 1452 | Ga0496117_0007374 | |||
| 1453 | Ga0496117_0024228 | |||
| 1454 | Ga0496117_0043033 | |||
| 1455 | Ga0496117_0060677 | |||
| 1456 | Ga0496118_0001803 | |||
| 1457 | Ga0496118_0002003 | |||
| 1458 | Ga0496118_0003491 | |||
| 1459 | Ga0496118_0005794 | |||
| 1460 | Ga0496118_0006944 | |||
| 1461 | Ga0496118_0015115 | |||
| 1462 | Ga0496118_0026844 | |||
| 1463 | Ga0496120_0135564 | |||
| 1464 | Ga0496121_0001722 | |||
| 1465 | Ga0496121_0001723 | |||
| 1466 | Ga0496121_0014969 | |||
| 1467 | Ga0496121_0024288 | |||
| 1468 | Ga0496121_0028218 | |||
| 1469 | Ga0496121_0037471 | |||
| 1470 | Ga0496122_0001320 | |||
| 1471 | Ga0496122_0029202 | |||
| 1472 | Ga0496122_0058149 | |||
| 1473 | Ga0496123_0005048 | |||
| 1474 | Ga0496123_0006703 | |||
| 1475 | Ga0496123_0014258 | |||
| 1476 | Ga0496124_0027051 | |||
| 1477 | Ga0496124_0029090 | |||
| 1478 | Ga0496124_0083882 | |||
| 1479 | Ga0496125_0034948 | |||
| 1480 | Ga0496126_0000034 | |||
| 1481 | Ga0496126_0001702 | |||
| 1482 | Ga0496126_0005654 | |||
| 1483 | Ga0496126_0019086 | |||
| 1484 | Ga0496126_0027494 | |||
| 1485 | Ga0495678_000071 | |||
| 1486 | Ga0495678_001563 | |||
| 1487 | Ga0495682_0001515 | |||
| 1488 | Ga0501031_0020072 | |||
| 1489 | Ga0501034_0151543 | |||
| 1490 | Ga0501038_0024604 | |||
| 1491 | Ga0501040_0003327 | |||
| 1492 | Ga0501041_0016641 | |||
| 1493 | Ga0501042_0000428 | |||
| 1494 | Ga0501043_0000010 | |||
| 1495 | Ga0501046_0000097 | |||
| 1496 | Ga0501047_0000026 | |||
| 1497 | Ga0501048_0003251 | |||
| 1498 | Ga0501048_0109283 | |||
| 1499 | Ga0501076_0087034 | |||
| 1500 | Ga0501249_004148 | |||
| 1501 | Ga0501234_006175 | |||
| 1502 | Ga0501269_000134 | |||
| 1503 | Ga0501279_001353 | |||
| 1504 | Ga0501045_0003305 | |||
| 1505 | Ga0501045_0011172 | |||
| 1506 | Ga0495601_0001280 | |||
| 1507 | Ga0500595_002958 | |||
| 1508 | Ga0500618_000187 | |||
| 1509 | Ga0500618_002400 | |||
| 1510 | Ga0500618_015507 | |||
| 1511 | Ga0500586_000139 | |||
| 1512 | Ga0500586_021842 | |||
| 1513 | Ga0500619_000189 | |||
| 1514 | Ga0501084_0002414 | |||
| 1515 | Ga0466962_0004561 | |||
| 1516 | Ga0466962_0004689 | |||
| 1517 | Ga0466962_0011403 | |||
| 1518 | 2501075742 | |||
| 1519 | 2501076875 | |||
| 1520 | 2501411348 | |||
| 1521 | 2509130330 | |||
| 1522 | 2510250526 | |||
| 1523 | 2511088949 | |||
| 1524 | 2511100010 | |||
| 1525 | 2511103981 | |||
| 1526 | 2512348055 | |||
| 1527 | 2513552618 | |||
| 1528 | 2513565203 | |||
| 1529 | 2513963263 | |||
| 1530 | 2514053076 | |||
| 1531 | 2515678922 | |||
| 1532 | 2515688765 | |||
| 1533 | 2516021199 | |||
| 1534 | 2519459293 | |||
| 1535 | 2527077184 | |||
| 1536 | 2548497428 | |||
| 1537 | 2563062567 | |||
| 1538 | 2585294313 | |||
| 1539 | 2599738339 | |||
| 1540 | 2599746461 | |||
| 1541 | 2600208367 | |||
| 1542 | 2600813084 | |||
| 1543 | 2643792262 | |||
| 1544 | 2643866537 | |||
| 1545 | 2644212247 | |||
| 1546 | 2644294106 | |||
| 1547 | 2644354724 | |||
| 1548 | 2644646109 | |||
| 1549 | 2676745327 | |||
| 1550 | 2713477574 | |||
| 1551 | 2719639674 | |||
| 1552 | 2723877081 | |||
| 1553 | 2738739815 | |||
| 1554 | 2738823235 | |||
| 1555 | 2738828011 | |||
| 1556 | 2738835663 | |||
| 1557 | 2738842333 | |||
| 1558 | 2738877156 | |||
| 1559 | 2739151807 | |||
| 1560 | 2739188862 | |||
| 1561 | 2739194172 | |||
| 1562 | 2739223749 | |||
| 1563 | 2739274034 | |||
| 1564 | 2739320203 | |||
| 1565 | 2739338889 | |||
| 1566 | 2739343078 | |||
| 1567 | 2746091760 | |||
| 1568 | 2746097134 | |||
| 1569 | 2753568083 | |||
| 1570 | 2792833717 | |||
| 1571 | 2808971997 | |||
| 1572 | 2809006826 | |||
| 1573 | 2809013964 | |||
| 1574 | 2817261580 | |||
| 1575 | 2817279262 | |||
| 1576 | 2817454539 | |||
| 1577 | 2819540649 | |||
| 1578 | 2819622306 | |||
| 1579 | 2819633534 | |||
| 1580 | 2842329959 | |||
| 1581 | 2842356197 | |||
| 1582 | 2842457521 | |||
| 1583 | 2856294065 | |||
| 1584 | 2857362498 | |||
| 1585 | 2857560034 | |||
| 1586 | 2857566772 | |||
| 1587 | 2857578216 | |||
| 1588 | 2863425709 | |||
| 1589 | 2870070719 | |||
| 1590 | 2881102180 | |||
| 1591 | 2883094131 | |||
| 1592 | 2885273218 | |||
| 1593 | 2900635602 | |||
| 1594 | 2902688655 | |||
| 1595 | 2904426793 | |||
| 1596 | 2904435718 | |||
| 1597 | 2904487139 | |||
| 1598 | 2904569914 | |||
| 1599 | 2904577066 | |||
| 1600 | 2904619781 | |||
| 1601 | 2919528445 | |||
| 1602 | 2921653208 | |||
| 1603 | 2928113065 | |||
| 1604 | 2928140224 | |||
| 1605 | 2928161653 | |||
| 1606 | 2928168481 | |||
| 1607 | 2928174792 | |||
| 1608 | 2928507783 | |||
| 1609 | 2928542484 | |||
| 1610 | 2932425895 | |||
| 1611 | 2939636463 | |||
| 1612 | 2945936164 | |||
| 1613 | 2981993641 | |||
| 1614 | 2990709934 | |||
| 1615 | 642427200 | |||
| 1616 | 642415158 | |||
| 1617 | 642593774 | |||
| 1618 | 642620933 | |||
| 1619 | 8003961447 | |||
| 1620 | 8018850903 | |||
| 1621 | 8020810083 | |||
| 1622 | 8020940968 | |||
| 1623 | 8020952329 | |||
| 1624 | 8020958418 | |||
| 1625 | 8021125175 | |||
| 1626 | 8039103476 | |||
| 1627 | 8040170323 | |||
| 1628 | 8040175881 | |||
| 1629 | 8055271339 | |||
| 1630 | 8055306044 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u08-assembly1.cif.gz_B | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.9803 | 8 | 389 |
| 1u08-assembly1.cif.gz_A | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.9796 | 8 | 389 |
| 1u08-assembly1.cif.gz_B | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.9777 | 8 | 389 |
| 1u08-assembly1.cif.gz_A | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.977 | 8 | 389 |
| 2o0r-assembly1.cif.gz_B | the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis | 0.9568 | 12 | 388 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77806_47_284_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9921 | 53 | 286 | 3.40.640.10 |
| af_A0A1D6I5Q5_168_402_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9796 | 52 | 282 | 3.40.640.10 |
| af_P77806_286_386_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9765 | 291 | 389 | 3.90.1150.10 |
| af_P77806_47_284_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9714 | 53 | 286 | 3.40.640.10 |
| af_Q54KM6_55_307_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9654 | 53 | 284 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257JDI9-F1-model_v4 | Methionine aminotransferase | 0.9934 | 118 | 333 |
GO:0005737
GO:0009058 GO:0016212 GO:0030170 |
| AF-A0A7X5N1V2-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.992 | 195 | 350 |
GO:0005737
GO:0009058 GO:0016212 GO:0030170 |
| AF-I3UHU5-F1-model_v4 | Methionine aminotransferase | 0.9918 | 29 | 389 |
GO:0005737
GO:0009058 GO:0016212 GO:0030170 |
| AF-A0A6A5KY21-F1-model_v4 | deleted | 0.9899 | 13 | 382 |
|
| AF-A0A257JDI9-F1-model_v4 | Methionine aminotransferase | 0.9889 | 118 | 333 |
GO:0005737
GO:0009058 GO:0016212 GO:0030170 |