F482008

General Info

Members Datasets Scaffolds Average Seq Length
815 221 1630 222

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10002514|Ga0070691_100025145
Length 233
Sequence MAVDRSGRIVADHEEKRIVDLSHVIEHGMTTYPGLPPPHICDFWTRDGSAANYDDGSSFHIGRIEMVANTGTYVDAPFHRYAEGSDLAELPLSSLADLPGIIVRRPWETELATTTAQFDGVDVRGKAVLIHTGWDRHWRTDRYGVDHPFLTAEAADWLVEQGAALVGIDSNNIDDTRVRARPVHSKLLAADIPICEHMTGLGSLPDEGFRFSAVPPKVRGMGTFPVRAYAVLG

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
180 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
181 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
182 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
214 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.13
Rhizosphere 93.62
Stem 0
Stem Tuber 0.12
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10002514 3300005341 Bacteria 8160
2 JGI24736J21556_1007039 3300001904 Bacteria 1895
3 JGI24736J21556_1020772 3300001904 Bacteria 1030
4 JGI24741J21665_1016005 3300001915 Bacteria 1230
5 JGI24740J21852_10005218 3300001979 Bacteria 5516
6 JGI24740J21852_10014388 3300001979 Bacteria 2920
7 JGI24740J21852_10025312 3300001979 Bacteria 2002
8 JGI24740J21852_10026704 3300001979 Bacteria 1931
9 JGI24740J21852_10044901 3300001979 Bacteria 1308
10 JGI24739J22299_10000129 3300001989 Bacteria 23885
11 JGI24739J22299_10005090 3300001989 Bacteria 5009
12 JGI24739J22299_10012295 3300001989 Bacteria 3143
13 JGI24737J22298_10000357 3300001990 Bacteria 15471
14 JGI24737J22298_10040939 3300001990 Bacteria 1421
15 JGI24735J21928_10001481 3300002067 Bacteria 8303
16 JGI24735J21928_10048335 3300002067 Bacteria 1231
17 JGI24738J21930_10002016 3300002075 Bacteria 5457
18 JGI24738J21930_10013308 3300002075 Bacteria 1782
19 Ga0065715_10040526 3300005293 Bacteria 1774
20 Ga0065715_10325170 3300005293 Bacteria 994
21 Ga0070658_10005892 3300005327 Bacteria 9941
22 Ga0070658_10044040 3300005327 Bacteria 3606
23 Ga0070658_10136009 3300005327 Bacteria 2051
24 Ga0070658_10192122 3300005327 Bacteria 1721
25 Ga0070658_10413189 3300005327 Bacteria 1160
26 Ga0070658_10505309 3300005327 Bacteria 1044
27 Ga0070658_10753299 3300005327 Bacteria 846
28 Ga0070676_10344712 3300005328 Bacteria 1023
29 Ga0070676_10655224 3300005328 Bacteria 762
30 Ga0070683_100012234 3300005329 Bacteria 7452
31 Ga0070683_100121722 3300005329 Bacteria 2465
32 Ga0070690_100011023 3300005330 Bacteria 5279
33 Ga0070690_100043088 3300005330 Bacteria 2860
34 Ga0070670_100000265 3300005331 Bacteria 46560
35 Ga0070670_100003781 3300005331 Bacteria 12600
36 Ga0070670_100014349 3300005331 Bacteria 6798
37 Ga0070670_100029602 3300005331 Bacteria 4714
38 Ga0070670_100055734 3300005331 Bacteria 3392
39 Ga0070670_100092939 3300005331 Bacteria 2594
40 Ga0068869_100000331 3300005334 Bacteria 25170
41 Ga0068869_100049115 3300005334 Bacteria 3053
42 Ga0070666_10000822 3300005335 Bacteria 18838
43 Ga0070666_10020480 3300005335 Bacteria 4275
44 Ga0070666_10020767 3300005335 Bacteria 4249
45 Ga0070666_10044857 3300005335 Bacteria 2964
46 Ga0070666_10176429 3300005335 Bacteria 1498
47 Ga0070680_100041495 3300005336 Bacteria 3730
48 Ga0070680_100052095 3300005336 Bacteria 3341
49 Ga0070680_100168597 3300005336 Bacteria 1842
50 Ga0070682_100087002 3300005337 Bacteria 2036
51 Ga0070682_100095657 3300005337 Bacteria 1951
52 Ga0068868_100000156 3300005338 Bacteria 44526
53 Ga0068868_100002559 3300005338 Bacteria 12640
54 Ga0068868_100006614 3300005338 Bacteria 8219
55 Ga0068868_100159878 3300005338 Bacteria 1860
56 Ga0068868_100574744 3300005338 Bacteria 996
57 Ga0070660_100007081 3300005339 Bacteria 7793
58 Ga0070660_100026563 3300005339 Bacteria 4312
59 Ga0070660_100030049 3300005339 Bacteria 4074
60 Ga0070660_100043478 3300005339 Bacteria 3433
61 Ga0070660_100080989 3300005339 Bacteria 2548
62 Ga0070660_100085471 3300005339 Bacteria 2481
63 Ga0070660_100145148 3300005339 Bacteria 1906
64 Ga0070660_100153516 3300005339 Bacteria 1852
65 Ga0070660_100304788 3300005339 Bacteria 1306
66 Ga0070660_100392678 3300005339 Bacteria 1146
67 Ga0070660_100489185 3300005339 Bacteria 1023
68 Ga0070689_100177195 3300005340 Bacteria 1730
69 Ga0070661_100005185 3300005344 Bacteria 8968
70 Ga0070661_100008741 3300005344 Bacteria 7009
71 Ga0070661_100025985 3300005344 Bacteria 4208
72 Ga0070661_100039022 3300005344 Bacteria 3459
73 Ga0070661_100073103 3300005344 Bacteria 2524
74 Ga0070661_100087901 3300005344 Bacteria 2300
75 Ga0070661_100107056 3300005344 Bacteria 2085
76 Ga0070661_100140266 3300005344 Bacteria 1821
77 Ga0070661_100159417 3300005344 Bacteria 1708
78 Ga0070661_100519858 3300005344 Bacteria 955
79 Ga0070692_10042346 3300005345 Bacteria 2338
80 Ga0070668_100531194 3300005347 Bacteria 1022
81 Ga0070669_100012144 3300005353 Bacteria 6113
82 Ga0070669_100074505 3300005353 Bacteria 2516
83 Ga0070669_100097848 3300005353 Bacteria 2209
84 Ga0070669_100695846 3300005353 Bacteria 858
85 Ga0070675_100024135 3300005354 Bacteria 4869
86 Ga0070675_100038524 3300005354 Bacteria 3897
87 Ga0070675_100051454 3300005354 Bacteria 3385
88 Ga0070675_100359812 3300005354 Bacteria 1292
89 Ga0070671_100002678 3300005355 Bacteria 13804
90 Ga0070671_100003224 3300005355 Bacteria 12714
91 Ga0070671_100004595 3300005355 Bacteria 10940
92 Ga0070671_100013820 3300005355 Bacteria 6514
93 Ga0070671_100027301 3300005355 Bacteria 4697
94 Ga0070671_100033667 3300005355 Bacteria 4240
95 Ga0070671_100127406 3300005355 Bacteria 2144
96 Ga0070671_100136445 3300005355 Bacteria 2068
97 Ga0070671_100158747 3300005355 Bacteria 1911
98 Ga0070671_100274132 3300005355 Bacteria 1434
99 Ga0070674_100067730 3300005356 Bacteria 2512
100 Ga0070674_100091992 3300005356 Bacteria 2192
101 Ga0070673_100000249 3300005364 Bacteria 27281
102 Ga0070673_100004605 3300005364 Bacteria 8744
103 Ga0070673_100012814 3300005364 Bacteria 5771
104 Ga0070673_100140299 3300005364 Bacteria 2038
105 Ga0070673_100315730 3300005364 Bacteria 1379
106 Ga0070673_100564901 3300005364 Bacteria 1035
107 Ga0070659_100000814 3300005366 Bacteria 22773
108 Ga0070659_100001062 3300005366 Bacteria 20090
109 Ga0070659_100010645 3300005366 Bacteria 6773
110 Ga0070659_100012093 3300005366 Bacteria 6390
111 Ga0070659_100017466 3300005366 Bacteria 5402
112 Ga0070659_100026998 3300005366 Bacteria 4421
113 Ga0070659_100054621 3300005366 Bacteria 3146
114 Ga0070659_100225735 3300005366 Bacteria 1547
115 Ga0070659_100232702 3300005366 Bacteria 1523
116 Ga0070659_100302972 3300005366 Bacteria 1333
117 Ga0070659_100405156 3300005366 Bacteria 1152
118 Ga0070667_100001760 3300005367 Bacteria 19301
119 Ga0070667_100001996 3300005367 Bacteria 18084
120 Ga0070667_100003528 3300005367 Bacteria 13330
121 Ga0070667_100005936 3300005367 Bacteria 10165
122 Ga0070667_100012097 3300005367 Bacteria 7145
123 Ga0070667_100053246 3300005367 Bacteria 3415
124 Ga0070667_100143007 3300005367 Bacteria 2096
125 Ga0070714_100155481 3300005435 Bacteria 2064
126 Ga0070713_100159477 3300005436 Bacteria 2012
127 Ga0070694_100001882 3300005444 Bacteria 12423
128 Ga0070663_100097433 3300005455 Bacteria 2189
129 Ga0070663_100115393 3300005455 Bacteria 2023
130 Ga0070663_100287288 3300005455 Bacteria 1312
131 Ga0070663_100316344 3300005455 Bacteria 1254
132 Ga0070663_100440855 3300005455 Bacteria 1072
133 Ga0070678_100002527 3300005456 Bacteria 10025
134 Ga0070678_100012520 3300005456 Bacteria 5278
135 Ga0070678_100044701 3300005456 Bacteria 3164
136 Ga0070678_100432324 3300005456 Bacteria 1150
137 Ga0070662_100001186 3300005457 Bacteria 15980
138 Ga0070662_100004435 3300005457 Bacteria 8876
139 Ga0070662_100011120 3300005457 Bacteria 5927
140 Ga0070662_100013318 3300005457 Bacteria 5471
141 Ga0070662_100066085 3300005457 Bacteria 2653
142 Ga0070662_100077558 3300005457 Bacteria 2466
143 Ga0070662_100296442 3300005457 Bacteria 1312
144 Ga0070662_100305270 3300005457 Bacteria 1294
145 Ga0070662_100475685 3300005457 Bacteria 1039
146 Ga0070662_100735687 3300005457 Bacteria 836
147 Ga0070681_10004466 3300005458 Bacteria 13328
148 Ga0070681_10011820 3300005458 Bacteria 8654
149 Ga0070681_10032773 3300005458 Bacteria 5216
150 Ga0070681_10234222 3300005458 Bacteria 1750
151 Ga0068867_100006496 3300005459 Bacteria 8259
152 Ga0068867_100228551 3300005459 Bacteria 1503
153 Ga0070679_100051106 3300005530 Bacteria 4117
154 Ga0070679_100092329 3300005530 Bacteria 3015
155 Ga0070679_100097574 3300005530 Bacteria 2926
156 Ga0070679_100420110 3300005530 Bacteria 1282
157 Ga0070684_100346971 3300005535 Bacteria 1365
158 Ga0070684_100356693 3300005535 Bacteria 1345
159 Ga0068853_100003189 3300005539 Bacteria 12522
160 Ga0068853_100016758 3300005539 Bacteria 6036
161 Ga0068853_100028037 3300005539 Bacteria 4736
162 Ga0068853_100040515 3300005539 Bacteria 3974
163 Ga0068853_100180284 3300005539 Bacteria 1915
164 Ga0068853_100279082 3300005539 Bacteria 1540
165 Ga0070672_100004112 3300005543 Bacteria 9500
166 Ga0070672_100024836 3300005543 Bacteria 4435
167 Ga0070672_100151707 3300005543 Bacteria 1917
168 Ga0070672_100359766 3300005543 Bacteria 1242
169 Ga0070672_100424675 3300005543 Bacteria 1142
170 Ga0070686_100015812 3300005544 Bacteria 4381
171 Ga0070686_100057824 3300005544 Bacteria 2493
172 Ga0070696_100018036 3300005546 Bacteria 4767
173 Ga0070696_100029511 3300005546 Bacteria 3749
174 Ga0070693_100003535 3300005547 Bacteria 7287
175 Ga0070693_100021052 3300005547 Bacteria 3450
176 Ga0070693_100037986 3300005547 Bacteria 2688
177 Ga0070693_100159193 3300005547 Bacteria 1437
178 Ga0070665_100014720 3300005548 Bacteria 7849
179 Ga0070665_100131970 3300005548 Bacteria 2500
180 Ga0070704_100249319 3300005549 Bacteria 1457
181 Ga0068855_100013435 3300005563 Bacteria 9872
182 Ga0068855_100020021 3300005563 Bacteria 8034
183 Ga0068855_100023602 3300005563 Bacteria 7367
184 Ga0068855_100278870 3300005563 Bacteria 1857
185 Ga0068855_100395288 3300005563 Bacteria 1516
186 Ga0068855_100656999 3300005563 Bacteria 1125
187 Ga0070664_100001299 3300005564 Bacteria 19974
188 Ga0070664_100002185 3300005564 Bacteria 15712
189 Ga0070664_100003024 3300005564 Bacteria 13598
190 Ga0070664_100009071 3300005564 Bacteria 8070
191 Ga0070664_100045653 3300005564 Bacteria 3700
192 Ga0070664_100079032 3300005564 Bacteria 2830
193 Ga0070664_100104994 3300005564 Bacteria 2460
194 Ga0070664_100195872 3300005564 Bacteria 1801
195 Ga0070664_100323245 3300005564 Bacteria 1398
196 Ga0070664_100418787 3300005564 Bacteria 1226
197 Ga0070664_100581111 3300005564 Bacteria 1038
198 Ga0068857_100001148 3300005577 Bacteria 20637
199 Ga0068857_100006203 3300005577 Bacteria 10222
200 Ga0068857_100044306 3300005577 Bacteria 3946
201 Ga0068857_100088327 3300005577 Bacteria 2773
202 Ga0068857_100112604 3300005577 Bacteria 2446
203 Ga0068857_100460894 3300005577 Bacteria 1189
204 Ga0068854_100002969 3300005578 Bacteria 10522
205 Ga0068854_100006117 3300005578 Bacteria 7636
206 Ga0068854_100026095 3300005578 Bacteria 4012
207 Ga0068854_100077420 3300005578 Bacteria 2447
208 Ga0068854_100086439 3300005578 Bacteria 2324
209 Ga0068854_100209141 3300005578 Bacteria 1538
210 Ga0068854_100620088 3300005578 Bacteria 925
211 Ga0068856_100009206 3300005614 Bacteria 9602
212 Ga0068856_100052761 3300005614 Bacteria 4011
213 Ga0068856_100060282 3300005614 Bacteria 3749
214 Ga0068852_100004156 3300005616 Bacteria 10199
215 Ga0068852_100014972 3300005616 Bacteria 5996
216 Ga0068852_100018232 3300005616 Bacteria 5527
217 Ga0068852_100042943 3300005616 Bacteria 3831
218 Ga0068852_100048261 3300005616 Bacteria 3637
219 Ga0068852_100121347 3300005616 Bacteria 2393
220 Ga0068852_100191425 3300005616 Bacteria 1930
221 Ga0068852_100200478 3300005616 Bacteria 1888
222 Ga0068852_100223037 3300005616 Bacteria 1793
223 Ga0068859_100000324 3300005617 Bacteria 47483
224 Ga0068859_100000778 3300005617 Bacteria 32222
225 Ga0068859_100008048 3300005617 Bacteria 10687
226 Ga0068859_100009708 3300005617 Bacteria 9716
227 Ga0068859_100115745 3300005617 Bacteria 2746
228 Ga0068859_100296654 3300005617 Bacteria 1710
229 Ga0068859_100450897 3300005617 Bacteria 1383
230 Ga0068864_100000291 3300005618 Bacteria 44522
231 Ga0068864_100000795 3300005618 Bacteria 26479
232 Ga0068864_100005333 3300005618 Bacteria 10533
233 Ga0068864_100010009 3300005618 Bacteria 7825
234 Ga0068864_100013911 3300005618 Bacteria 6670
235 Ga0068864_100018948 3300005618 Bacteria 5753
236 Ga0068864_100385213 3300005618 Bacteria 1329
237 Ga0068866_10010582 3300005718 Bacteria 3961
238 Ga0068866_10090526 3300005718 Bacteria 1665
239 Ga0068861_100147661 3300005719 Bacteria 1926
240 Ga0068851_10004289 3300005834 Bacteria 6422
241 Ga0068851_10016630 3300005834 Bacteria 3524
242 Ga0068851_10105626 3300005834 Bacteria 1499
243 Ga0068851_10228726 3300005834 Bacteria 1048
244 Ga0068863_100000921 3300005841 Bacteria 29492
245 Ga0068863_100003770 3300005841 Bacteria 14990
246 Ga0068863_100006534 3300005841 Bacteria 11440
247 Ga0068863_100009599 3300005841 Bacteria 9438
248 Ga0068863_100016913 3300005841 Bacteria 6994
249 Ga0068863_100198637 3300005841 Bacteria 1928
250 Ga0068863_100389594 3300005841 Bacteria 1361
251 Ga0068863_100596349 3300005841 Bacteria 1093
252 Ga0068858_100002150 3300005842 Bacteria 19979
253 Ga0068858_100003884 3300005842 Bacteria 14758
254 Ga0068858_100012006 3300005842 Bacteria 8166
255 Ga0068858_100015011 3300005842 Bacteria 7288
256 Ga0068858_100026394 3300005842 Bacteria 5398
257 Ga0068858_100028763 3300005842 Bacteria 5161
258 Ga0068858_100057247 3300005842 Bacteria 3603
259 Ga0068860_100001686 3300005843 Bacteria 23599
260 Ga0068860_100001926 3300005843 Bacteria 21977
261 Ga0068860_100035697 3300005843 Bacteria 4767
262 Ga0068860_100180454 3300005843 Bacteria 2040
263 Ga0068860_100246471 3300005843 Bacteria 1739
264 Ga0068860_100870034 3300005843 Bacteria 916
265 Ga0068862_100012981 3300005844 Bacteria 6890
266 Ga0068862_100014186 3300005844 Bacteria 6607
267 Ga0068862_100086339 3300005844 Bacteria 2727
268 Ga0068862_100099295 3300005844 Bacteria 2544
269 Ga0068862_100243650 3300005844 Bacteria 1636
270 Ga0081539_10004604 3300005985 Bacteria 15046
271 Ga0070717_10007485 3300006028 Bacteria 8110
272 Ga0097621_100003293 3300006237 Bacteria 11111
273 Ga0097621_100027506 3300006237 Bacteria 4474
274 Ga0097621_100216581 3300006237 Bacteria 1667
275 Ga0097621_100623540 3300006237 Bacteria 987
276 Ga0068871_100010557 3300006358 Bacteria 6746
277 Ga0068871_100037362 3300006358 Bacteria 3872
278 Ga0068871_100255689 3300006358 Bacteria 1527
279 Ga0075428_100187961 3300006844 Bacteria 2234
280 Ga0075431_100152629 3300006847 Bacteria 2378
281 Ga0075433_10040363 3300006852 Bacteria 4039
282 Ga0068865_100002393 3300006881 Bacteria 11064
283 Ga0068865_100003247 3300006881 Bacteria 9738
284 Ga0068865_100062114 3300006881 Bacteria 2621
285 Ga0097620_100000324 3300006931 Bacteria 47483
286 Ga0097620_100000778 3300006931 Bacteria 32222
287 Ga0097620_100008050 3300006931 Bacteria 10687
288 Ga0097620_100009708 3300006931 Bacteria 9716
289 Ga0097620_100115745 3300006931 Bacteria 2746
290 Ga0097620_100296639 3300006931 Bacteria 1710
291 Ga0097620_100372599 3300006931 Bacteria 1523
292 Ga0097620_100450856 3300006931 Bacteria 1383
293 Ga0075435_100886954 3300007076 Bacteria 778
294 Ga0105240_10102578 3300009093 Bacteria 3476
295 Ga0105240_10285232 3300009093 Bacteria 1895
296 Ga0111539_10046155 3300009094 Bacteria 5213
297 Ga0105245_10000326 3300009098 Bacteria 44899
298 Ga0105245_10035058 3300009098 Bacteria 4452
299 Ga0105247_10059897 3300009101 Bacteria 2358
300 Ga0105243_10118825 3300009148 Bacteria 2225
301 Ga0105243_10137328 3300009148 Bacteria 2082
302 Ga0105243_10154793 3300009148 Bacteria 1970
303 Ga0105243_10199262 3300009148 Bacteria 1755
304 Ga0105241_10311422 3300009174 Bacteria 1354
305 Ga0105241_10681676 3300009174 Bacteria 936
306 Ga0105241_10684095 3300009174 Bacteria 935
307 Ga0105242_10215922 3300009176 Bacteria 1711
308 Ga0105242_10954479 3300009176 Bacteria 862
309 Ga0105248_10000123 3300009177 Bacteria 89301
310 Ga0105248_10000159 3300009177 Bacteria 78504
311 Ga0105248_10003349 3300009177 Bacteria 17812
312 Ga0105248_10008341 3300009177 Bacteria 11381
313 Ga0105248_10032008 3300009177 Bacteria 5876
314 Ga0105248_10068988 3300009177 Bacteria 3969
315 Ga0105248_10152882 3300009177 Bacteria 2604
316 Ga0105237_10014626 3300009545 Bacteria 8197
317 Ga0105237_10104049 3300009545 Bacteria 2831
318 Ga0105238_10029725 3300009551 Bacteria 5565
319 Ga0105238_10045399 3300009551 Bacteria 4438
320 Ga0105238_10074687 3300009551 Bacteria 3383
321 Ga0105238_10370272 3300009551 Bacteria 1423
322 Ga0105249_10002812 3300009553 Bacteria 15022
323 Ga0105249_10027144 3300009553 Bacteria 5165
324 Ga0105249_10042437 3300009553 Bacteria 4137
325 Ga0105249_10902449 3300009553 Bacteria 951
326 Ga0105239_10088620 3300010375 Bacteria 3412
327 Ga0105239_10139049 3300010375 Bacteria 2705
328 Ga0105239_10265154 3300010375 Bacteria 1931
329 Ga0105246_10007596 3300011119 Bacteria 6648
330 Ga0105246_10035563 3300011119 Bacteria 3330
331 Ga0157373_10025715 3300013100 Bacteria 4256
332 Ga0157373_10028470 3300013100 Bacteria 4031
333 Ga0157373_10031567 3300013100 Bacteria 3813
334 Ga0157373_10048670 3300013100 Bacteria 3022
335 Ga0157373_10142175 3300013100 Bacteria 1688
336 Ga0157373_10314773 3300013100 Bacteria 1113
337 Ga0157371_10042144 3300013102 Bacteria 3254
338 Ga0157371_10043433 3300013102 Bacteria 3201
339 Ga0157371_10117565 3300013102 Bacteria 1890
340 Ga0157371_10158325 3300013102 Bacteria 1617
341 Ga0157370_10408331 3300013104 Bacteria 1250
342 Ga0157369_10001821 3300013105 Bacteria 25788
343 Ga0157369_10471240 3300013105 Bacteria 1300
344 Ga0157369_10636344 3300013105 Bacteria 1100
345 Ga0157374_10007961 3300013296 Bacteria 9051
346 Ga0157374_10037887 3300013296 Bacteria 4429
347 Ga0157378_10017601 3300013297 Bacteria 6275
348 Ga0157378_10217415 3300013297 Bacteria 1815
349 Ga0157378_10275325 3300013297 Bacteria 1620
350 Ga0163162_10000839 3300013306 Bacteria 28555
351 Ga0163162_10020519 3300013306 Bacteria 6492
352 Ga0163162_10032585 3300013306 Bacteria 5177
353 Ga0163162_10106474 3300013306 Bacteria 2899
354 Ga0163162_10122547 3300013306 Bacteria 2705
355 Ga0157372_10007786 3300013307 Bacteria 11380
356 Ga0157372_10038030 3300013307 Bacteria 5311
357 Ga0157372_10044456 3300013307 Bacteria 4922
358 Ga0157372_10069626 3300013307 Bacteria 3957
359 Ga0157372_10467149 3300013307 Bacteria 1471
360 Ga0157375_10012608 3300013308 Bacteria 7501
361 Ga0157375_10030402 3300013308 Bacteria 5092
362 Ga0157375_10280627 3300013308 Bacteria 1829
363 Ga0163163_10001003 3300014325 Bacteria 23895
364 Ga0163163_10002107 3300014325 Bacteria 16792
365 Ga0163163_10006230 3300014325 Bacteria 10407
366 Ga0163163_10028144 3300014325 Bacteria 5392
367 Ga0157380_10491759 3300014326 Bacteria 1189
368 Ga0182008_10026040 3300014497 Bacteria 2967
369 Ga0157377_10069321 3300014745 Bacteria 2035
370 Ga0157379_10033238 3300014968 Bacteria 4600
371 Ga0157379_10051067 3300014968 Bacteria 3693
372 Ga0157379_10226307 3300014968 Bacteria 1695
373 Ga0157379_10485817 3300014968 Bacteria 1143
374 Ga0157379_10685220 3300014968 Bacteria 961
375 Ga0157376_10004128 3300014969 Bacteria 10064
376 Ga0207697_10000584 3300025315 Bacteria 20797
377 Ga0207656_10001997 3300025321 Bacteria 6800
378 Ga0207656_10025612 3300025321 Bacteria 2396
379 Ga0207656_10143178 3300025321 Bacteria 1128
380 Ga0207642_10010293 3300025899 Bacteria 3291
381 Ga0207642_10073951 3300025899 Bacteria 1632
382 Ga0207642_10274063 3300025899 Bacteria 967
383 Ga0207710_10034795 3300025900 Bacteria 2215
384 Ga0207710_10055450 3300025900 Bacteria 1786
385 Ga0207688_10004411 3300025901 Bacteria 7657
386 Ga0207680_10001404 3300025903 Bacteria 11397
387 Ga0207680_10025443 3300025903 Bacteria 3264
388 Ga0207647_10000575 3300025904 Bacteria 28658
389 Ga0207647_10001244 3300025904 Bacteria 19604
390 Ga0207647_10002145 3300025904 Bacteria 15075
391 Ga0207647_10002864 3300025904 Bacteria 12995
392 Ga0207647_10033790 3300025904 Bacteria 3271
393 Ga0207647_10075157 3300025904 Bacteria 2034
394 Ga0207647_10086300 3300025904 Bacteria 1876
395 Ga0207647_10096088 3300025904 Bacteria 1764
396 Ga0207647_10202596 3300025904 Bacteria 1147
397 Ga0207645_10001233 3300025907 Bacteria 21061
398 Ga0207645_10030785 3300025907 Bacteria 3458
399 Ga0207645_10039751 3300025907 Bacteria 3014
400 Ga0207645_10152444 3300025907 Bacteria 1509
401 Ga0207645_10201432 3300025907 Bacteria 1310
402 Ga0207645_10260884 3300025907 Bacteria 1148
403 Ga0207705_10007837 3300025909 Bacteria 7842
404 Ga0207705_10018858 3300025909 Bacteria 4932
405 Ga0207705_10033458 3300025909 Bacteria 3672
406 Ga0207705_10035309 3300025909 Bacteria 3576
407 Ga0207705_10048695 3300025909 Bacteria 3049
408 Ga0207705_10083585 3300025909 Bacteria 2329
409 Ga0207705_10102558 3300025909 Bacteria 2106
410 Ga0207705_10102877 3300025909 Bacteria 2103
411 Ga0207705_10138815 3300025909 Bacteria 1814
412 Ga0207705_10167853 3300025909 Bacteria 1651
413 Ga0207705_10602809 3300025909 Bacteria 854
414 Ga0207654_10261953 3300025911 Bacteria 1163
415 Ga0207654_10284114 3300025911 Bacteria 1120
416 Ga0207707_10011234 3300025912 Bacteria 7792
417 Ga0207707_10030054 3300025912 Bacteria 4750
418 Ga0207707_10155416 3300025912 Bacteria 2000
419 Ga0207695_10030232 3300025913 Bacteria 5966
420 Ga0207671_10079430 3300025914 Bacteria 2458
421 Ga0207671_10227897 3300025914 Bacteria 1461
422 Ga0207671_10450844 3300025914 Bacteria 1025
423 Ga0207660_10092580 3300025917 Bacteria 2244
424 Ga0207660_10131797 3300025917 Bacteria 1903
425 Ga0207660_10567870 3300025917 Bacteria 923
426 Ga0207662_10115890 3300025918 Bacteria 1675
427 Ga0207657_10003760 3300025919 Bacteria 16129
428 Ga0207657_10006383 3300025919 Bacteria 12243
429 Ga0207657_10009915 3300025919 Bacteria 9533
430 Ga0207657_10012863 3300025919 Bacteria 8230
431 Ga0207657_10018812 3300025919 Bacteria 6578
432 Ga0207657_10029194 3300025919 Bacteria 5023
433 Ga0207657_10031527 3300025919 Bacteria 4800
434 Ga0207657_10033201 3300025919 Bacteria 4654
435 Ga0207657_10063108 3300025919 Bacteria 3169
436 Ga0207657_10158296 3300025919 Bacteria 1841
437 Ga0207657_10400293 3300025919 Bacteria 1080
438 Ga0207649_10007985 3300025920 Bacteria 5757
439 Ga0207649_10014080 3300025920 Bacteria 4476
440 Ga0207649_10020769 3300025920 Bacteria 3770
441 Ga0207649_10036628 3300025920 Bacteria 2957
442 Ga0207649_10038576 3300025920 Bacteria 2893
443 Ga0207649_10047823 3300025920 Bacteria 2635
444 Ga0207649_10056556 3300025920 Bacteria 2450
445 Ga0207649_10083659 3300025920 Bacteria 2072
446 Ga0207649_10247969 3300025920 Bacteria 1281
447 Ga0207649_10629857 3300025920 Bacteria 827
448 Ga0207652_10032054 3300025921 Bacteria 4414
449 Ga0207652_10081876 3300025921 Bacteria 2824
450 Ga0207652_10092503 3300025921 Bacteria 2660
451 Ga0207652_10093149 3300025921 Bacteria 2651
452 Ga0207652_10305724 3300025921 Bacteria 1435
453 Ga0207681_10001333 3300025923 Bacteria 15917
454 Ga0207681_10024034 3300025923 Bacteria 3906
455 Ga0207681_10044200 3300025923 Bacteria 2985
456 Ga0207681_10048614 3300025923 Bacteria 2863
457 Ga0207681_10145162 3300025923 Bacteria 1772
458 Ga0207694_10000526 3300025924 Bacteria 34586
459 Ga0207694_10094782 3300025924 Bacteria 2359
460 Ga0207694_10097636 3300025924 Bacteria 2324
461 Ga0207694_10461466 3300025924 Bacteria 1061
462 Ga0207650_10035137 3300025925 Bacteria 3637
463 Ga0207650_10047869 3300025925 Bacteria 3152
464 Ga0207650_10053878 3300025925 Bacteria 2982
465 Ga0207650_10232112 3300025925 Bacteria 1488
466 Ga0207650_10286116 3300025925 Bacteria 1343
467 Ga0207650_10362481 3300025925 Bacteria 1194
468 Ga0207659_10049665 3300025926 Bacteria 2977
469 Ga0207659_10094303 3300025926 Bacteria 2242
470 Ga0207687_10019136 3300025927 Bacteria 4534
471 Ga0207687_10113424 3300025927 Bacteria 2016
472 Ga0207700_10046656 3300025928 Bacteria 3206
473 Ga0207664_10168925 3300025929 Bacteria 1870
474 Ga0207644_10000153 3300025931 Bacteria 49585
475 Ga0207644_10005857 3300025931 Bacteria 8010
476 Ga0207644_10007605 3300025931 Bacteria 7064
477 Ga0207644_10095947 3300025931 Bacteria 2218
478 Ga0207644_10133807 3300025931 Bacteria 1901
479 Ga0207690_10004613 3300025932 Bacteria 8148
480 Ga0207690_10008302 3300025932 Bacteria 6160
481 Ga0207690_10023437 3300025932 Bacteria 3851
482 Ga0207690_10026011 3300025932 Bacteria 3683
483 Ga0207690_10034199 3300025932 Bacteria 3273
484 Ga0207690_10080295 3300025932 Bacteria 2276
485 Ga0207690_10102967 3300025932 Bacteria 2042
486 Ga0207690_10387273 3300025932 Bacteria 1112
487 Ga0207690_10520503 3300025932 Bacteria 964
488 Ga0207690_10783087 3300025932 Bacteria 787
489 Ga0207706_10000171 3300025933 Bacteria 72122
490 Ga0207706_10000285 3300025933 Bacteria 55179
491 Ga0207706_10000475 3300025933 Bacteria 42955
492 Ga0207706_10005076 3300025933 Bacteria 12297
493 Ga0207706_10005820 3300025933 Bacteria 11468
494 Ga0207706_10022887 3300025933 Bacteria 5608
495 Ga0207706_10149497 3300025933 Bacteria 2054
496 Ga0207706_10233611 3300025933 Bacteria 1608
497 Ga0207706_10257088 3300025933 Bacteria 1525
498 Ga0207706_10860659 3300025933 Bacteria 767
499 Ga0207686_10085188 3300025934 Bacteria 2072
500 Ga0207686_10219239 3300025934 Bacteria 1373
501 Ga0207709_10037183 3300025935 Bacteria 2891
502 Ga0207709_10046377 3300025935 Bacteria 2637
503 Ga0207669_10268808 3300025937 Bacteria 1279
504 Ga0207669_10433910 3300025937 Bacteria 1037
505 Ga0207704_10001327 3300025938 Bacteria 11039
506 Ga0207704_10004215 3300025938 Bacteria 6570
507 Ga0207704_10050424 3300025938 Bacteria 2511
508 Ga0207691_10001864 3300025940 Bacteria 20610
509 Ga0207691_10003885 3300025940 Bacteria 14507
510 Ga0207691_10007857 3300025940 Bacteria 10275
511 Ga0207691_10045206 3300025940 Bacteria 4049
512 Ga0207691_10365532 3300025940 Bacteria 1233
513 Ga0207691_10370089 3300025940 Bacteria 1224
514 Ga0207711_10000100 3300025941 Bacteria 91024
515 Ga0207711_10000500 3300025941 Bacteria 40435
516 Ga0207711_10001810 3300025941 Bacteria 19532
517 Ga0207711_10005339 3300025941 Bacteria 10896
518 Ga0207711_10012350 3300025941 Bacteria 7097
519 Ga0207711_10020529 3300025941 Bacteria 5510
520 Ga0207711_10025677 3300025941 Bacteria 4940
521 Ga0207689_10000092 3300025942 Bacteria 73254
522 Ga0207689_10038849 3300025942 Bacteria 3940
523 Ga0207689_10048828 3300025942 Bacteria 3491
524 Ga0207661_10073659 3300025944 Bacteria 2798
525 Ga0207661_10308326 3300025944 Bacteria 1420
526 Ga0207661_10474479 3300025944 Bacteria 1141
527 Ga0207679_10002034 3300025945 Bacteria 12542
528 Ga0207679_10010347 3300025945 Bacteria 6003
529 Ga0207679_10013915 3300025945 Bacteria 5274
530 Ga0207679_10033414 3300025945 Bacteria 3619
531 Ga0207679_10060080 3300025945 Bacteria 2823
532 Ga0207679_10178170 3300025945 Bacteria 1756
533 Ga0207679_10243413 3300025945 Bacteria 1525
534 Ga0207679_10563574 3300025945 Bacteria 1023
535 Ga0207679_10566921 3300025945 Bacteria 1020
536 Ga0207667_10058246 3300025949 Bacteria 4053
537 Ga0207667_10061421 3300025949 Bacteria 3931
538 Ga0207667_10131929 3300025949 Bacteria 2573
539 Ga0207667_10145110 3300025949 Bacteria 2443
540 Ga0207667_10175188 3300025949 Bacteria 2204
541 Ga0207667_10328320 3300025949 Bacteria 1562
542 Ga0207651_10000176 3300025960 Bacteria 27858
543 Ga0207651_10001364 3300025960 Bacteria 11061
544 Ga0207651_10003307 3300025960 Bacteria 7899
545 Ga0207651_10004062 3300025960 Bacteria 7291
546 Ga0207651_10297741 3300025960 Bacteria 1340
547 Ga0207712_10000269 3300025961 Bacteria 50416
548 Ga0207712_10022653 3300025961 Bacteria 4139
549 Ga0207712_10025954 3300025961 Bacteria 3898
550 Ga0207668_10053589 3300025972 Bacteria 2796
551 Ga0207668_10390011 3300025972 Bacteria 1174
552 Ga0207668_10856474 3300025972 Bacteria 807
553 Ga0207640_10001999 3300025981 Bacteria 11002
554 Ga0207640_10015285 3300025981 Bacteria 4440
555 Ga0207640_10053877 3300025981 Bacteria 2628
556 Ga0207640_10116829 3300025981 Bacteria 1903
557 Ga0207640_10118287 3300025981 Bacteria 1893
558 Ga0207640_10206244 3300025981 Bacteria 1494
559 Ga0207640_10218441 3300025981 Bacteria 1457
560 Ga0207640_10465913 3300025981 Bacteria 1045
561 Ga0207658_10003101 3300025986 Bacteria 11895
562 Ga0207658_10003348 3300025986 Bacteria 11367
563 Ga0207658_10005467 3300025986 Bacteria 8714
564 Ga0207658_10015553 3300025986 Bacteria 5219
565 Ga0207658_10021272 3300025986 Bacteria 4500
566 Ga0207658_10030575 3300025986 Bacteria 3814
567 Ga0207658_10260199 3300025986 Bacteria 1478
568 Ga0207658_10312106 3300025986 Bacteria 1358
569 Ga0207677_10001085 3300026023 Bacteria 14802
570 Ga0207677_10001622 3300026023 Bacteria 11935
571 Ga0207677_10014561 3300026023 Bacteria 4598
572 Ga0207677_10024170 3300026023 Bacteria 3770
573 Ga0207677_10030556 3300026023 Bacteria 3440
574 Ga0207677_10071255 3300026023 Bacteria 2452
575 Ga0207677_10163017 3300026023 Bacteria 1734
576 Ga0207677_10339999 3300026023 Bacteria 1254
577 Ga0207703_10000515 3300026035 Bacteria 39972
578 Ga0207703_10006494 3300026035 Bacteria 9335
579 Ga0207703_10018762 3300026035 Bacteria 5403
580 Ga0207703_10040032 3300026035 Bacteria 3749
581 Ga0207703_10047247 3300026035 Bacteria 3470
582 Ga0207639_10000608 3300026041 Bacteria 24669
583 Ga0207639_10003016 3300026041 Bacteria 11334
584 Ga0207639_10044263 3300026041 Bacteria 3347
585 Ga0207639_10049433 3300026041 Bacteria 3189
586 Ga0207639_10088149 3300026041 Bacteria 2475
587 Ga0207639_10265952 3300026041 Bacteria 1502
588 Ga0207678_10000198 3300026067 Bacteria 52573
589 Ga0207678_10005020 3300026067 Bacteria 11873
590 Ga0207678_10050142 3300026067 Bacteria 3607
591 Ga0207678_10163154 3300026067 Bacteria 1903
592 Ga0207678_10392464 3300026067 Bacteria 1201
593 Ga0207678_10447506 3300026067 Bacteria 1122
594 Ga0207678_10899288 3300026067 Bacteria 783
595 Ga0207708_10476585 3300026075 Bacteria 1043
596 Ga0207702_10003139 3300026078 Bacteria 15321
597 Ga0207702_10435193 3300026078 Bacteria 1270
598 Ga0207702_10585136 3300026078 Bacteria 1094
599 Ga0207641_10000221 3300026088 Bacteria 74390
600 Ga0207641_10019634 3300026088 Bacteria 5548
601 Ga0207641_10090279 3300026088 Bacteria 2679
602 Ga0207641_10093805 3300026088 Bacteria 2631
603 Ga0207641_10394425 3300026088 Bacteria 1328
604 Ga0207648_10008297 3300026089 Bacteria 10086
605 Ga0207648_10008508 3300026089 Bacteria 9929
606 Ga0207648_10142052 3300026089 Bacteria 2116
607 Ga0207648_10170700 3300026089 Bacteria 1922
608 Ga0207676_10001355 3300026095 Bacteria 18216
609 Ga0207676_10003246 3300026095 Bacteria 11578
610 Ga0207676_10017890 3300026095 Bacteria 5143
611 Ga0207676_10024995 3300026095 Bacteria 4428
612 Ga0207676_10039776 3300026095 Bacteria 3599
613 Ga0207676_10384360 3300026095 Bacteria 1307
614 Ga0207674_10000289 3300026116 Bacteria 63604
615 Ga0207674_10002023 3300026116 Bacteria 25726
616 Ga0207674_10005285 3300026116 Bacteria 15361
617 Ga0207674_10008247 3300026116 Bacteria 12064
618 Ga0207674_10010569 3300026116 Bacteria 10444
619 Ga0207674_10012968 3300026116 Bacteria 9294
620 Ga0207674_10014950 3300026116 Bacteria 8552
621 Ga0207674_10017852 3300026116 Bacteria 7734
622 Ga0207674_10024603 3300026116 Bacteria 6431
623 Ga0207674_10232301 3300026116 Bacteria 1792
624 Ga0207675_100200723 3300026118 Bacteria 1915
625 Ga0207675_100701205 3300026118 Bacteria 1021
626 Ga0207683_10013330 3300026121 Bacteria 7009
627 Ga0207683_10017765 3300026121 Bacteria 6066
628 Ga0207683_10019973 3300026121 Bacteria 5723
629 Ga0207683_10062438 3300026121 Bacteria 3281
630 Ga0207683_10280310 3300026121 Bacteria 1523
631 Ga0207698_10002078 3300026142 Bacteria 11807
632 Ga0207698_10011096 3300026142 Bacteria 5825
633 Ga0207698_10046967 3300026142 Bacteria 3266
634 Ga0207698_10059449 3300026142 Bacteria 2968
635 Ga0207698_10257512 3300026142 Bacteria 1601
636 Ga0207698_10301054 3300026142 Bacteria 1493
637 Ga0268266_10020335 3300028379 Bacteria 5659
638 Ga0268266_10043443 3300028379 Bacteria 3841
639 Ga0268265_10006869 3300028380 Bacteria 7701
640 Ga0268265_10019311 3300028380 Bacteria 4734
641 Ga0268265_10037750 3300028380 Bacteria 3547
642 Ga0268265_10148181 3300028380 Bacteria 1975
643 Ga0268265_10165530 3300028380 Bacteria 1884
644 Ga0268264_10001272 3300028381 Bacteria 23913
645 Ga0268264_10168710 3300028381 Unclassified 1978
646 Ga0268264_10314142 3300028381 Bacteria 1479
647 Ga0307513_10241698 3300031456 Bacteria 1610
648 Ga0307408_100163414 3300031548 Bacteria 1770
649 Ga0307405_10153888 3300031731 Bacteria 1620
650 Ga0307413_10052610 3300031824 Bacteria 2460
651 Ga0307410_10070751 3300031852 Bacteria 2417
652 Ga0307406_10163627 3300031901 Bacteria 1602
653 Ga0307407_10106963 3300031903 Bacteria 1748
654 Ga0307416_100001051 3300032002 Bacteria 14704
655 Ga0307416_100352768 3300032002 Bacteria 1489
656 Ga0307411_10008224 3300032005 Bacteria 5387
657 Ga0307411_10045608 3300032005 Bacteria 2820
658 Ga0307415_100028704 3300032126 Bacteria 3544
659 Ga0307415_100231058 3300032126 Bacteria 1489
660 Ga0373960_0049686 3300035121 Bacteria 1241
661 Ga0373961_0151761 3300035241 Bacteria 790
662 Ga0373931_0008844 3300035691 Bacteria 4794
663 Ga0395899_0004324 3300037312 Bacteria 11091
664 Ga0395899_0017239 3300037312 Bacteria 5503
665 Ga0395899_0045405 3300037312 Bacteria 3274
666 Ga0395899_0048319 3300037312 Bacteria 3167
667 Ga0395899_0053004 3300037312 Bacteria 3005
668 Ga0395899_0082740 3300037312 Bacteria 2334
669 Ga0395899_0083095 3300037312 Bacteria 2329
670 Ga0395899_0088232 3300037312 Bacteria 2250
671 Ga0395899_0092886 3300037312 Bacteria 2184
672 Ga0395899_0271669 3300037312 Bacteria 1156
673 Ga0395900_0006151 3300037418 Bacteria 12530
674 Ga0395900_0017917 3300037418 Bacteria 7228
675 Ga0395900_0020464 3300037418 Bacteria 6754
676 Ga0395900_0047856 3300037418 Bacteria 4405
677 Ga0395900_0056737 3300037418 Bacteria 4031
678 Ga0395900_0064840 3300037418 Bacteria 3752
679 Ga0395900_0150795 3300037418 Bacteria 2375
680 Ga0395900_0183405 3300037418 Bacteria 2125
681 Ga0395900_0213973 3300037418 Bacteria 1945
682 Ga0395900_0509161 3300037418 Bacteria 1153
683 Ga0395900_0645391 3300037418 Bacteria 995
684 Ga0395900_0653863 3300037418 Bacteria 987
685 Ga0395898_0023032 3300037466 Bacteria 6297
686 Ga0395898_0050360 3300037466 Bacteria 4076
687 Ga0395898_0124595 3300037466 Bacteria 2468
688 Ga0395898_0151677 3300037466 Bacteria 2217
689 Ga0395898_0155353 3300037466 Bacteria 2188
690 Ga0395898_0206294 3300037466 Bacteria 1875
691 Ga0395898_0224760 3300037466 Bacteria 1790
692 Ga0395898_0270530 3300037466 Bacteria 1621
693 Ga0395905_0005211 3300037471 Bacteria 13309
694 Ga0395905_0010192 3300037471 Bacteria 9158
695 Ga0395905_0011956 3300037471 Bacteria 8368
696 Ga0395905_0012382 3300037471 Bacteria 8212
697 Ga0395905_0020935 3300037471 Bacteria 6193
698 Ga0395905_0041275 3300037471 Bacteria 4330
699 Ga0395905_0048551 3300037471 Bacteria 3978
700 Ga0395905_0062329 3300037471 Bacteria 3488
701 Ga0395905_0063031 3300037471 Bacteria 3468
702 Ga0395905_0070193 3300037471 Bacteria 3282
703 Ga0395905_0084089 3300037471 Bacteria 2981
704 Ga0395905_0159056 3300037471 Bacteria 2124
705 Ga0395905_0172863 3300037471 Bacteria 2029
706 Ga0395905_0175258 3300037471 Bacteria 2013
707 Ga0395905_0199371 3300037471 Bacteria 1876
708 Ga0395905_0572280 3300037471 Bacteria 1031
709 Ga0395905_0702758 3300037471 Bacteria 913
710 Ga0395901_0017856 3300038443 Bacteria 7241
711 Ga0395901_0040781 3300038443 Bacteria 4808
712 Ga0395901_0050788 3300038443 Bacteria 4307
713 Ga0395901_0115821 3300038443 Bacteria 2815
714 Ga0395901_0157330 3300038443 Bacteria 2386
715 Ga0395901_0165883 3300038443 Bacteria 2319
716 Ga0395901_0196843 3300038443 Bacteria 2113
717 Ga0395901_0200510 3300038443 Bacteria 2092
718 Ga0395901_0257029 3300038443 Bacteria 1819
719 Ga0395901_0490112 3300038443 Bacteria 1252
720 Ga0395901_1005901 3300038443 Bacteria 809
721 Ga0450917_001793 3300042120 Bacteria 1523
722 Ga0450890_003675 3300042127 Bacteria 2029
723 Ga0450905_001142 3300042142 Bacteria 3356
724 Ga0450889_000350 3300042144 Bacteria 5152
725 Ga0466965_0151491 3300044683 Bacteria 1212
726 Ga0466966_0241909 3300044684 Bacteria 1088
727 Ga0466961_0122559 3300044693 Bacteria 1631
728 Ga0466963_0000971 3300044694 Bacteria 14730
729 Ga0466963_0024216 3300044694 Bacteria 3864
730 Ga0466964_0007482 3300044706 Bacteria 4087
731 Ga0466964_0022207 3300044706 Bacteria 2460
732 Ga0466971_0133611 3300044719 Bacteria 1153
733 Ga0466971_0140157 3300044719 Bacteria 1126
734 Ga0466968_0012551 3300044735 Bacteria 3319
735 Ga0466970_0017074 3300044765 Bacteria 3747
736 Ga0466957_0002813 3300044842 Bacteria 9412
737 Ga0466957_0201129 3300044842 Bacteria 1308
738 Ga0466957_0575022 3300044842 Bacteria 787
739 Ga0466959_0046031 3300045049 Bacteria 3211
740 Ga0466958_0012491 3300045836 Bacteria 4813
741 Ga0466958_0021618 3300045836 Bacteria 3762
742 Ga0466958_0412010 3300045836 Bacteria 873
743 Ga0466967_0000483 3300045976 Bacteria 19324
744 Ga0466967_0005574 3300045976 Bacteria 8749
745 Ga0466967_0037141 3300045976 Bacteria 4165
746 Ga0466967_0053032 3300045976 Bacteria 3563
747 Ga0466967_0067913 3300045976 Bacteria 3181
748 Ga0466967_0085199 3300045976 Bacteria 2861
749 Ga0466967_0086948 3300045976 Bacteria 2833
750 Ga0466967_0205320 3300045976 Bacteria 1867
751 Ga0466967_0332490 3300045976 Bacteria 1467
752 Ga0495643_0296996 3300046522 Bacteria 738
753 Ga0495669_0017334 3300046684 Bacteria 3090
754 Ga0496100_0003674 3300048903 Bacteria 8031
755 Ga0496101_0007198 3300048904 Bacteria 7201
756 Ga0496101_0014020 3300048904 Bacteria 5383
757 Ga0496101_0034250 3300048904 Bacteria 3586
758 Ga0496102_0024679 3300048905 Bacteria 5346
759 Ga0496102_0042681 3300048905 Bacteria 4110
760 Ga0496102_0761821 3300048905 Bacteria 891
761 Ga0496103_0017232 3300048906 Bacteria 4321
762 Ga0496103_0035101 3300048906 Bacteria 3069
763 Ga0496104_0016380 3300048907 Bacteria 6733
764 Ga0496105_0089565 3300048908 Bacteria 2541
765 Ga0496106_0017372 3300048909 Bacteria 5324
766 Ga0496106_0022594 3300048909 Bacteria 4675
767 Ga0496106_0073993 3300048909 Bacteria 2607
768 Ga0496107_0001919 3300048910 Bacteria 13202
769 Ga0496107_0008085 3300048910 Bacteria 7264
770 Ga0496107_0013909 3300048910 Bacteria 5627
771 Ga0496107_0025380 3300048910 Bacteria 4196
772 Ga0496107_0213578 3300048910 Bacteria 1435
773 Ga0496108_0007036 3300048911 Bacteria 9109
774 Ga0496108_0019391 3300048911 Bacteria 5584
775 Ga0496108_0038075 3300048911 Bacteria 4006
776 Ga0496108_0171171 3300048911 Bacteria 1879
777 Ga0496108_0262193 3300048911 Bacteria 1504
778 Ga0496109_0001378 3300048912 Bacteria 20162
779 Ga0496109_0006003 3300048912 Bacteria 10202
780 Ga0496109_0024990 3300048912 Bacteria 5317
781 Ga0496109_0132879 3300048912 Bacteria 2324
782 Ga0496109_0374775 3300048912 Bacteria 1344
783 Ga0496109_0924964 3300048912 Bacteria 810
784 Ga0496110_0000655 3300048913 Bacteria 23617
785 Ga0496110_0007568 3300048913 Bacteria 8677
786 Ga0496110_0023977 3300048913 Bacteria 5196
787 Ga0496110_0106037 3300048913 Bacteria 2522
788 Ga0496110_0174948 3300048913 Bacteria 1948
789 Ga0496111_0003769 3300048914 Bacteria 9441
790 Ga0496111_0009402 3300048914 Bacteria 6521
791 Ga0496111_0017619 3300048914 Bacteria 4938
792 Ga0496111_0021952 3300048914 Bacteria 4463
793 Ga0496112_0004292 3300048915 Bacteria 12040
794 Ga0496112_0005909 3300048915 Bacteria 10673
795 Ga0496112_0010224 3300048915 Bacteria 8506
796 Ga0496112_0021948 3300048915 Bacteria 6075
797 Ga0496112_0028086 3300048915 Bacteria 5428
798 Ga0496112_0028191 3300048915 Bacteria 5417
799 Ga0496113_0011850 3300048916 Bacteria 5841
800 Ga0496113_0032544 3300048916 Bacteria 3789
801 Ga0496113_0053445 3300048916 Bacteria 3020
802 Ga0496113_0154398 3300048916 Bacteria 1812
803 Ga0496115_0011486 3300048918 Bacteria 6641
804 Ga0501069_0134016 3300049585 Bacteria 1420
805 Ga0501207_020860 3300049654 Bacteria 1049
806 Ga0501224_015813 3300049664 Bacteria 1119
807 Ga0501249_006048 3300049679 Bacteria 2484
808 Ga0501249_020324 3300049679 Bacteria 1444
809 Ga0501212_014867 3300049851 Bacteria 1156
810 nmdc:mga05p37_865341_c1 3300050507 Bacteria 979
811 nmdc:mga0n895_729095_c1 3300050512 Bacteria 985
812 nmdc:mga0a205_6246_c1 3300050515 Bacteria 10755
813 Ga0466962_0083596 3300061719 Bacteria 1527
814 Ga0466962_0109401 3300061719 Bacteria 1330
815 2885429523 2885427238 Bacteria 2291351
816 Ga0070691_10002514
817 JGI24736J21556_1007039
818 JGI24736J21556_1020772
819 JGI24741J21665_1016005
820 JGI24740J21852_10005218
821 JGI24740J21852_10014388
822 JGI24740J21852_10025312
823 JGI24740J21852_10026704
824 JGI24740J21852_10044901
825 JGI24739J22299_10000129
826 JGI24739J22299_10005090
827 JGI24739J22299_10012295
828 JGI24737J22298_10000357
829 JGI24737J22298_10040939
830 JGI24735J21928_10001481
831 JGI24735J21928_10048335
832 JGI24738J21930_10002016
833 JGI24738J21930_10013308
834 Ga0065715_10040526
835 Ga0065715_10325170
836 Ga0070658_10005892
837 Ga0070658_10044040
838 Ga0070658_10136009
839 Ga0070658_10192122
840 Ga0070658_10413189
841 Ga0070658_10505309
842 Ga0070658_10753299
843 Ga0070676_10344712
844 Ga0070676_10655224
845 Ga0070683_100012234
846 Ga0070683_100121722
847 Ga0070690_100011023
848 Ga0070690_100043088
849 Ga0070670_100000265
850 Ga0070670_100003781
851 Ga0070670_100014349
852 Ga0070670_100029602
853 Ga0070670_100055734
854 Ga0070670_100092939
855 Ga0068869_100000331
856 Ga0068869_100049115
857 Ga0070666_10000822
858 Ga0070666_10020480
859 Ga0070666_10020767
860 Ga0070666_10044857
861 Ga0070666_10176429
862 Ga0070680_100041495
863 Ga0070680_100052095
864 Ga0070680_100168597
865 Ga0070682_100087002
866 Ga0070682_100095657
867 Ga0068868_100000156
868 Ga0068868_100002559
869 Ga0068868_100006614
870 Ga0068868_100159878
871 Ga0068868_100574744
872 Ga0070660_100007081
873 Ga0070660_100026563
874 Ga0070660_100030049
875 Ga0070660_100043478
876 Ga0070660_100080989
877 Ga0070660_100085471
878 Ga0070660_100145148
879 Ga0070660_100153516
880 Ga0070660_100304788
881 Ga0070660_100392678
882 Ga0070660_100489185
883 Ga0070689_100177195
884 Ga0070661_100005185
885 Ga0070661_100008741
886 Ga0070661_100025985
887 Ga0070661_100039022
888 Ga0070661_100073103
889 Ga0070661_100087901
890 Ga0070661_100107056
891 Ga0070661_100140266
892 Ga0070661_100159417
893 Ga0070661_100519858
894 Ga0070692_10042346
895 Ga0070668_100531194
896 Ga0070669_100012144
897 Ga0070669_100074505
898 Ga0070669_100097848
899 Ga0070669_100695846
900 Ga0070675_100024135
901 Ga0070675_100038524
902 Ga0070675_100051454
903 Ga0070675_100359812
904 Ga0070671_100002678
905 Ga0070671_100003224
906 Ga0070671_100004595
907 Ga0070671_100013820
908 Ga0070671_100027301
909 Ga0070671_100033667
910 Ga0070671_100127406
911 Ga0070671_100136445
912 Ga0070671_100158747
913 Ga0070671_100274132
914 Ga0070674_100067730
915 Ga0070674_100091992
916 Ga0070673_100000249
917 Ga0070673_100004605
918 Ga0070673_100012814
919 Ga0070673_100140299
920 Ga0070673_100315730
921 Ga0070673_100564901
922 Ga0070659_100000814
923 Ga0070659_100001062
924 Ga0070659_100010645
925 Ga0070659_100012093
926 Ga0070659_100017466
927 Ga0070659_100026998
928 Ga0070659_100054621
929 Ga0070659_100225735
930 Ga0070659_100232702
931 Ga0070659_100302972
932 Ga0070659_100405156
933 Ga0070667_100001760
934 Ga0070667_100001996
935 Ga0070667_100003528
936 Ga0070667_100005936
937 Ga0070667_100012097
938 Ga0070667_100053246
939 Ga0070667_100143007
940 Ga0070714_100155481
941 Ga0070713_100159477
942 Ga0070694_100001882
943 Ga0070663_100097433
944 Ga0070663_100115393
945 Ga0070663_100287288
946 Ga0070663_100316344
947 Ga0070663_100440855
948 Ga0070678_100002527
949 Ga0070678_100012520
950 Ga0070678_100044701
951 Ga0070678_100432324
952 Ga0070662_100001186
953 Ga0070662_100004435
954 Ga0070662_100011120
955 Ga0070662_100013318
956 Ga0070662_100066085
957 Ga0070662_100077558
958 Ga0070662_100296442
959 Ga0070662_100305270
960 Ga0070662_100475685
961 Ga0070662_100735687
962 Ga0070681_10004466
963 Ga0070681_10011820
964 Ga0070681_10032773
965 Ga0070681_10234222
966 Ga0068867_100006496
967 Ga0068867_100228551
968 Ga0070679_100051106
969 Ga0070679_100092329
970 Ga0070679_100097574
971 Ga0070679_100420110
972 Ga0070684_100346971
973 Ga0070684_100356693
974 Ga0068853_100003189
975 Ga0068853_100016758
976 Ga0068853_100028037
977 Ga0068853_100040515
978 Ga0068853_100180284
979 Ga0068853_100279082
980 Ga0070672_100004112
981 Ga0070672_100024836
982 Ga0070672_100151707
983 Ga0070672_100359766
984 Ga0070672_100424675
985 Ga0070686_100015812
986 Ga0070686_100057824
987 Ga0070696_100018036
988 Ga0070696_100029511
989 Ga0070693_100003535
990 Ga0070693_100021052
991 Ga0070693_100037986
992 Ga0070693_100159193
993 Ga0070665_100014720
994 Ga0070665_100131970
995 Ga0070704_100249319
996 Ga0068855_100013435
997 Ga0068855_100020021
998 Ga0068855_100023602
999 Ga0068855_100278870
1000 Ga0068855_100395288
1001 Ga0068855_100656999
1002 Ga0070664_100001299
1003 Ga0070664_100002185
1004 Ga0070664_100003024
1005 Ga0070664_100009071
1006 Ga0070664_100045653
1007 Ga0070664_100079032
1008 Ga0070664_100104994
1009 Ga0070664_100195872
1010 Ga0070664_100323245
1011 Ga0070664_100418787
1012 Ga0070664_100581111
1013 Ga0068857_100001148
1014 Ga0068857_100006203
1015 Ga0068857_100044306
1016 Ga0068857_100088327
1017 Ga0068857_100112604
1018 Ga0068857_100460894
1019 Ga0068854_100002969
1020 Ga0068854_100006117
1021 Ga0068854_100026095
1022 Ga0068854_100077420
1023 Ga0068854_100086439
1024 Ga0068854_100209141
1025 Ga0068854_100620088
1026 Ga0068856_100009206
1027 Ga0068856_100052761
1028 Ga0068856_100060282
1029 Ga0068852_100004156
1030 Ga0068852_100014972
1031 Ga0068852_100018232
1032 Ga0068852_100042943
1033 Ga0068852_100048261
1034 Ga0068852_100121347
1035 Ga0068852_100191425
1036 Ga0068852_100200478
1037 Ga0068852_100223037
1038 Ga0068859_100000324
1039 Ga0068859_100000778
1040 Ga0068859_100008048
1041 Ga0068859_100009708
1042 Ga0068859_100115745
1043 Ga0068859_100296654
1044 Ga0068859_100450897
1045 Ga0068864_100000291
1046 Ga0068864_100000795
1047 Ga0068864_100005333
1048 Ga0068864_100010009
1049 Ga0068864_100013911
1050 Ga0068864_100018948
1051 Ga0068864_100385213
1052 Ga0068866_10010582
1053 Ga0068866_10090526
1054 Ga0068861_100147661
1055 Ga0068851_10004289
1056 Ga0068851_10016630
1057 Ga0068851_10105626
1058 Ga0068851_10228726
1059 Ga0068863_100000921
1060 Ga0068863_100003770
1061 Ga0068863_100006534
1062 Ga0068863_100009599
1063 Ga0068863_100016913
1064 Ga0068863_100198637
1065 Ga0068863_100389594
1066 Ga0068863_100596349
1067 Ga0068858_100002150
1068 Ga0068858_100003884
1069 Ga0068858_100012006
1070 Ga0068858_100015011
1071 Ga0068858_100026394
1072 Ga0068858_100028763
1073 Ga0068858_100057247
1074 Ga0068860_100001686
1075 Ga0068860_100001926
1076 Ga0068860_100035697
1077 Ga0068860_100180454
1078 Ga0068860_100246471
1079 Ga0068860_100870034
1080 Ga0068862_100012981
1081 Ga0068862_100014186
1082 Ga0068862_100086339
1083 Ga0068862_100099295
1084 Ga0068862_100243650
1085 Ga0081539_10004604
1086 Ga0070717_10007485
1087 Ga0097621_100003293
1088 Ga0097621_100027506
1089 Ga0097621_100216581
1090 Ga0097621_100623540
1091 Ga0068871_100010557
1092 Ga0068871_100037362
1093 Ga0068871_100255689
1094 Ga0075428_100187961
1095 Ga0075431_100152629
1096 Ga0075433_10040363
1097 Ga0068865_100002393
1098 Ga0068865_100003247
1099 Ga0068865_100062114
1100 Ga0097620_100000324
1101 Ga0097620_100000778
1102 Ga0097620_100008050
1103 Ga0097620_100009708
1104 Ga0097620_100115745
1105 Ga0097620_100296639
1106 Ga0097620_100372599
1107 Ga0097620_100450856
1108 Ga0075435_100886954
1109 Ga0105240_10102578
1110 Ga0105240_10285232
1111 Ga0111539_10046155
1112 Ga0105245_10000326
1113 Ga0105245_10035058
1114 Ga0105247_10059897
1115 Ga0105243_10118825
1116 Ga0105243_10137328
1117 Ga0105243_10154793
1118 Ga0105243_10199262
1119 Ga0105241_10311422
1120 Ga0105241_10681676
1121 Ga0105241_10684095
1122 Ga0105242_10215922
1123 Ga0105242_10954479
1124 Ga0105248_10000123
1125 Ga0105248_10000159
1126 Ga0105248_10003349
1127 Ga0105248_10008341
1128 Ga0105248_10032008
1129 Ga0105248_10068988
1130 Ga0105248_10152882
1131 Ga0105237_10014626
1132 Ga0105237_10104049
1133 Ga0105238_10029725
1134 Ga0105238_10045399
1135 Ga0105238_10074687
1136 Ga0105238_10370272
1137 Ga0105249_10002812
1138 Ga0105249_10027144
1139 Ga0105249_10042437
1140 Ga0105249_10902449
1141 Ga0105239_10088620
1142 Ga0105239_10139049
1143 Ga0105239_10265154
1144 Ga0105246_10007596
1145 Ga0105246_10035563
1146 Ga0157373_10025715
1147 Ga0157373_10028470
1148 Ga0157373_10031567
1149 Ga0157373_10048670
1150 Ga0157373_10142175
1151 Ga0157373_10314773
1152 Ga0157371_10042144
1153 Ga0157371_10043433
1154 Ga0157371_10117565
1155 Ga0157371_10158325
1156 Ga0157370_10408331
1157 Ga0157369_10001821
1158 Ga0157369_10471240
1159 Ga0157369_10636344
1160 Ga0157374_10007961
1161 Ga0157374_10037887
1162 Ga0157378_10017601
1163 Ga0157378_10217415
1164 Ga0157378_10275325
1165 Ga0163162_10000839
1166 Ga0163162_10020519
1167 Ga0163162_10032585
1168 Ga0163162_10106474
1169 Ga0163162_10122547
1170 Ga0157372_10007786
1171 Ga0157372_10038030
1172 Ga0157372_10044456
1173 Ga0157372_10069626
1174 Ga0157372_10467149
1175 Ga0157375_10012608
1176 Ga0157375_10030402
1177 Ga0157375_10280627
1178 Ga0163163_10001003
1179 Ga0163163_10002107
1180 Ga0163163_10006230
1181 Ga0163163_10028144
1182 Ga0157380_10491759
1183 Ga0182008_10026040
1184 Ga0157377_10069321
1185 Ga0157379_10033238
1186 Ga0157379_10051067
1187 Ga0157379_10226307
1188 Ga0157379_10485817
1189 Ga0157379_10685220
1190 Ga0157376_10004128
1191 Ga0207697_10000584
1192 Ga0207656_10001997
1193 Ga0207656_10025612
1194 Ga0207656_10143178
1195 Ga0207642_10010293
1196 Ga0207642_10073951
1197 Ga0207642_10274063
1198 Ga0207710_10034795
1199 Ga0207710_10055450
1200 Ga0207688_10004411
1201 Ga0207680_10001404
1202 Ga0207680_10025443
1203 Ga0207647_10000575
1204 Ga0207647_10001244
1205 Ga0207647_10002145
1206 Ga0207647_10002864
1207 Ga0207647_10033790
1208 Ga0207647_10075157
1209 Ga0207647_10086300
1210 Ga0207647_10096088
1211 Ga0207647_10202596
1212 Ga0207645_10001233
1213 Ga0207645_10030785
1214 Ga0207645_10039751
1215 Ga0207645_10152444
1216 Ga0207645_10201432
1217 Ga0207645_10260884
1218 Ga0207705_10007837
1219 Ga0207705_10018858
1220 Ga0207705_10033458
1221 Ga0207705_10035309
1222 Ga0207705_10048695
1223 Ga0207705_10083585
1224 Ga0207705_10102558
1225 Ga0207705_10102877
1226 Ga0207705_10138815
1227 Ga0207705_10167853
1228 Ga0207705_10602809
1229 Ga0207654_10261953
1230 Ga0207654_10284114
1231 Ga0207707_10011234
1232 Ga0207707_10030054
1233 Ga0207707_10155416
1234 Ga0207695_10030232
1235 Ga0207671_10079430
1236 Ga0207671_10227897
1237 Ga0207671_10450844
1238 Ga0207660_10092580
1239 Ga0207660_10131797
1240 Ga0207660_10567870
1241 Ga0207662_10115890
1242 Ga0207657_10003760
1243 Ga0207657_10006383
1244 Ga0207657_10009915
1245 Ga0207657_10012863
1246 Ga0207657_10018812
1247 Ga0207657_10029194
1248 Ga0207657_10031527
1249 Ga0207657_10033201
1250 Ga0207657_10063108
1251 Ga0207657_10158296
1252 Ga0207657_10400293
1253 Ga0207649_10007985
1254 Ga0207649_10014080
1255 Ga0207649_10020769
1256 Ga0207649_10036628
1257 Ga0207649_10038576
1258 Ga0207649_10047823
1259 Ga0207649_10056556
1260 Ga0207649_10083659
1261 Ga0207649_10247969
1262 Ga0207649_10629857
1263 Ga0207652_10032054
1264 Ga0207652_10081876
1265 Ga0207652_10092503
1266 Ga0207652_10093149
1267 Ga0207652_10305724
1268 Ga0207681_10001333
1269 Ga0207681_10024034
1270 Ga0207681_10044200
1271 Ga0207681_10048614
1272 Ga0207681_10145162
1273 Ga0207694_10000526
1274 Ga0207694_10094782
1275 Ga0207694_10097636
1276 Ga0207694_10461466
1277 Ga0207650_10035137
1278 Ga0207650_10047869
1279 Ga0207650_10053878
1280 Ga0207650_10232112
1281 Ga0207650_10286116
1282 Ga0207650_10362481
1283 Ga0207659_10049665
1284 Ga0207659_10094303
1285 Ga0207687_10019136
1286 Ga0207687_10113424
1287 Ga0207700_10046656
1288 Ga0207664_10168925
1289 Ga0207644_10000153
1290 Ga0207644_10005857
1291 Ga0207644_10007605
1292 Ga0207644_10095947
1293 Ga0207644_10133807
1294 Ga0207690_10004613
1295 Ga0207690_10008302
1296 Ga0207690_10023437
1297 Ga0207690_10026011
1298 Ga0207690_10034199
1299 Ga0207690_10080295
1300 Ga0207690_10102967
1301 Ga0207690_10387273
1302 Ga0207690_10520503
1303 Ga0207690_10783087
1304 Ga0207706_10000171
1305 Ga0207706_10000285
1306 Ga0207706_10000475
1307 Ga0207706_10005076
1308 Ga0207706_10005820
1309 Ga0207706_10022887
1310 Ga0207706_10149497
1311 Ga0207706_10233611
1312 Ga0207706_10257088
1313 Ga0207706_10860659
1314 Ga0207686_10085188
1315 Ga0207686_10219239
1316 Ga0207709_10037183
1317 Ga0207709_10046377
1318 Ga0207669_10268808
1319 Ga0207669_10433910
1320 Ga0207704_10001327
1321 Ga0207704_10004215
1322 Ga0207704_10050424
1323 Ga0207691_10001864
1324 Ga0207691_10003885
1325 Ga0207691_10007857
1326 Ga0207691_10045206
1327 Ga0207691_10365532
1328 Ga0207691_10370089
1329 Ga0207711_10000100
1330 Ga0207711_10000500
1331 Ga0207711_10001810
1332 Ga0207711_10005339
1333 Ga0207711_10012350
1334 Ga0207711_10020529
1335 Ga0207711_10025677
1336 Ga0207689_10000092
1337 Ga0207689_10038849
1338 Ga0207689_10048828
1339 Ga0207661_10073659
1340 Ga0207661_10308326
1341 Ga0207661_10474479
1342 Ga0207679_10002034
1343 Ga0207679_10010347
1344 Ga0207679_10013915
1345 Ga0207679_10033414
1346 Ga0207679_10060080
1347 Ga0207679_10178170
1348 Ga0207679_10243413
1349 Ga0207679_10563574
1350 Ga0207679_10566921
1351 Ga0207667_10058246
1352 Ga0207667_10061421
1353 Ga0207667_10131929
1354 Ga0207667_10145110
1355 Ga0207667_10175188
1356 Ga0207667_10328320
1357 Ga0207651_10000176
1358 Ga0207651_10001364
1359 Ga0207651_10003307
1360 Ga0207651_10004062
1361 Ga0207651_10297741
1362 Ga0207712_10000269
1363 Ga0207712_10022653
1364 Ga0207712_10025954
1365 Ga0207668_10053589
1366 Ga0207668_10390011
1367 Ga0207668_10856474
1368 Ga0207640_10001999
1369 Ga0207640_10015285
1370 Ga0207640_10053877
1371 Ga0207640_10116829
1372 Ga0207640_10118287
1373 Ga0207640_10206244
1374 Ga0207640_10218441
1375 Ga0207640_10465913
1376 Ga0207658_10003101
1377 Ga0207658_10003348
1378 Ga0207658_10005467
1379 Ga0207658_10015553
1380 Ga0207658_10021272
1381 Ga0207658_10030575
1382 Ga0207658_10260199
1383 Ga0207658_10312106
1384 Ga0207677_10001085
1385 Ga0207677_10001622
1386 Ga0207677_10014561
1387 Ga0207677_10024170
1388 Ga0207677_10030556
1389 Ga0207677_10071255
1390 Ga0207677_10163017
1391 Ga0207677_10339999
1392 Ga0207703_10000515
1393 Ga0207703_10006494
1394 Ga0207703_10018762
1395 Ga0207703_10040032
1396 Ga0207703_10047247
1397 Ga0207639_10000608
1398 Ga0207639_10003016
1399 Ga0207639_10044263
1400 Ga0207639_10049433
1401 Ga0207639_10088149
1402 Ga0207639_10265952
1403 Ga0207678_10000198
1404 Ga0207678_10005020
1405 Ga0207678_10050142
1406 Ga0207678_10163154
1407 Ga0207678_10392464
1408 Ga0207678_10447506
1409 Ga0207678_10899288
1410 Ga0207708_10476585
1411 Ga0207702_10003139
1412 Ga0207702_10435193
1413 Ga0207702_10585136
1414 Ga0207641_10000221
1415 Ga0207641_10019634
1416 Ga0207641_10090279
1417 Ga0207641_10093805
1418 Ga0207641_10394425
1419 Ga0207648_10008297
1420 Ga0207648_10008508
1421 Ga0207648_10142052
1422 Ga0207648_10170700
1423 Ga0207676_10001355
1424 Ga0207676_10003246
1425 Ga0207676_10017890
1426 Ga0207676_10024995
1427 Ga0207676_10039776
1428 Ga0207676_10384360
1429 Ga0207674_10000289
1430 Ga0207674_10002023
1431 Ga0207674_10005285
1432 Ga0207674_10008247
1433 Ga0207674_10010569
1434 Ga0207674_10012968
1435 Ga0207674_10014950
1436 Ga0207674_10017852
1437 Ga0207674_10024603
1438 Ga0207674_10232301
1439 Ga0207675_100200723
1440 Ga0207675_100701205
1441 Ga0207683_10013330
1442 Ga0207683_10017765
1443 Ga0207683_10019973
1444 Ga0207683_10062438
1445 Ga0207683_10280310
1446 Ga0207698_10002078
1447 Ga0207698_10011096
1448 Ga0207698_10046967
1449 Ga0207698_10059449
1450 Ga0207698_10257512
1451 Ga0207698_10301054
1452 Ga0268266_10020335
1453 Ga0268266_10043443
1454 Ga0268265_10006869
1455 Ga0268265_10019311
1456 Ga0268265_10037750
1457 Ga0268265_10148181
1458 Ga0268265_10165530
1459 Ga0268264_10001272
1460 Ga0268264_10168710
1461 Ga0268264_10314142
1462 Ga0307513_10241698
1463 Ga0307408_100163414
1464 Ga0307405_10153888
1465 Ga0307413_10052610
1466 Ga0307410_10070751
1467 Ga0307406_10163627
1468 Ga0307407_10106963
1469 Ga0307416_100001051
1470 Ga0307416_100352768
1471 Ga0307411_10008224
1472 Ga0307411_10045608
1473 Ga0307415_100028704
1474 Ga0307415_100231058
1475 Ga0373960_0049686
1476 Ga0373961_0151761
1477 Ga0373931_0008844
1478 Ga0395899_0004324
1479 Ga0395899_0017239
1480 Ga0395899_0045405
1481 Ga0395899_0048319
1482 Ga0395899_0053004
1483 Ga0395899_0082740
1484 Ga0395899_0083095
1485 Ga0395899_0088232
1486 Ga0395899_0092886
1487 Ga0395899_0271669
1488 Ga0395900_0006151
1489 Ga0395900_0017917
1490 Ga0395900_0020464
1491 Ga0395900_0047856
1492 Ga0395900_0056737
1493 Ga0395900_0064840
1494 Ga0395900_0150795
1495 Ga0395900_0183405
1496 Ga0395900_0213973
1497 Ga0395900_0509161
1498 Ga0395900_0645391
1499 Ga0395900_0653863
1500 Ga0395898_0023032
1501 Ga0395898_0050360
1502 Ga0395898_0124595
1503 Ga0395898_0151677
1504 Ga0395898_0155353
1505 Ga0395898_0206294
1506 Ga0395898_0224760
1507 Ga0395898_0270530
1508 Ga0395905_0005211
1509 Ga0395905_0010192
1510 Ga0395905_0011956
1511 Ga0395905_0012382
1512 Ga0395905_0020935
1513 Ga0395905_0041275
1514 Ga0395905_0048551
1515 Ga0395905_0062329
1516 Ga0395905_0063031
1517 Ga0395905_0070193
1518 Ga0395905_0084089
1519 Ga0395905_0159056
1520 Ga0395905_0172863
1521 Ga0395905_0175258
1522 Ga0395905_0199371
1523 Ga0395905_0572280
1524 Ga0395905_0702758
1525 Ga0395901_0017856
1526 Ga0395901_0040781
1527 Ga0395901_0050788
1528 Ga0395901_0115821
1529 Ga0395901_0157330
1530 Ga0395901_0165883
1531 Ga0395901_0196843
1532 Ga0395901_0200510
1533 Ga0395901_0257029
1534 Ga0395901_0490112
1535 Ga0395901_1005901
1536 Ga0450917_001793
1537 Ga0450890_003675
1538 Ga0450905_001142
1539 Ga0450889_000350
1540 Ga0466965_0151491
1541 Ga0466966_0241909
1542 Ga0466961_0122559
1543 Ga0466963_0000971
1544 Ga0466963_0024216
1545 Ga0466964_0007482
1546 Ga0466964_0022207
1547 Ga0466971_0133611
1548 Ga0466971_0140157
1549 Ga0466968_0012551
1550 Ga0466970_0017074
1551 Ga0466957_0002813
1552 Ga0466957_0201129
1553 Ga0466957_0575022
1554 Ga0466959_0046031
1555 Ga0466958_0012491
1556 Ga0466958_0021618
1557 Ga0466958_0412010
1558 Ga0466967_0000483
1559 Ga0466967_0005574
1560 Ga0466967_0037141
1561 Ga0466967_0053032
1562 Ga0466967_0067913
1563 Ga0466967_0085199
1564 Ga0466967_0086948
1565 Ga0466967_0205320
1566 Ga0466967_0332490
1567 Ga0495643_0296996
1568 Ga0495669_0017334
1569 Ga0496100_0003674
1570 Ga0496101_0007198
1571 Ga0496101_0014020
1572 Ga0496101_0034250
1573 Ga0496102_0024679
1574 Ga0496102_0042681
1575 Ga0496102_0761821
1576 Ga0496103_0017232
1577 Ga0496103_0035101
1578 Ga0496104_0016380
1579 Ga0496105_0089565
1580 Ga0496106_0017372
1581 Ga0496106_0022594
1582 Ga0496106_0073993
1583 Ga0496107_0001919
1584 Ga0496107_0008085
1585 Ga0496107_0013909
1586 Ga0496107_0025380
1587 Ga0496107_0213578
1588 Ga0496108_0007036
1589 Ga0496108_0019391
1590 Ga0496108_0038075
1591 Ga0496108_0171171
1592 Ga0496108_0262193
1593 Ga0496109_0001378
1594 Ga0496109_0006003
1595 Ga0496109_0024990
1596 Ga0496109_0132879
1597 Ga0496109_0374775
1598 Ga0496109_0924964
1599 Ga0496110_0000655
1600 Ga0496110_0007568
1601 Ga0496110_0023977
1602 Ga0496110_0106037
1603 Ga0496110_0174948
1604 Ga0496111_0003769
1605 Ga0496111_0009402
1606 Ga0496111_0017619
1607 Ga0496111_0021952
1608 Ga0496112_0004292
1609 Ga0496112_0005909
1610 Ga0496112_0010224
1611 Ga0496112_0021948
1612 Ga0496112_0028086
1613 Ga0496112_0028191
1614 Ga0496113_0011850
1615 Ga0496113_0032544
1616 Ga0496113_0053445
1617 Ga0496113_0154398
1618 Ga0496115_0011486
1619 Ga0501069_0134016
1620 Ga0501207_020860
1621 Ga0501224_015813
1622 Ga0501249_006048
1623 Ga0501249_020324
1624 Ga0501212_014867
1625 nmdc:mga05p37_865341_c1
1626 nmdc:mga0n895_729095_c1
1627 nmdc:mga0a205_6246_c1
1628 Ga0466962_0083596
1629 Ga0466962_0109401
1630 2885429523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

19

175

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.8743 8 221
3krv-assembly1.cif.gz_B the structure of potential metal-dependent hydrolase with cyclase activity 0.872 7 222
8hmo-assembly3.cif.gz_F crystal structure of metal-dependent hydrolase complexed with manganese from bacillus smithii 0.8673 8 223
8f9x-assembly2.cif.gz_D cyclase-phosphotriesterase from ruegeria pomeroyi dss-3 0.8609 8 221
8hmo-assembly3.cif.gz_E crystal structure of metal-dependent hydrolase complexed with manganese from bacillus smithii 0.8592 8 223
ID Description Score Start End Superfamily
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.872 7 222 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8558 8 221 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.854 8 221 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8478 7 222 3.50.30.50
af_O53929_16_261_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8464 10 221 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A3D0UM03-F1-model_v4 Cyclase 1 114 224 GO:0004061
GO:0019441
AF-A0A511Y8D7-F1-model_v4 Cyclase 0.9941 81 196 GO:0004061
GO:0019441
AF-A0A831X0Y5-F1-model_v4 Cyclase family protein 0.9863 118 224 GO:0004061
GO:0019441
AF-A0A511Y8D7-F1-model_v4 Cyclase 0.9857 81 196 GO:0004061
GO:0019441
AF-A0A358SSL1-F1-model_v4 Cyclase family protein 0.9788 84 223 GO:0004061
GO:0019441

Map