F482011
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 815 | 430 | 1630 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100468228|Ga0068864_1004682282 |
| Length | 203 |
| Sequence | VHIGHSPCSRRGFLWQIVSRLSPAMKLVILDRDGVINQDSDQFIKTPDEWHPIPGSLEAIAKLSHSGYRVVVASNQSGIGRGLLDMATLNAINDKMYKALAPLGGRIDALFYCPHPAEANCSCRKPKPGMFEDIARRFNISLNAVPSVGDSLRDMQACATAGCQPMLVLTGKGRKTLAAGDVPANTQVFEDLAEAVRKIIAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 199 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 200 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 204 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 205 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 206 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 226 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 229 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 230 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 371 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 372 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 373 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 374 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 375 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 376 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 377 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 378 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 379 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 380 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 381 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 382 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 383 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 384 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 385 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 386 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 387 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 388 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 389 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 390 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 391 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 392 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 393 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 394 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 395 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 396 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 397 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 398 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 399 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 400 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 401 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 402 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 403 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 404 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 405 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 406 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 407 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 408 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 409 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 410 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 411 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 412 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 413 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 414 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 415 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 416 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 417 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 418 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 419 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 420 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 421 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 422 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 423 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 424 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 425 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 426 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 427 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 428 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 429 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 430 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.17 |
| Metatranscriptomes | 1.47 |
| Isolates | 7.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.99 |
| Nodule | 1.47 |
| Rhizoplane | 1.47 |
| Rhizosphere | 82.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068864_100468228 | 3300005618 | Bacteria | 1208 |
| 2 | JGI24741J21665_1014130 | 3300001915 | Bacteria | 1339 |
| 3 | JGI24740J21852_10012152 | 3300001979 | Bacteria | 3252 |
| 4 | JGI24739J22299_10003573 | 3300001989 | Bacteria | 5940 |
| 5 | JGI24739J22299_10047384 | 3300001989 | Bacteria | 1403 |
| 6 | JGI24737J22298_10011025 | 3300001990 | Bacteria | 2968 |
| 7 | JGI24735J21928_10011323 | 3300002067 | Bacteria | 2831 |
| 8 | JGI24735J21928_10021649 | 3300002067 | Bacteria | 1962 |
| 9 | JGI24735J21928_10031743 | 3300002067 | Bacteria | 1565 |
| 10 | JGI24738J21930_10000745 | 3300002075 | Bacteria | 9375 |
| 11 | JGI25156J39149_1000571 | 3300002705 | Bacteria | 21041 |
| 12 | JGI25156J39149_1000951 | 3300002705 | Bacteria | 13864 |
| 13 | JGI25165J46597_1001506 | 3300003214 | Bacteria | 11843 |
| 14 | rootH1_10031982 | 3300003316 | Bacteria | 6597 |
| 15 | rootH2_10010622 | 3300003320 | Bacteria | 2111 |
| 16 | rootL2_10104888 | 3300003322 | Bacteria | 1682 |
| 17 | Ga0055533_1000434 | 3300003756 | Bacteria | 15950 |
| 18 | Ga0055533_1001223 | 3300003756 | Bacteria | 7136 |
| 19 | Ga0055532_1000177 | 3300003758 | Bacteria | 54669 |
| 20 | Ga0055532_1005023 | 3300003758 | Bacteria | 1912 |
| 21 | Ga0055527_1000123 | 3300003760 | Bacteria | 54669 |
| 22 | Ga0055527_1001412 | 3300003760 | Bacteria | 5077 |
| 23 | Ga0055527_1001426 | 3300003760 | Bacteria | 5041 |
| 24 | Ga0055535_1000268 | 3300003761 | Bacteria | 54669 |
| 25 | Ga0055535_1003049 | 3300003761 | Bacteria | 5077 |
| 26 | Ga0055535_1003076 | 3300003761 | Bacteria | 5041 |
| 27 | Ga0055542_1000304 | 3300003762 | Bacteria | 54669 |
| 28 | Ga0055542_1002898 | 3300003762 | Bacteria | 5077 |
| 29 | Ga0055542_1002917 | 3300003762 | Bacteria | 5041 |
| 30 | Ga0055529_1000318 | 3300003763 | Bacteria | 54669 |
| 31 | Ga0055529_1000561 | 3300003763 | Bacteria | 30975 |
| 32 | Ga0055529_1008936 | 3300003763 | Bacteria | 1325 |
| 33 | Ga0055528_1002578 | 3300003790 | Bacteria | 9599 |
| 34 | Ga0058692_1002896 | 3300003856 | Bacteria | 5553 |
| 35 | Ga0070658_10173762 | 3300005327 | Bacteria | 1811 |
| 36 | Ga0070658_10850993 | 3300005327 | Bacteria | 793 |
| 37 | Ga0070676_10131167 | 3300005328 | Bacteria | 1585 |
| 38 | Ga0070690_100016460 | 3300005330 | Bacteria | 4431 |
| 39 | Ga0070690_100064896 | 3300005330 | Bacteria | 2360 |
| 40 | Ga0070677_10118403 | 3300005333 | Bacteria | 1193 |
| 41 | Ga0068869_100045097 | 3300005334 | Bacteria | 3173 |
| 42 | Ga0070682_100033534 | 3300005337 | Bacteria | 3121 |
| 43 | Ga0068868_100273686 | 3300005338 | Bacteria | 1427 |
| 44 | Ga0070660_100000021 | 3300005339 | Bacteria | 97654 |
| 45 | Ga0070660_100395742 | 3300005339 | Bacteria | 1142 |
| 46 | Ga0070689_100000383 | 3300005340 | Bacteria | 25925 |
| 47 | Ga0070689_100376195 | 3300005340 | Bacteria | 1196 |
| 48 | Ga0070689_101072020 | 3300005340 | Bacteria | 719 |
| 49 | Ga0070687_100227436 | 3300005343 | Bacteria | 1146 |
| 50 | Ga0070661_100341453 | 3300005344 | Bacteria | 1173 |
| 51 | Ga0070692_10039912 | 3300005345 | Bacteria | 2398 |
| 52 | Ga0070675_100138226 | 3300005354 | Bacteria | 2081 |
| 53 | Ga0070674_100301524 | 3300005356 | Bacteria | 1277 |
| 54 | Ga0070674_101389668 | 3300005356 | Bacteria | 628 |
| 55 | Ga0070673_100461961 | 3300005364 | Bacteria | 1143 |
| 56 | Ga0070688_100192686 | 3300005365 | Bacteria | 1421 |
| 57 | Ga0070659_100000061 | 3300005366 | Bacteria | 85192 |
| 58 | Ga0070659_100026941 | 3300005366 | Bacteria | 4425 |
| 59 | Ga0070714_100026968 | 3300005435 | Bacteria | 4753 |
| 60 | Ga0070701_10007230 | 3300005438 | Bacteria | 4726 |
| 61 | Ga0070705_100014965 | 3300005440 | Bacteria | 4002 |
| 62 | Ga0070705_100051355 | 3300005440 | Bacteria | 2404 |
| 63 | Ga0070700_100000746 | 3300005441 | Bacteria | 16006 |
| 64 | Ga0070700_100023703 | 3300005441 | Bacteria | 3593 |
| 65 | Ga0070694_100197852 | 3300005444 | Bacteria | 1496 |
| 66 | Ga0070694_100454229 | 3300005444 | Bacteria | 1012 |
| 67 | Ga0070694_100727164 | 3300005444 | Bacteria | 809 |
| 68 | Ga0070708_100970904 | 3300005445 | Bacteria | 797 |
| 69 | Ga0070663_100000360 | 3300005455 | Bacteria | 23909 |
| 70 | Ga0070663_100136554 | 3300005455 | Bacteria | 1868 |
| 71 | Ga0070678_100328657 | 3300005456 | Bacteria | 1308 |
| 72 | Ga0070678_100700872 | 3300005456 | Bacteria | 912 |
| 73 | Ga0070681_10496865 | 3300005458 | Bacteria | 1133 |
| 74 | Ga0068867_100012966 | 3300005459 | Bacteria | 5898 |
| 75 | Ga0068867_100054175 | 3300005459 | Bacteria | 2963 |
| 76 | Ga0068867_100219790 | 3300005459 | Bacteria | 1530 |
| 77 | Ga0070685_10056833 | 3300005466 | Bacteria | 2276 |
| 78 | Ga0070707_101351132 | 3300005468 | Bacteria | 679 |
| 79 | Ga0070679_100043513 | 3300005530 | Bacteria | 4473 |
| 80 | Ga0070684_100230246 | 3300005535 | Bacteria | 1692 |
| 81 | Ga0070684_100279389 | 3300005535 | Bacteria | 1530 |
| 82 | Ga0070684_100443810 | 3300005535 | Bacteria | 1199 |
| 83 | Ga0070686_100000740 | 3300005544 | Bacteria | 18920 |
| 84 | Ga0070686_100499330 | 3300005544 | Bacteria | 944 |
| 85 | Ga0070686_101131803 | 3300005544 | Bacteria | 648 |
| 86 | Ga0070695_100016904 | 3300005545 | Bacteria | 4422 |
| 87 | Ga0070696_100022306 | 3300005546 | Bacteria | 4300 |
| 88 | Ga0070693_100043389 | 3300005547 | Bacteria | 2539 |
| 89 | Ga0070693_100046697 | 3300005547 | Bacteria | 2461 |
| 90 | Ga0070665_100081943 | 3300005548 | Bacteria | 3232 |
| 91 | Ga0070665_100845125 | 3300005548 | Bacteria | 928 |
| 92 | Ga0070704_100023728 | 3300005549 | Bacteria | 4013 |
| 93 | Ga0070704_100217780 | 3300005549 | Bacteria | 1550 |
| 94 | Ga0070704_101261052 | 3300005549 | Bacteria | 675 |
| 95 | Ga0068855_100002326 | 3300005563 | Bacteria | 23485 |
| 96 | Ga0068855_100024344 | 3300005563 | Bacteria | 7245 |
| 97 | Ga0068855_100028419 | 3300005563 | Bacteria | 6690 |
| 98 | Ga0068855_100028597 | 3300005563 | Bacteria | 6669 |
| 99 | Ga0068855_100046274 | 3300005563 | Bacteria | 5144 |
| 100 | Ga0068855_100046385 | 3300005563 | Bacteria | 5138 |
| 101 | Ga0068857_100421323 | 3300005577 | Bacteria | 1245 |
| 102 | Ga0068854_100357165 | 3300005578 | Bacteria | 1198 |
| 103 | Ga0068856_100085472 | 3300005614 | Bacteria | 3134 |
| 104 | Ga0068856_100296924 | 3300005614 | Bacteria | 1633 |
| 105 | Ga0070702_100003111 | 3300005615 | Bacteria | 7350 |
| 106 | Ga0070702_100107885 | 3300005615 | Bacteria | 1720 |
| 107 | Ga0068852_100000618 | 3300005616 | Bacteria | 23320 |
| 108 | Ga0068852_100003636 | 3300005616 | Bacteria | 10800 |
| 109 | Ga0068852_100020421 | 3300005616 | Bacteria | 5268 |
| 110 | Ga0068852_100056305 | 3300005616 | Bacteria | 3397 |
| 111 | Ga0068859_100004756 | 3300005617 | Bacteria | 13806 |
| 112 | Ga0068859_100023776 | 3300005617 | Bacteria | 6150 |
| 113 | Ga0068866_10002120 | 3300005718 | Bacteria | 8255 |
| 114 | Ga0068866_10629998 | 3300005718 | Bacteria | 728 |
| 115 | Ga0068861_100002984 | 3300005719 | Bacteria | 11167 |
| 116 | Ga0068861_100115054 | 3300005719 | Bacteria | 2161 |
| 117 | Ga0068870_10006494 | 3300005840 | Bacteria | 5158 |
| 118 | Ga0068863_100123245 | 3300005841 | Bacteria | 2473 |
| 119 | Ga0068863_101016923 | 3300005841 | Bacteria | 832 |
| 120 | Ga0068858_100002485 | 3300005842 | Bacteria | 18611 |
| 121 | Ga0068858_100011312 | 3300005842 | Bacteria | 8431 |
| 122 | Ga0068858_100058823 | 3300005842 | Bacteria | 3554 |
| 123 | Ga0068858_100191791 | 3300005842 | Bacteria | 1931 |
| 124 | Ga0068858_100284441 | 3300005842 | Bacteria | 1575 |
| 125 | Ga0068860_100052968 | 3300005843 | Bacteria | 3858 |
| 126 | Ga0068860_100142242 | 3300005843 | Bacteria | 2306 |
| 127 | Ga0068860_100151911 | 3300005843 | Bacteria | 2230 |
| 128 | Ga0068862_100003014 | 3300005844 | Bacteria | 14687 |
| 129 | Ga0081539_10042254 | 3300005985 | Bacteria | 2657 |
| 130 | Ga0075363_100500112 | 3300006048 | Bacteria | 722 |
| 131 | Ga0075367_10109935 | 3300006178 | Unclassified | 1691 |
| 132 | Ga0075367_10137382 | 3300006178 | Bacteria | 1513 |
| 133 | Ga0075369_10065991 | 3300006186 | Bacteria | 1587 |
| 134 | Ga0075366_10061536 | 3300006195 | Bacteria | 2231 |
| 135 | Ga0097621_100002878 | 3300006237 | Bacteria | 11808 |
| 136 | Ga0097621_100121439 | 3300006237 | Bacteria | 2216 |
| 137 | Ga0075370_10329171 | 3300006353 | Bacteria | 911 |
| 138 | Ga0068871_100022510 | 3300006358 | Bacteria | 4860 |
| 139 | Ga0068871_100047155 | 3300006358 | Bacteria | 3474 |
| 140 | Ga0075428_100117828 | 3300006844 | Bacteria | 2893 |
| 141 | Ga0075428_100248016 | 3300006844 | Bacteria | 1919 |
| 142 | Ga0075433_10154629 | 3300006852 | Bacteria | 2041 |
| 143 | Ga0075434_100128221 | 3300006871 | Bacteria | 2554 |
| 144 | Ga0075429_100069353 | 3300006880 | Bacteria | 3070 |
| 145 | Ga0075429_100310627 | 3300006880 | Unclassified | 1380 |
| 146 | Ga0068865_100007859 | 3300006881 | Bacteria | 6579 |
| 147 | Ga0068865_100067523 | 3300006881 | Bacteria | 2526 |
| 148 | Ga0068865_100080405 | 3300006881 | Bacteria | 2337 |
| 149 | Ga0068865_100728573 | 3300006881 | Bacteria | 850 |
| 150 | Ga0075436_100003122 | 3300006914 | Bacteria | 11353 |
| 151 | Ga0097620_100004756 | 3300006931 | Bacteria | 13806 |
| 152 | Ga0097620_100023776 | 3300006931 | Bacteria | 6150 |
| 153 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 154 | Ga0075435_100216203 | 3300007076 | Bacteria | 1627 |
| 155 | Ga0099794_10243916 | 3300007265 | Bacteria | 926 |
| 156 | Ga0099794_10270247 | 3300007265 | Bacteria | 878 |
| 157 | Ga0105251_10000298 | 3300009011 | Bacteria | 49831 |
| 158 | Ga0105250_10022197 | 3300009092 | Bacteria | 2559 |
| 159 | Ga0105240_10018150 | 3300009093 | Bacteria | 9458 |
| 160 | Ga0105240_10042328 | 3300009093 | Bacteria | 5804 |
| 161 | Ga0105240_10088404 | 3300009093 | Bacteria | 3791 |
| 162 | Ga0105240_10103873 | 3300009093 | Bacteria | 3451 |
| 163 | Ga0105240_10123642 | 3300009093 | Bacteria | 3112 |
| 164 | Ga0105240_10154445 | 3300009093 | Bacteria | 2731 |
| 165 | Ga0105240_10158715 | 3300009093 | Bacteria | 2688 |
| 166 | Ga0105240_10409570 | 3300009093 | Bacteria | 1525 |
| 167 | Ga0111539_10000940 | 3300009094 | Bacteria | 38161 |
| 168 | Ga0111539_10892816 | 3300009094 | Unclassified | 1034 |
| 169 | Ga0105245_10005540 | 3300009098 | Bacteria | 11091 |
| 170 | Ga0105245_10104392 | 3300009098 | Bacteria | 2627 |
| 171 | Ga0105245_10166457 | 3300009098 | Bacteria | 2096 |
| 172 | Ga0105247_10073068 | 3300009101 | Bacteria | 2148 |
| 173 | Ga0105243_10004473 | 3300009148 | Bacteria | 11051 |
| 174 | Ga0105241_10013590 | 3300009174 | Bacteria | 5966 |
| 175 | Ga0105242_10001658 | 3300009176 | Bacteria | 17602 |
| 176 | Ga0105242_10006365 | 3300009176 | Bacteria | 9089 |
| 177 | Ga0105242_10126888 | 3300009176 | Bacteria | 2197 |
| 178 | Ga0105242_11025498 | 3300009176 | Bacteria | 834 |
| 179 | Ga0105248_10014079 | 3300009177 | Bacteria | 8803 |
| 180 | Ga0105248_10127471 | 3300009177 | Bacteria | 2871 |
| 181 | Ga0105248_10781248 | 3300009177 | Bacteria | 1078 |
| 182 | Ga0105248_11236919 | 3300009177 | Bacteria | 844 |
| 183 | Ga0105237_10169266 | 3300009545 | Bacteria | 2184 |
| 184 | Ga0105238_10004061 | 3300009551 | Bacteria | 14507 |
| 185 | Ga0105238_10011719 | 3300009551 | Bacteria | 8838 |
| 186 | Ga0105238_10020534 | 3300009551 | Bacteria | 6726 |
| 187 | Ga0105238_10116989 | 3300009551 | Bacteria | 2646 |
| 188 | Ga0105238_10185285 | 3300009551 | Bacteria | 2058 |
| 189 | Ga0105238_10409368 | 3300009551 | Bacteria | 1350 |
| 190 | Ga0105249_10036317 | 3300009553 | Bacteria | 4469 |
| 191 | Ga0105249_10267512 | 3300009553 | Bacteria | 1702 |
| 192 | Ga0105239_10015271 | 3300010375 | Bacteria | 8508 |
| 193 | Ga0105239_10573547 | 3300010375 | Bacteria | 1286 |
| 194 | Ga0105239_10614792 | 3300010375 | Bacteria | 1240 |
| 195 | Ga0105246_10076846 | 3300011119 | Bacteria | 2367 |
| 196 | Ga0157371_10043128 | 3300013102 | Bacteria | 3214 |
| 197 | Ga0157370_10000323 | 3300013104 | Bacteria | 59944 |
| 198 | Ga0157370_10000800 | 3300013104 | Bacteria | 39630 |
| 199 | Ga0157370_10131706 | 3300013104 | Bacteria | 2332 |
| 200 | Ga0157370_10181073 | 3300013104 | Bacteria | 1958 |
| 201 | Ga0157369_10000089 | 3300013105 | Bacteria | 127323 |
| 202 | Ga0157369_10000280 | 3300013105 | Bacteria | 68583 |
| 203 | Ga0157369_10005296 | 3300013105 | Bacteria | 15032 |
| 204 | Ga0157369_10373347 | 3300013105 | Bacteria | 1480 |
| 205 | Ga0157374_10206104 | 3300013296 | Bacteria | 1927 |
| 206 | Ga0157378_10001155 | 3300013297 | Bacteria | 24013 |
| 207 | Ga0157378_10011184 | 3300013297 | Bacteria | 7851 |
| 208 | Ga0157378_10097287 | 3300013297 | Bacteria | 2682 |
| 209 | Ga0163162_10044057 | 3300013306 | Bacteria | 4468 |
| 210 | Ga0157372_10003769 | 3300013307 | Bacteria | 16282 |
| 211 | Ga0157372_10189667 | 3300013307 | Bacteria | 2381 |
| 212 | Ga0163163_10064988 | 3300014325 | Bacteria | 3620 |
| 213 | Ga0157380_10025001 | 3300014326 | Bacteria | 4525 |
| 214 | Ga0182008_10148842 | 3300014497 | Bacteria | 1174 |
| 215 | Ga0182008_10174943 | 3300014497 | Bacteria | 1085 |
| 216 | Ga0157377_10593855 | 3300014745 | Bacteria | 789 |
| 217 | Ga0157379_10049245 | 3300014968 | Bacteria | 3762 |
| 218 | Ga0157379_10073141 | 3300014968 | Bacteria | 3068 |
| 219 | Ga0157379_11311114 | 3300014968 | Bacteria | 699 |
| 220 | Ga0157376_10236762 | 3300014969 | Bacteria | 1699 |
| 221 | Ga0157376_10858066 | 3300014969 | Bacteria | 924 |
| 222 | Ga0157376_11409576 | 3300014969 | Bacteria | 728 |
| 223 | Ga0182005_1022121 | 3300015265 | Bacteria | 1743 |
| 224 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 225 | Ga0206356_10288866 | 3300020070 | Bacteria | 1079 |
| 226 | Ga0206354_11251663 | 3300020081 | Bacteria | 1377 |
| 227 | Ga0206353_10100041 | 3300020082 | Bacteria | 681 |
| 228 | Ga0206353_11289395 | 3300020082 | Bacteria | 2049 |
| 229 | Ga0209566_100212 | 3300025225 | Bacteria | 59180 |
| 230 | Ga0209566_103548 | 3300025225 | Bacteria | 2356 |
| 231 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 232 | Ga0209674_100092 | 3300025226 | Bacteria | 172272 |
| 233 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 234 | Ga0209672_100046 | 3300025228 | Bacteria | 264244 |
| 235 | Ga0209672_100047 | 3300025228 | Bacteria | 250925 |
| 236 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 237 | Ga0209147_100043 | 3300025229 | Bacteria | 300460 |
| 238 | Ga0209147_100059 | 3300025229 | Bacteria | 250891 |
| 239 | Ga0209147_100172 | 3300025229 | Bacteria | 84617 |
| 240 | Ga0209563_101915 | 3300025230 | Bacteria | 5031 |
| 241 | Ga0207427_101871 | 3300025231 | Bacteria | 6641 |
| 242 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 243 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 244 | Ga0209258_100172 | 3300025242 | Bacteria | 144895 |
| 245 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 246 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 247 | Ga0209148_1000353 | 3300025254 | Bacteria | 59341 |
| 248 | Ga0209148_1002928 | 3300025254 | Bacteria | 5182 |
| 249 | Ga0209759_1000053 | 3300025256 | Bacteria | 212789 |
| 250 | Ga0209759_1000074 | 3300025256 | Bacteria | 177152 |
| 251 | Ga0209759_1006543 | 3300025256 | Bacteria | 3895 |
| 252 | Ga0209759_1016316 | 3300025256 | Bacteria | 1881 |
| 253 | Ga0209233_1000204 | 3300025261 | Bacteria | 118907 |
| 254 | Ga0209565_1004426 | 3300025263 | Bacteria | 4276 |
| 255 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 256 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 257 | Ga0209455_1001734 | 3300025272 | Bacteria | 9278 |
| 258 | Ga0209673_1000115 | 3300025273 | Bacteria | 176939 |
| 259 | Ga0209564_1012724 | 3300025295 | Bacteria | 3643 |
| 260 | Ga0207656_10000780 | 3300025321 | Bacteria | 10440 |
| 261 | Ga0207696_1015815 | 3300025711 | Bacteria | 2544 |
| 262 | Ga0207713_1000612 | 3300025735 | Bacteria | 35126 |
| 263 | Ga0207642_10002640 | 3300025899 | Bacteria | 5589 |
| 264 | Ga0207680_10062975 | 3300025903 | Bacteria | 2268 |
| 265 | Ga0207647_10007911 | 3300025904 | Bacteria | 7648 |
| 266 | Ga0207647_10018824 | 3300025904 | Bacteria | 4657 |
| 267 | Ga0207643_10004018 | 3300025908 | Bacteria | 7915 |
| 268 | Ga0207705_10009017 | 3300025909 | Bacteria | 7268 |
| 269 | Ga0207705_10111689 | 3300025909 | Bacteria | 2020 |
| 270 | Ga0207705_10205261 | 3300025909 | Bacteria | 1494 |
| 271 | Ga0207654_10039027 | 3300025911 | Bacteria | 2668 |
| 272 | Ga0207654_10259136 | 3300025911 | Bacteria | 1168 |
| 273 | Ga0207707_10096540 | 3300025912 | Bacteria | 2583 |
| 274 | Ga0207707_10601396 | 3300025912 | Bacteria | 931 |
| 275 | Ga0207695_10014762 | 3300025913 | Bacteria | 9231 |
| 276 | Ga0207695_10026553 | 3300025913 | Bacteria | 6464 |
| 277 | Ga0207695_10030603 | 3300025913 | Bacteria | 5922 |
| 278 | Ga0207695_10046453 | 3300025913 | Bacteria | 4603 |
| 279 | Ga0207695_10083723 | 3300025913 | Bacteria | 3222 |
| 280 | Ga0207695_10261130 | 3300025913 | Bacteria | 1629 |
| 281 | Ga0207695_10310481 | 3300025913 | Bacteria | 1467 |
| 282 | Ga0207660_11097929 | 3300025917 | Bacteria | 648 |
| 283 | Ga0207662_10103267 | 3300025918 | Bacteria | 1768 |
| 284 | Ga0207662_10201136 | 3300025918 | Bacteria | 1289 |
| 285 | Ga0207657_10000008 | 3300025919 | Bacteria | 189885 |
| 286 | Ga0207657_10227078 | 3300025919 | Bacteria | 1494 |
| 287 | Ga0207657_10310332 | 3300025919 | Bacteria | 1249 |
| 288 | Ga0207649_10118121 | 3300025920 | Bacteria | 1783 |
| 289 | Ga0207649_10283837 | 3300025920 | Bacteria | 1205 |
| 290 | Ga0207652_10033789 | 3300025921 | Bacteria | 4308 |
| 291 | Ga0207694_10011555 | 3300025924 | Bacteria | 6661 |
| 292 | Ga0207694_10043505 | 3300025924 | Bacteria | 3467 |
| 293 | Ga0207694_10140524 | 3300025924 | Bacteria | 1942 |
| 294 | Ga0207694_10489804 | 3300025924 | Bacteria | 1029 |
| 295 | Ga0207659_10489214 | 3300025926 | Bacteria | 1040 |
| 296 | Ga0207659_10571096 | 3300025926 | Bacteria | 962 |
| 297 | Ga0207687_10005161 | 3300025927 | Bacteria | 8658 |
| 298 | Ga0207687_10285679 | 3300025927 | Bacteria | 1324 |
| 299 | Ga0207687_10626601 | 3300025927 | Bacteria | 908 |
| 300 | Ga0207644_10335181 | 3300025931 | Bacteria | 1226 |
| 301 | Ga0207690_10000013 | 3300025932 | Bacteria | 266156 |
| 302 | Ga0207690_10025937 | 3300025932 | Bacteria | 3687 |
| 303 | Ga0207690_11143349 | 3300025932 | Bacteria | 649 |
| 304 | Ga0207686_10019035 | 3300025934 | Bacteria | 3897 |
| 305 | Ga0207686_10032139 | 3300025934 | Bacteria | 3121 |
| 306 | Ga0207686_10135350 | 3300025934 | Bacteria | 1696 |
| 307 | Ga0207686_10586233 | 3300025934 | Bacteria | 876 |
| 308 | Ga0207709_10021888 | 3300025935 | Bacteria | 3622 |
| 309 | Ga0207709_10050230 | 3300025935 | Bacteria | 2549 |
| 310 | Ga0207670_10012625 | 3300025936 | Bacteria | 4950 |
| 311 | Ga0207670_10238588 | 3300025936 | Bacteria | 1400 |
| 312 | Ga0207669_10185958 | 3300025937 | Bacteria | 1494 |
| 313 | Ga0207669_10245659 | 3300025937 | Bacteria | 1329 |
| 314 | Ga0207704_10015507 | 3300025938 | Bacteria | 3885 |
| 315 | Ga0207691_10364750 | 3300025940 | Bacteria | 1235 |
| 316 | Ga0207711_10074220 | 3300025941 | Bacteria | 2958 |
| 317 | Ga0207711_10083570 | 3300025941 | Bacteria | 2793 |
| 318 | Ga0207711_10768462 | 3300025941 | Bacteria | 898 |
| 319 | Ga0207689_10000474 | 3300025942 | Bacteria | 37756 |
| 320 | Ga0207689_10253868 | 3300025942 | Bacteria | 1454 |
| 321 | Ga0207667_10004312 | 3300025949 | Bacteria | 17424 |
| 322 | Ga0207667_10013366 | 3300025949 | Bacteria | 9396 |
| 323 | Ga0207667_10019690 | 3300025949 | Bacteria | 7523 |
| 324 | Ga0207667_10020307 | 3300025949 | Bacteria | 7393 |
| 325 | Ga0207667_10046287 | 3300025949 | Bacteria | 4606 |
| 326 | Ga0207667_10146920 | 3300025949 | Bacteria | 2427 |
| 327 | Ga0207667_10263651 | 3300025949 | Bacteria | 1762 |
| 328 | Ga0207651_11030347 | 3300025960 | Bacteria | 736 |
| 329 | Ga0207712_10253976 | 3300025961 | Bacteria | 1422 |
| 330 | Ga0207668_10146296 | 3300025972 | Bacteria | 1824 |
| 331 | Ga0207640_10553529 | 3300025981 | Bacteria | 967 |
| 332 | Ga0207677_10063227 | 3300026023 | Bacteria | 2572 |
| 333 | Ga0207677_10071403 | 3300026023 | Bacteria | 2450 |
| 334 | Ga0207703_10007077 | 3300026035 | Bacteria | 8925 |
| 335 | Ga0207703_10007310 | 3300026035 | Bacteria | 8780 |
| 336 | Ga0207703_10177048 | 3300026035 | Bacteria | 1880 |
| 337 | Ga0207639_10205559 | 3300026041 | Bacteria | 1692 |
| 338 | Ga0207678_10000363 | 3300026067 | Bacteria | 41217 |
| 339 | Ga0207678_10163228 | 3300026067 | Bacteria | 1902 |
| 340 | Ga0207708_10000382 | 3300026075 | Bacteria | 34635 |
| 341 | Ga0207708_10039444 | 3300026075 | Bacteria | 3598 |
| 342 | Ga0207708_10162880 | 3300026075 | Bacteria | 1762 |
| 343 | Ga0207702_10218111 | 3300026078 | Bacteria | 1777 |
| 344 | Ga0207641_10106722 | 3300026088 | Bacteria | 2476 |
| 345 | Ga0207648_10001543 | 3300026089 | Bacteria | 25355 |
| 346 | Ga0207648_10026704 | 3300026089 | Bacteria | 5129 |
| 347 | Ga0207648_10064949 | 3300026089 | Bacteria | 3181 |
| 348 | Ga0207648_10338815 | 3300026089 | Bacteria | 1354 |
| 349 | Ga0207648_11031949 | 3300026089 | Bacteria | 770 |
| 350 | Ga0207674_10210042 | 3300026116 | Bacteria | 1896 |
| 351 | Ga0207675_100000178 | 3300026118 | Bacteria | 57002 |
| 352 | Ga0207675_100154235 | 3300026118 | Bacteria | 2188 |
| 353 | Ga0207675_100385324 | 3300026118 | Bacteria | 1379 |
| 354 | Ga0207683_10205204 | 3300026121 | Bacteria | 1792 |
| 355 | Ga0207683_10949433 | 3300026121 | Bacteria | 798 |
| 356 | Ga0207698_10003281 | 3300026142 | Bacteria | 9722 |
| 357 | Ga0207698_10010646 | 3300026142 | Bacteria | 5927 |
| 358 | Ga0207698_10013611 | 3300026142 | Bacteria | 5376 |
| 359 | Ga0207698_10062676 | 3300026142 | Bacteria | 2905 |
| 360 | Ga0209371_1000065 | 3300027312 | Bacteria | 214464 |
| 361 | Ga0209371_1012184 | 3300027312 | Bacteria | 2507 |
| 362 | Ga0209999_1045218 | 3300027543 | Bacteria | 828 |
| 363 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 364 | Ga0209971_1078428 | 3300027682 | Bacteria | 803 |
| 365 | Ga0207428_10123033 | 3300027907 | Bacteria | 1988 |
| 366 | Ga0268266_10601539 | 3300028379 | Bacteria | 1056 |
| 367 | Ga0268266_11447287 | 3300028379 | Bacteria | 663 |
| 368 | Ga0268265_10026191 | 3300028380 | Bacteria | 4146 |
| 369 | Ga0268265_10054596 | 3300028380 | Bacteria | 3033 |
| 370 | Ga0268264_10046116 | 3300028381 | Bacteria | 3620 |
| 371 | Ga0268264_10079355 | 3300028381 | Bacteria | 2800 |
| 372 | Ga0265338_10170388 | 3300028800 | Bacteria | 1671 |
| 373 | Ga0268256_1000118 | 3300030500 | Bacteria | 115175 |
| 374 | Ga0268256_1013264 | 3300030500 | Bacteria | 2507 |
| 375 | Ga0265340_10251813 | 3300031247 | Bacteria | 787 |
| 376 | Ga0307509_10606093 | 3300031507 | Bacteria | 767 |
| 377 | Ga0307408_100138227 | 3300031548 | Bacteria | 1909 |
| 378 | Ga0307408_100411781 | 3300031548 | Bacteria | 1163 |
| 379 | Ga0307408_100419049 | 3300031548 | Bacteria | 1154 |
| 380 | Ga0316575_10072466 | 3300031665 | Bacteria | 1385 |
| 381 | Ga0316579_10000868 | 3300031691 | Bacteria | 10463 |
| 382 | Ga0316576_10029816 | 3300031727 | Bacteria | 3859 |
| 383 | Ga0316576_10643769 | 3300031727 | Bacteria | 771 |
| 384 | Ga0316578_10000287 | 3300031728 | Bacteria | 15321 |
| 385 | Ga0316578_10112401 | 3300031728 | Bacteria | 1636 |
| 386 | Ga0316577_10000452 | 3300031733 | Bacteria | 16096 |
| 387 | Ga0307412_10000014 | 3300031911 | Bacteria | 353795 |
| 388 | Ga0307412_10236086 | 3300031911 | Bacteria | 1411 |
| 389 | Ga0307416_100274273 | 3300032002 | Bacteria | 1658 |
| 390 | Ga0307416_100670909 | 3300032002 | Bacteria | 1123 |
| 391 | Ga0307416_101082790 | 3300032002 | Bacteria | 906 |
| 392 | Ga0316583_10031499 | 3300032133 | Bacteria | 1888 |
| 393 | Ga0316585_10059956 | 3300032137 | Bacteria | 1229 |
| 394 | Ga0316585_10124359 | 3300032137 | Bacteria | 849 |
| 395 | Ga0316580_10014936 | 3300032139 | Bacteria | 2373 |
| 396 | Ga0316593_10001800 | 3300032168 | Bacteria | 4887 |
| 397 | Ga0316592_1000185 | 3300033524 | Bacteria | 7403 |
| 398 | Ga0316592_1014347 | 3300033524 | Unclassified | 1642 |
| 399 | Ga0316592_1025935 | 3300033524 | Unclassified | 1264 |
| 400 | Ga0316588_1001369 | 3300033528 | Bacteria | 3965 |
| 401 | Ga0316588_1069153 | 3300033528 | Unclassified | 866 |
| 402 | Ga0316596_1000042 | 3300033541 | Bacteria | 13570 |
| 403 | Ga0316596_1000390 | 3300033541 | Bacteria | 7277 |
| 404 | Ga0373948_0143006 | 3300034817 | Bacteria | 593 |
| 405 | Ga0373939_0053240 | 3300035114 | Bacteria | 1264 |
| 406 | Ga0373942_0002444 | 3300035207 | Bacteria | 4503 |
| 407 | Ga0316574_0000074 | 3300035398 | Bacteria | 27344 |
| 408 | Ga0316574_0123779 | 3300035398 | Bacteria | 1661 |
| 409 | Ga0316574_0182225 | 3300035398 | Bacteria | 1351 |
| 410 | Ga0316574_0396006 | 3300035398 | Bacteria | 870 |
| 411 | Ga0373931_0227594 | 3300035691 | Bacteria | 1125 |
| 412 | Ga0373931_0463909 | 3300035691 | Bacteria | 812 |
| 413 | Ga0373931_0567110 | 3300035691 | Bacteria | 739 |
| 414 | Ga0373935_0343024 | 3300035692 | Bacteria | 1064 |
| 415 | Ga0373947_0526743 | 3300035725 | Bacteria | 804 |
| 416 | Ga0373937_0169519 | 3300036401 | Bacteria | 2048 |
| 417 | Ga0316582_0000999 | 3300036647 | Bacteria | 11795 |
| 418 | Ga0316584_0442095 | 3300036712 | Bacteria | 921 |
| 419 | Ga0395899_0000031 | 3300037312 | Bacteria | 322356 |
| 420 | Ga0395899_0042832 | 3300037312 | Bacteria | 3378 |
| 421 | Ga0395899_0058255 | 3300037312 | Bacteria | 2849 |
| 422 | Ga0395899_0315353 | 3300037312 | Bacteria | 1055 |
| 423 | Ga0395900_0000158 | 3300037418 | Bacteria | 112053 |
| 424 | Ga0395900_0003337 | 3300037418 | Bacteria | 17347 |
| 425 | Ga0395900_0006577 | 3300037418 | Bacteria | 12096 |
| 426 | Ga0395900_0018187 | 3300037418 | Bacteria | 7170 |
| 427 | Ga0395898_0000040 | 3300037466 | Bacteria | 317329 |
| 428 | Ga0395898_0003196 | 3300037466 | Bacteria | 18447 |
| 429 | Ga0395898_0016977 | 3300037466 | Bacteria | 7433 |
| 430 | Ga0395905_0013205 | 3300037471 | Bacteria | 7926 |
| 431 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 432 | Ga0395901_0000059 | 3300038443 | Bacteria | 152667 |
| 433 | Ga0395901_0000196 | 3300038443 | Bacteria | 77048 |
| 434 | Ga0395901_0051787 | 3300038443 | Bacteria | 4268 |
| 435 | Ga0395901_0557232 | 3300038443 | Bacteria | 1161 |
| 436 | Ga0400490_16935 | 3300038726 | Bacteria | 14185 |
| 437 | Ga0400487_51885 | 3300039110 | Bacteria | 77480 |
| 438 | Ga0436365_1241889 | 3300039437 | Bacteria | 5207 |
| 439 | Ga0436365_1461145 | 3300039437 | Bacteria | 2839 |
| 440 | Ga0436360_0835901 | 3300039438 | Bacteria | 1346 |
| 441 | Ga0439441_001275 | 3300042001 | Bacteria | 3236 |
| 442 | Ga0439444_0101316 | 3300042437 | Bacteria | 653 |
| 443 | Ga0466969_0016591 | 3300044656 | Bacteria | 3852 |
| 444 | Ga0466977_0000619 | 3300044666 | Bacteria | 12277 |
| 445 | Ga0466966_0000271 | 3300044684 | Bacteria | 33899 |
| 446 | Ga0466966_0000465 | 3300044684 | Bacteria | 25971 |
| 447 | Ga0466966_0036011 | 3300044684 | Bacteria | 3197 |
| 448 | Ga0466966_0168392 | 3300044684 | Bacteria | 1332 |
| 449 | Ga0466961_0000552 | 3300044693 | Bacteria | 23841 |
| 450 | Ga0466961_0047304 | 3300044693 | Bacteria | 2751 |
| 451 | Ga0466963_0004798 | 3300044694 | Bacteria | 7885 |
| 452 | Ga0453684_0001497 | 3300044712 | Bacteria | 65811 |
| 453 | Ga0466971_0016881 | 3300044719 | Bacteria | 3225 |
| 454 | Ga0466971_0209040 | 3300044719 | Bacteria | 922 |
| 455 | Ga0466957_0012884 | 3300044842 | Bacteria | 4846 |
| 456 | Ga0466957_0024533 | 3300044842 | Bacteria | 3569 |
| 457 | Ga0466957_0158076 | 3300044842 | Bacteria | 1470 |
| 458 | Ga0466957_0576827 | 3300044842 | Bacteria | 786 |
| 459 | Ga0466959_0003757 | 3300045049 | Bacteria | 10047 |
| 460 | Ga0466959_0263943 | 3300045049 | Bacteria | 1185 |
| 461 | Ga0466959_0297290 | 3300045049 | Bacteria | 1106 |
| 462 | Ga0451576_0459654 | 3300045051 | Bacteria | 1337 |
| 463 | Ga0466958_0000134 | 3300045836 | Bacteria | 24891 |
| 464 | Ga0466958_0016502 | 3300045836 | Bacteria | 4253 |
| 465 | Ga0466958_0077757 | 3300045836 | Bacteria | 2038 |
| 466 | Ga0466958_0107714 | 3300045836 | Bacteria | 1738 |
| 467 | Ga0466967_0194921 | 3300045976 | Bacteria | 1916 |
| 468 | Ga0466967_0211233 | 3300045976 | Bacteria | 1841 |
| 469 | Ga0466967_0510331 | 3300045976 | Bacteria | 1181 |
| 470 | Ga0495592_0001159 | 3300046454 | Bacteria | 18286 |
| 471 | Ga0495592_0038803 | 3300046454 | Bacteria | 3581 |
| 472 | Ga0495592_0145136 | 3300046454 | Bacteria | 1646 |
| 473 | Ga0495603_0167400 | 3300046455 | Bacteria | 1273 |
| 474 | Ga0495603_0293811 | 3300046455 | Bacteria | 933 |
| 475 | Ga0495590_0011142 | 3300046457 | Bacteria | 3367 |
| 476 | Ga0495590_0026463 | 3300046457 | Bacteria | 2036 |
| 477 | Ga0495591_000961 | 3300046458 | Bacteria | 19683 |
| 478 | Ga0495629_0000147 | 3300046459 | Bacteria | 61514 |
| 479 | Ga0495629_0003838 | 3300046459 | Bacteria | 11336 |
| 480 | Ga0495629_0008409 | 3300046459 | Bacteria | 7592 |
| 481 | Ga0495629_0027982 | 3300046459 | Bacteria | 4003 |
| 482 | Ga0495638_0011209 | 3300046460 | Bacteria | 6188 |
| 483 | Ga0495641_0052781 | 3300046461 | Bacteria | 1852 |
| 484 | Ga0495641_0126250 | 3300046461 | Bacteria | 1141 |
| 485 | Ga0495651_0000955 | 3300046462 | Bacteria | 22358 |
| 486 | Ga0495651_0117189 | 3300046462 | Bacteria | 1961 |
| 487 | Ga0495651_0139799 | 3300046462 | Bacteria | 1757 |
| 488 | Ga0495653_0000355 | 3300046463 | Bacteria | 37058 |
| 489 | Ga0495653_0174570 | 3300046463 | Bacteria | 1480 |
| 490 | Ga0495653_0259491 | 3300046463 | Bacteria | 1149 |
| 491 | Ga0495653_0557342 | 3300046463 | Bacteria | 708 |
| 492 | Ga0495653_0644420 | 3300046463 | Bacteria | 647 |
| 493 | Ga0495650_0001394 | 3300046471 | Bacteria | 23768 |
| 494 | Ga0495650_0008493 | 3300046471 | Bacteria | 5980 |
| 495 | Ga0495650_0027190 | 3300046471 | Bacteria | 2648 |
| 496 | Ga0495650_0046169 | 3300046471 | Bacteria | 1829 |
| 497 | Ga0495650_0079938 | 3300046471 | Bacteria | 1263 |
| 498 | Ga0495650_0246766 | 3300046471 | Bacteria | 608 |
| 499 | Ga0495580_0000541 | 3300046472 | Bacteria | 31897 |
| 500 | Ga0495580_0000912 | 3300046472 | Bacteria | 25774 |
| 501 | Ga0495580_0002115 | 3300046472 | Bacteria | 17430 |
| 502 | Ga0495580_0006853 | 3300046472 | Bacteria | 9222 |
| 503 | Ga0495580_0024558 | 3300046472 | Bacteria | 4410 |
| 504 | Ga0495580_0286378 | 3300046472 | Bacteria | 1123 |
| 505 | Ga0495582_0001753 | 3300046473 | Bacteria | 12248 |
| 506 | Ga0495582_0014292 | 3300046473 | Bacteria | 4366 |
| 507 | Ga0495582_0050896 | 3300046473 | Bacteria | 2283 |
| 508 | Ga0495605_0020730 | 3300046474 | Bacteria | 3491 |
| 509 | Ga0495605_0035003 | 3300046474 | Bacteria | 2540 |
| 510 | Ga0495662_0057213 | 3300046476 | Bacteria | 1883 |
| 511 | Ga0495662_0093675 | 3300046476 | Bacteria | 1466 |
| 512 | Ga0495664_0011112 | 3300046477 | Bacteria | 5066 |
| 513 | Ga0495664_0037595 | 3300046477 | Bacteria | 2857 |
| 514 | Ga0495594_0364728 | 3300046499 | Bacteria | 822 |
| 515 | Ga0495596_0000982 | 3300046500 | Bacteria | 16980 |
| 516 | Ga0495596_0013170 | 3300046500 | Bacteria | 3518 |
| 517 | Ga0495596_0015181 | 3300046500 | Bacteria | 3232 |
| 518 | Ga0495596_0077853 | 3300046500 | Bacteria | 1287 |
| 519 | Ga0495607_0028850 | 3300046501 | Bacteria | 3418 |
| 520 | Ga0495583_0003596 | 3300046506 | Bacteria | 11632 |
| 521 | Ga0495606_0218575 | 3300046507 | Bacteria | 1075 |
| 522 | Ga0495608_0000869 | 3300046511 | Bacteria | 21090 |
| 523 | Ga0495608_0006410 | 3300046511 | Bacteria | 8356 |
| 524 | Ga0495610_0005866 | 3300046512 | Bacteria | 8620 |
| 525 | Ga0495618_0004312 | 3300046514 | Bacteria | 8753 |
| 526 | Ga0495618_0011962 | 3300046514 | Bacteria | 5266 |
| 527 | Ga0495618_0029276 | 3300046514 | Bacteria | 3435 |
| 528 | Ga0495618_0064048 | 3300046514 | Bacteria | 2335 |
| 529 | Ga0495620_0015676 | 3300046515 | Bacteria | 3819 |
| 530 | Ga0495620_0082926 | 3300046515 | Bacteria | 1295 |
| 531 | Ga0495628_0008297 | 3300046516 | Bacteria | 8926 |
| 532 | Ga0495628_0025593 | 3300046516 | Bacteria | 4820 |
| 533 | Ga0495628_0027989 | 3300046516 | Bacteria | 4583 |
| 534 | Ga0495628_0060537 | 3300046516 | Bacteria | 2970 |
| 535 | Ga0495628_0093840 | 3300046516 | Bacteria | 2320 |
| 536 | Ga0495628_0171730 | 3300046516 | Bacteria | 1643 |
| 537 | Ga0495628_0236376 | 3300046516 | Bacteria | 1368 |
| 538 | Ga0495630_0008073 | 3300046517 | Bacteria | 7567 |
| 539 | Ga0495630_0009649 | 3300046517 | Bacteria | 6942 |
| 540 | Ga0495630_0067609 | 3300046517 | Bacteria | 2686 |
| 541 | Ga0495630_0584111 | 3300046517 | Bacteria | 856 |
| 542 | Ga0495632_0198053 | 3300046519 | Bacteria | 916 |
| 543 | Ga0495643_0052370 | 3300046522 | Bacteria | 2192 |
| 544 | Ga0495648_0020557 | 3300046524 | Bacteria | 4599 |
| 545 | Ga0495648_0035144 | 3300046524 | Bacteria | 3251 |
| 546 | Ga0495648_0043923 | 3300046524 | Bacteria | 2794 |
| 547 | Ga0495666_0000266 | 3300046526 | Bacteria | 22595 |
| 548 | Ga0495666_0003295 | 3300046526 | Bacteria | 8153 |
| 549 | Ga0495666_0033743 | 3300046526 | Bacteria | 2498 |
| 550 | Ga0495666_0047506 | 3300046526 | Bacteria | 2067 |
| 551 | Ga0495642_0170941 | 3300046528 | Bacteria | 944 |
| 552 | Ga0495652_0029801 | 3300046529 | Bacteria | 4790 |
| 553 | Ga0495652_0041513 | 3300046529 | Bacteria | 3970 |
| 554 | Ga0495652_0070444 | 3300046529 | Bacteria | 2922 |
| 555 | Ga0495654_0157719 | 3300046530 | Bacteria | 999 |
| 556 | Ga0495665_0005766 | 3300046531 | Bacteria | 6684 |
| 557 | Ga0495665_0034674 | 3300046531 | Bacteria | 2698 |
| 558 | Ga0495665_0034894 | 3300046531 | Bacteria | 2689 |
| 559 | Ga0495665_0096157 | 3300046531 | Bacteria | 1555 |
| 560 | Ga0495640_0004554 | 3300046533 | Bacteria | 11050 |
| 561 | Ga0495640_0029879 | 3300046533 | Bacteria | 3906 |
| 562 | Ga0495640_0058885 | 3300046533 | Bacteria | 2618 |
| 563 | Ga0495586_0005854 | 3300046535 | Bacteria | 6569 |
| 564 | Ga0495586_0072791 | 3300046535 | Bacteria | 1879 |
| 565 | Ga0495586_0132550 | 3300046535 | Bacteria | 1395 |
| 566 | Ga0495587_0002232 | 3300046536 | Bacteria | 12950 |
| 567 | Ga0495587_0002649 | 3300046536 | Bacteria | 11956 |
| 568 | Ga0495587_0294681 | 3300046536 | Bacteria | 908 |
| 569 | Ga0495598_0042104 | 3300046537 | Bacteria | 1339 |
| 570 | Ga0495609_0043956 | 3300046538 | Bacteria | 2005 |
| 571 | Ga0495621_0017865 | 3300046539 | Bacteria | 2298 |
| 572 | Ga0495597_0049239 | 3300046542 | Bacteria | 1863 |
| 573 | Ga0495645_0054557 | 3300046543 | Bacteria | 2903 |
| 574 | Ga0495622_0002432 | 3300046557 | Bacteria | 9035 |
| 575 | Ga0495667_0049295 | 3300046559 | Bacteria | 2780 |
| 576 | Ga0495667_0153351 | 3300046559 | Bacteria | 1483 |
| 577 | Ga0495668_0292950 | 3300046616 | Bacteria | 892 |
| 578 | Ga0495634_0011146 | 3300046642 | Bacteria | 6557 |
| 579 | Ga0495634_0016716 | 3300046642 | Bacteria | 5242 |
| 580 | Ga0495634_0059012 | 3300046642 | Bacteria | 2556 |
| 581 | Ga0495611_0026130 | 3300046648 | Bacteria | 2547 |
| 582 | Ga0495611_0039779 | 3300046648 | Bacteria | 2094 |
| 583 | Ga0495625_0067430 | 3300046660 | Bacteria | 2518 |
| 584 | Ga0495635_0002508 | 3300046663 | Bacteria | 12548 |
| 585 | Ga0495635_0007855 | 3300046663 | Bacteria | 7450 |
| 586 | Ga0495635_0126161 | 3300046663 | Bacteria | 1745 |
| 587 | Ga0495661_0006883 | 3300046665 | Bacteria | 7949 |
| 588 | Ga0495661_0027877 | 3300046665 | Bacteria | 3622 |
| 589 | Ga0495661_0053466 | 3300046665 | Bacteria | 2428 |
| 590 | Ga0495588_0037475 | 3300046674 | Bacteria | 2464 |
| 591 | Ga0495657_0041820 | 3300046675 | Bacteria | 3134 |
| 592 | Ga0495657_0044901 | 3300046675 | Bacteria | 3001 |
| 593 | Ga0495599_0022115 | 3300046678 | Bacteria | 3969 |
| 594 | Ga0495599_0486585 | 3300046678 | Bacteria | 727 |
| 595 | Ga0495623_0002158 | 3300046679 | Bacteria | 13140 |
| 596 | Ga0495623_0104906 | 3300046679 | Bacteria | 1718 |
| 597 | Ga0495623_0186666 | 3300046679 | Bacteria | 1200 |
| 598 | Ga0495646_0002595 | 3300046680 | Bacteria | 11133 |
| 599 | Ga0495646_0003268 | 3300046680 | Bacteria | 10086 |
| 600 | Ga0495646_0023036 | 3300046680 | Bacteria | 3922 |
| 601 | Ga0495646_0028757 | 3300046680 | Bacteria | 3479 |
| 602 | Ga0495646_0137019 | 3300046680 | Bacteria | 1372 |
| 603 | Ga0495646_0137730 | 3300046680 | Bacteria | 1368 |
| 604 | Ga0495669_0075172 | 3300046684 | Bacteria | 1545 |
| 605 | Ga0495613_0026567 | 3300046689 | Bacteria | 4311 |
| 606 | Ga0495613_0161515 | 3300046689 | Bacteria | 1593 |
| 607 | Ga0495613_0342540 | 3300046689 | Bacteria | 1028 |
| 608 | Ga0495624_0004472 | 3300046690 | Bacteria | 10227 |
| 609 | Ga0495624_0011607 | 3300046690 | Bacteria | 6051 |
| 610 | Ga0495624_0014820 | 3300046690 | Bacteria | 5280 |
| 611 | Ga0495624_0034815 | 3300046690 | Bacteria | 3254 |
| 612 | Ga0495624_0054474 | 3300046690 | Bacteria | 2521 |
| 613 | Ga0495671_0086235 | 3300046692 | Bacteria | 1538 |
| 614 | Ga0495649_0058452 | 3300046694 | Bacteria | 2077 |
| 615 | Ga0495649_0062548 | 3300046694 | Bacteria | 2000 |
| 616 | Ga0495649_0205208 | 3300046694 | Bacteria | 1022 |
| 617 | Ga0495589_0001698 | 3300046794 | Bacteria | 12565 |
| 618 | Ga0495589_0074709 | 3300046794 | Bacteria | 1653 |
| 619 | Ga0495589_0109009 | 3300046794 | Bacteria | 1337 |
| 620 | Ga0495600_0014180 | 3300046809 | Bacteria | 5020 |
| 621 | Ga0495600_0036521 | 3300046809 | Bacteria | 3193 |
| 622 | Ga0495600_0370684 | 3300046809 | Bacteria | 894 |
| 623 | Ga0495660_0065446 | 3300046810 | Bacteria | 1940 |
| 624 | Ga0495581_0021485 | 3300047315 | Bacteria | 3740 |
| 625 | Ga0495604_0051457 | 3300047317 | Bacteria | 3192 |
| 626 | Ga0495604_0092279 | 3300047317 | Bacteria | 2243 |
| 627 | Ga0495604_0156072 | 3300047317 | Bacteria | 1616 |
| 628 | Ga0495604_0263095 | 3300047317 | Bacteria | 1171 |
| 629 | Ga0495674_0026860 | 3300047319 | Bacteria | 5265 |
| 630 | Ga0495674_0220553 | 3300047319 | Bacteria | 1567 |
| 631 | Ga0495672_0050089 | 3300047320 | Bacteria | 2468 |
| 632 | Ga0495672_0132827 | 3300047320 | Bacteria | 1307 |
| 633 | Ga0495676_0023757 | 3300047321 | Bacteria | 5315 |
| 634 | Ga0495680_0034791 | 3300047322 | Bacteria | 4064 |
| 635 | Ga0495680_0059708 | 3300047322 | Bacteria | 2942 |
| 636 | Ga0495680_0119103 | 3300047322 | Bacteria | 1950 |
| 637 | Ga0495683_0008360 | 3300047323 | Bacteria | 5544 |
| 638 | Ga0495683_0016402 | 3300047323 | Bacteria | 3847 |
| 639 | Ga0495683_0036102 | 3300047323 | Bacteria | 2510 |
| 640 | Ga0495687_003598 | 3300047443 | Bacteria | 11098 |
| 641 | Ga0495687_019609 | 3300047443 | Bacteria | 3313 |
| 642 | Ga0495687_023030 | 3300047443 | Bacteria | 2981 |
| 643 | Ga0495675_0033433 | 3300047444 | Bacteria | 3283 |
| 644 | Ga0495675_0559502 | 3300047444 | Bacteria | 651 |
| 645 | Ga0495679_000007 | 3300047446 | Bacteria | 401482 |
| 646 | Ga0495679_000777 | 3300047446 | Bacteria | 20199 |
| 647 | Ga0495679_001594 | 3300047446 | Bacteria | 12757 |
| 648 | Ga0495684_0031855 | 3300047471 | Bacteria | 4050 |
| 649 | Ga0495684_0097697 | 3300047471 | Bacteria | 2221 |
| 650 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 651 | Ga0495686_0041678 | 3300047472 | Bacteria | 2922 |
| 652 | Ga0495593_0001969 | 3300047673 | Bacteria | 12233 |
| 653 | Ga0495593_0051260 | 3300047673 | Bacteria | 2184 |
| 654 | Ga0495602_0046894 | 3300048088 | Bacteria | 3898 |
| 655 | Ga0495602_0108452 | 3300048088 | Bacteria | 2260 |
| 656 | Ga0495602_0113357 | 3300048088 | Bacteria | 2197 |
| 657 | Ga0495602_0136196 | 3300048088 | Bacteria | 1950 |
| 658 | Ga0495602_0308502 | 3300048088 | Bacteria | 1155 |
| 659 | Ga0495614_0004727 | 3300048089 | Bacteria | 6140 |
| 660 | Ga0495614_0010107 | 3300048089 | Bacteria | 4165 |
| 661 | Ga0495614_0015034 | 3300048089 | Bacteria | 3378 |
| 662 | Ga0495626_0016381 | 3300048091 | Bacteria | 3765 |
| 663 | Ga0495626_0027635 | 3300048091 | Bacteria | 2757 |
| 664 | Ga0496102_0037779 | 3300048905 | Bacteria | 4357 |
| 665 | Ga0496102_1236989 | 3300048905 | Bacteria | 666 |
| 666 | Ga0496103_0006243 | 3300048906 | Bacteria | 7122 |
| 667 | Ga0496104_0049450 | 3300048907 | Bacteria | 3965 |
| 668 | Ga0496104_0572575 | 3300048907 | Bacteria | 1040 |
| 669 | Ga0496106_0058018 | 3300048909 | Bacteria | 2929 |
| 670 | Ga0496111_0253469 | 3300048914 | Bacteria | 1306 |
| 671 | Ga0496116_0092416 | 3300048919 | Bacteria | 1835 |
| 672 | Ga0496116_0159197 | 3300048919 | Bacteria | 1241 |
| 673 | Ga0496116_0187770 | 3300048919 | Bacteria | 1098 |
| 674 | Ga0496117_0005194 | 3300048920 | Bacteria | 13859 |
| 675 | Ga0496117_0026344 | 3300048920 | Bacteria | 4551 |
| 676 | Ga0496117_0029092 | 3300048920 | Bacteria | 4265 |
| 677 | Ga0496117_0055022 | 3300048920 | Bacteria | 2783 |
| 678 | Ga0496117_0094191 | 3300048920 | Bacteria | 1918 |
| 679 | Ga0496118_0000282 | 3300048921 | Bacteria | 89232 |
| 680 | Ga0496118_0002992 | 3300048921 | Bacteria | 21847 |
| 681 | Ga0496118_0015903 | 3300048921 | Bacteria | 6934 |
| 682 | Ga0496118_0068145 | 3300048921 | Bacteria | 2586 |
| 683 | Ga0496118_0123823 | 3300048921 | Bacteria | 1678 |
| 684 | Ga0496118_0312544 | 3300048921 | Bacteria | 856 |
| 685 | Ga0496121_0051751 | 3300048924 | Bacteria | 3456 |
| 686 | Ga0496121_0468271 | 3300048924 | Bacteria | 808 |
| 687 | Ga0496126_0000061 | 3300048929 | Bacteria | 261515 |
| 688 | Ga0496126_0001519 | 3300048929 | Bacteria | 35767 |
| 689 | Ga0496126_0524237 | 3300048929 | Bacteria | 944 |
| 690 | Ga0495678_033374 | 3300049459 | Bacteria | 2125 |
| 691 | Ga0495678_037703 | 3300049459 | Bacteria | 1961 |
| 692 | Ga0495682_0049331 | 3300049460 | Bacteria | 1534 |
| 693 | Ga0501299_084914 | 3300049522 | Bacteria | 710 |
| 694 | Ga0501034_0000456 | 3300049571 | Bacteria | 67493 |
| 695 | Ga0501034_0040175 | 3300049571 | Bacteria | 4737 |
| 696 | Ga0501034_0191279 | 3300049571 | Bacteria | 2008 |
| 697 | Ga0501036_0718154 | 3300049572 | Bacteria | 825 |
| 698 | Ga0501037_0001334 | 3300049573 | Bacteria | 18109 |
| 699 | Ga0501038_0064136 | 3300049574 | Bacteria | 3133 |
| 700 | Ga0501039_0137223 | 3300049575 | Bacteria | 1921 |
| 701 | Ga0501039_0264960 | 3300049575 | Bacteria | 1350 |
| 702 | Ga0501043_0334329 | 3300049579 | Bacteria | 1153 |
| 703 | Ga0501046_0012661 | 3300049580 | Bacteria | 7172 |
| 704 | Ga0501047_0025488 | 3300049581 | Bacteria | 5685 |
| 705 | Ga0501047_0144232 | 3300049581 | Bacteria | 2259 |
| 706 | Ga0501048_0320806 | 3300049582 | Bacteria | 1104 |
| 707 | Ga0501068_0022173 | 3300049584 | Bacteria | 3711 |
| 708 | Ga0501068_0460653 | 3300049584 | Bacteria | 823 |
| 709 | Ga0501069_0009654 | 3300049585 | Bacteria | 5098 |
| 710 | Ga0501070_0028182 | 3300049586 | Bacteria | 4710 |
| 711 | Ga0501070_0035410 | 3300049586 | Bacteria | 4171 |
| 712 | Ga0501070_0042923 | 3300049586 | Bacteria | 3765 |
| 713 | Ga0501070_0521436 | 3300049586 | Bacteria | 953 |
| 714 | Ga0501070_1131760 | 3300049586 | Bacteria | 603 |
| 715 | Ga0501072_0016094 | 3300049588 | Bacteria | 5736 |
| 716 | Ga0501073_0004611 | 3300049589 | Bacteria | 10355 |
| 717 | Ga0501073_0008127 | 3300049589 | Bacteria | 7782 |
| 718 | Ga0501074_0000309 | 3300049590 | Bacteria | 28271 |
| 719 | Ga0501074_0011687 | 3300049590 | Bacteria | 6380 |
| 720 | Ga0501074_0031959 | 3300049590 | Bacteria | 3815 |
| 721 | Ga0501077_0408491 | 3300049593 | Bacteria | 868 |
| 722 | Ga0501079_0021387 | 3300049741 | Bacteria | 4948 |
| 723 | Ga0501079_0466548 | 3300049741 | Bacteria | 992 |
| 724 | Ga0501080_0030890 | 3300049742 | Bacteria | 4991 |
| 725 | Ga0501080_0119289 | 3300049742 | Bacteria | 2445 |
| 726 | Ga0501080_0268733 | 3300049742 | Bacteria | 1552 |
| 727 | Ga0501080_0328759 | 3300049742 | Bacteria | 1383 |
| 728 | Ga0501080_0509019 | 3300049742 | Bacteria | 1075 |
| 729 | Ga0501081_0051842 | 3300049743 | Bacteria | 2830 |
| 730 | Ga0501083_0005715 | 3300049744 | Bacteria | 8802 |
| 731 | Ga0501083_0017673 | 3300049744 | Bacteria | 4972 |
| 732 | Ga0501083_0050134 | 3300049744 | Bacteria | 2811 |
| 733 | Ga0501035_0218285 | 3300049822 | Bacteria | 1629 |
| 734 | Ga0501035_0397289 | 3300049822 | Bacteria | 1147 |
| 735 | Ga0501035_0905348 | 3300049822 | Bacteria | 698 |
| 736 | Ga0501044_0065144 | 3300049823 | Bacteria | 3717 |
| 737 | Ga0501044_0561789 | 3300049823 | Bacteria | 1037 |
| 738 | nmdc:mga03n38_472095_c1 | 3300050490 | Bacteria | 700 |
| 739 | nmdc:mga0k408_201082_c1 | 3300050493 | Bacteria | 1189 |
| 740 | nmdc:mga0k408_33042_c1 | 3300050493 | Bacteria | 2957 |
| 741 | nmdc:mga06z11_127541_c1 | 3300050494 | Bacteria | 1425 |
| 742 | nmdc:mga07m45_158782_c1 | 3300050496 | Bacteria | 1312 |
| 743 | nmdc:mga06r32_552569_c1 | 3300050510 | Bacteria | 1125 |
| 744 | nmdc:mga08y16_1758_c1 | 3300050511 | Bacteria | 21960 |
| 745 | nmdc:mga0n895_1797163_c1 | 3300050512 | Bacteria | 574 |
| 746 | nmdc:mga0n895_74366_c1 | 3300050512 | Bacteria | 3375 |
| 747 | nmdc:mga0rr50_56142_c1 | 3300050513 | Bacteria | 2941 |
| 748 | nmdc:mga08x19_22420_c1 | 3300050514 | Bacteria | 3911 |
| 749 | nmdc:mga0a205_220133_c1 | 3300050515 | Bacteria | 1784 |
| 750 | nmdc:mga0sz30_109693_c1 | 3300050516 | Bacteria | 1209 |
| 751 | Ga0590077_021760 | 3300059426 | Bacteria | 1367 |
| 752 | Ga0501082_0590995 | 3300060353 | Bacteria | 971 |
| 753 | Ga0466962_0002291 | 3300061719 | Bacteria | 9077 |
| 754 | Ga0466962_0042464 | 3300061719 | Bacteria | 2176 |
| 755 | Ga0466962_0169886 | 3300061719 | Bacteria | 1062 |
| 756 | 2509129335 | 2508501125 | Bacteria | 7208311 |
| 757 | 2510253292 | 2510065045 | Bacteria | 7761063 |
| 758 | 2512347467 | 2512047030 | Bacteria | 9031815 |
| 759 | 2513962513 | 2513237151 | Bacteria | 6309801 |
| 760 | 2515679472 | 2515154122 | Bacteria | 8609520 |
| 761 | 2519459735 | 2519103095 | Bacteria | 6629912 |
| 762 | 2527079247 | 2526164713 | Bacteria | 6780608 |
| 763 | 2585291313 | 2582581311 | Bacteria | 6763856 |
| 764 | 2599739909 | 2599185239 | Bacteria | 8686614 |
| 765 | 2599748101 | 2599185240 | Bacteria | 7968121 |
| 766 | 2600210029 | 2599185355 | Bacteria | 7968906 |
| 767 | 2676746373 | 2675903129 | Bacteria | 7964495 |
| 768 | 2719639081 | 2718217991 | Bacteria | 7829542 |
| 769 | 2738820167 | 2738541296 | Bacteria | 7285013 |
| 770 | 2738832647 | 2738541298 | Bacteria | 7286732 |
| 771 | 2738874174 | 2738541306 | Bacteria | 7284992 |
| 772 | 2739185804 | 2738543002 | Bacteria | 7284546 |
| 773 | 2739220772 | 2738543008 | Bacteria | 7282815 |
| 774 | 2753565833 | 2751185846 | Bacteria | 7242164 |
| 775 | 2792834583 | 2791355137 | Bacteria | 9654227 |
| 776 | 2808968221 | 2808606384 | Bacteria | 8474373 |
| 777 | 2809003052 | 2808606390 | Bacteria | 8476311 |
| 778 | 2809010329 | 2808606391 | Bacteria | 8308166 |
| 779 | 2817262009 | 2816332253 | Bacteria | 6764532 |
| 780 | 2817279727 | 2816332256 | Bacteria | 6891714 |
| 781 | 2817453904 | 2816332286 | Bacteria | 6853759 |
| 782 | 2819633813 | 2818991452 | Bacteria | 8442785 |
| 783 | 2863426979 | 2863421361 | Bacteria | 7300805 |
| 784 | 2870070228 | 2870068957 | Bacteria | 8925310 |
| 785 | 2885277372 | 2885270888 | Bacteria | 9831543 |
| 786 | 2887379846 | 2887375801 | Bacteria | 5334027 |
| 787 | 2902689247 | 2902682994 | Bacteria | 8951596 |
| 788 | 2904488638 | 2904483920 | Bacteria | 7545285 |
| 789 | 2904570455 | 2904564687 | Bacteria | 7609577 |
| 790 | 2904577632 | 2904571731 | Bacteria | 7608790 |
| 791 | 2904620484 | 2904615490 | Bacteria | 10047340 |
| 792 | 2919532250 | 2919527303 | Bacteria | 7718827 |
| 793 | 2928109620 | 2928108538 | Bacteria | 7360024 |
| 794 | 2928136926 | 2928135762 | Bacteria | 7259641 |
| 795 | 2928161160 | 2928157003 | Bacteria | 7522202 |
| 796 | 2928169397 | 2928163908 | Bacteria | 7561269 |
| 797 | 2928175575 | 2928170801 | Bacteria | 8785406 |
| 798 | 2928506454 | 2928503688 | Bacteria | 7268108 |
| 799 | 2928542730 | 2928536128 | Bacteria | 7657547 |
| 800 | 2945935372 | 2945934425 | Bacteria | 7444609 |
| 801 | 2981992686 | 2981990288 | Bacteria | 7590678 |
| 802 | 2990704077 | 2990703756 | Bacteria | 7715990 |
| 803 | 642422234 | 641736151 | Bacteria | 7477263 |
| 804 | 642416181 | 641736154 | Bacteria | 7689995 |
| 805 | 8018851608 | 8018845410 | Bacteria | 8933938 |
| 806 | 8020813328 | 8020807995 | Bacteria | 6801506 |
| 807 | 8020945189 | 8020938398 | Bacteria | 7472757 |
| 808 | 8020948920 | 8020945358 | Bacteria | 8467355 |
| 809 | 8020955726 | 8020953355 | Bacteria | 7439080 |
| 810 | 8021125669 | 8021120328 | Bacteria | 8782274 |
| 811 | 8039101019 | 8039098773 | Bacteria | 6602928 |
| 812 | 8040169764 | 8040167225 | Bacteria | 6542727 |
| 813 | 8040178006 | 8040173305 | Bacteria | 6827067 |
| 814 | 8055266754 | 8055266321 | Bacteria | 7999742 |
| 815 | 8055303975 | 8055301274 | Bacteria | 8587385 |
| 816 | Ga0068864_100468228 | |||
| 817 | JGI24741J21665_1014130 | |||
| 818 | JGI24740J21852_10012152 | |||
| 819 | JGI24739J22299_10003573 | |||
| 820 | JGI24739J22299_10047384 | |||
| 821 | JGI24737J22298_10011025 | |||
| 822 | JGI24735J21928_10011323 | |||
| 823 | JGI24735J21928_10021649 | |||
| 824 | JGI24735J21928_10031743 | |||
| 825 | JGI24738J21930_10000745 | |||
| 826 | JGI25156J39149_1000571 | |||
| 827 | JGI25156J39149_1000951 | |||
| 828 | JGI25165J46597_1001506 | |||
| 829 | rootH1_10031982 | |||
| 830 | rootH2_10010622 | |||
| 831 | rootL2_10104888 | |||
| 832 | Ga0055533_1000434 | |||
| 833 | Ga0055533_1001223 | |||
| 834 | Ga0055532_1000177 | |||
| 835 | Ga0055532_1005023 | |||
| 836 | Ga0055527_1000123 | |||
| 837 | Ga0055527_1001412 | |||
| 838 | Ga0055527_1001426 | |||
| 839 | Ga0055535_1000268 | |||
| 840 | Ga0055535_1003049 | |||
| 841 | Ga0055535_1003076 | |||
| 842 | Ga0055542_1000304 | |||
| 843 | Ga0055542_1002898 | |||
| 844 | Ga0055542_1002917 | |||
| 845 | Ga0055529_1000318 | |||
| 846 | Ga0055529_1000561 | |||
| 847 | Ga0055529_1008936 | |||
| 848 | Ga0055528_1002578 | |||
| 849 | Ga0058692_1002896 | |||
| 850 | Ga0070658_10173762 | |||
| 851 | Ga0070658_10850993 | |||
| 852 | Ga0070676_10131167 | |||
| 853 | Ga0070690_100016460 | |||
| 854 | Ga0070690_100064896 | |||
| 855 | Ga0070677_10118403 | |||
| 856 | Ga0068869_100045097 | |||
| 857 | Ga0070682_100033534 | |||
| 858 | Ga0068868_100273686 | |||
| 859 | Ga0070660_100000021 | |||
| 860 | Ga0070660_100395742 | |||
| 861 | Ga0070689_100000383 | |||
| 862 | Ga0070689_100376195 | |||
| 863 | Ga0070689_101072020 | |||
| 864 | Ga0070687_100227436 | |||
| 865 | Ga0070661_100341453 | |||
| 866 | Ga0070692_10039912 | |||
| 867 | Ga0070675_100138226 | |||
| 868 | Ga0070674_100301524 | |||
| 869 | Ga0070674_101389668 | |||
| 870 | Ga0070673_100461961 | |||
| 871 | Ga0070688_100192686 | |||
| 872 | Ga0070659_100000061 | |||
| 873 | Ga0070659_100026941 | |||
| 874 | Ga0070714_100026968 | |||
| 875 | Ga0070701_10007230 | |||
| 876 | Ga0070705_100014965 | |||
| 877 | Ga0070705_100051355 | |||
| 878 | Ga0070700_100000746 | |||
| 879 | Ga0070700_100023703 | |||
| 880 | Ga0070694_100197852 | |||
| 881 | Ga0070694_100454229 | |||
| 882 | Ga0070694_100727164 | |||
| 883 | Ga0070708_100970904 | |||
| 884 | Ga0070663_100000360 | |||
| 885 | Ga0070663_100136554 | |||
| 886 | Ga0070678_100328657 | |||
| 887 | Ga0070678_100700872 | |||
| 888 | Ga0070681_10496865 | |||
| 889 | Ga0068867_100012966 | |||
| 890 | Ga0068867_100054175 | |||
| 891 | Ga0068867_100219790 | |||
| 892 | Ga0070685_10056833 | |||
| 893 | Ga0070707_101351132 | |||
| 894 | Ga0070679_100043513 | |||
| 895 | Ga0070684_100230246 | |||
| 896 | Ga0070684_100279389 | |||
| 897 | Ga0070684_100443810 | |||
| 898 | Ga0070686_100000740 | |||
| 899 | Ga0070686_100499330 | |||
| 900 | Ga0070686_101131803 | |||
| 901 | Ga0070695_100016904 | |||
| 902 | Ga0070696_100022306 | |||
| 903 | Ga0070693_100043389 | |||
| 904 | Ga0070693_100046697 | |||
| 905 | Ga0070665_100081943 | |||
| 906 | Ga0070665_100845125 | |||
| 907 | Ga0070704_100023728 | |||
| 908 | Ga0070704_100217780 | |||
| 909 | Ga0070704_101261052 | |||
| 910 | Ga0068855_100002326 | |||
| 911 | Ga0068855_100024344 | |||
| 912 | Ga0068855_100028419 | |||
| 913 | Ga0068855_100028597 | |||
| 914 | Ga0068855_100046274 | |||
| 915 | Ga0068855_100046385 | |||
| 916 | Ga0068857_100421323 | |||
| 917 | Ga0068854_100357165 | |||
| 918 | Ga0068856_100085472 | |||
| 919 | Ga0068856_100296924 | |||
| 920 | Ga0070702_100003111 | |||
| 921 | Ga0070702_100107885 | |||
| 922 | Ga0068852_100000618 | |||
| 923 | Ga0068852_100003636 | |||
| 924 | Ga0068852_100020421 | |||
| 925 | Ga0068852_100056305 | |||
| 926 | Ga0068859_100004756 | |||
| 927 | Ga0068859_100023776 | |||
| 928 | Ga0068866_10002120 | |||
| 929 | Ga0068866_10629998 | |||
| 930 | Ga0068861_100002984 | |||
| 931 | Ga0068861_100115054 | |||
| 932 | Ga0068870_10006494 | |||
| 933 | Ga0068863_100123245 | |||
| 934 | Ga0068863_101016923 | |||
| 935 | Ga0068858_100002485 | |||
| 936 | Ga0068858_100011312 | |||
| 937 | Ga0068858_100058823 | |||
| 938 | Ga0068858_100191791 | |||
| 939 | Ga0068858_100284441 | |||
| 940 | Ga0068860_100052968 | |||
| 941 | Ga0068860_100142242 | |||
| 942 | Ga0068860_100151911 | |||
| 943 | Ga0068862_100003014 | |||
| 944 | Ga0081539_10042254 | |||
| 945 | Ga0075363_100500112 | |||
| 946 | Ga0075367_10109935 | |||
| 947 | Ga0075367_10137382 | |||
| 948 | Ga0075369_10065991 | |||
| 949 | Ga0075366_10061536 | |||
| 950 | Ga0097621_100002878 | |||
| 951 | Ga0097621_100121439 | |||
| 952 | Ga0075370_10329171 | |||
| 953 | Ga0068871_100022510 | |||
| 954 | Ga0068871_100047155 | |||
| 955 | Ga0075428_100117828 | |||
| 956 | Ga0075428_100248016 | |||
| 957 | Ga0075433_10154629 | |||
| 958 | Ga0075434_100128221 | |||
| 959 | Ga0075429_100069353 | |||
| 960 | Ga0075429_100310627 | |||
| 961 | Ga0068865_100007859 | |||
| 962 | Ga0068865_100067523 | |||
| 963 | Ga0068865_100080405 | |||
| 964 | Ga0068865_100728573 | |||
| 965 | Ga0075436_100003122 | |||
| 966 | Ga0097620_100004756 | |||
| 967 | Ga0097620_100023776 | |||
| 968 | Ga0099826_10000003 | |||
| 969 | Ga0075435_100216203 | |||
| 970 | Ga0099794_10243916 | |||
| 971 | Ga0099794_10270247 | |||
| 972 | Ga0105251_10000298 | |||
| 973 | Ga0105250_10022197 | |||
| 974 | Ga0105240_10018150 | |||
| 975 | Ga0105240_10042328 | |||
| 976 | Ga0105240_10088404 | |||
| 977 | Ga0105240_10103873 | |||
| 978 | Ga0105240_10123642 | |||
| 979 | Ga0105240_10154445 | |||
| 980 | Ga0105240_10158715 | |||
| 981 | Ga0105240_10409570 | |||
| 982 | Ga0111539_10000940 | |||
| 983 | Ga0111539_10892816 | |||
| 984 | Ga0105245_10005540 | |||
| 985 | Ga0105245_10104392 | |||
| 986 | Ga0105245_10166457 | |||
| 987 | Ga0105247_10073068 | |||
| 988 | Ga0105243_10004473 | |||
| 989 | Ga0105241_10013590 | |||
| 990 | Ga0105242_10001658 | |||
| 991 | Ga0105242_10006365 | |||
| 992 | Ga0105242_10126888 | |||
| 993 | Ga0105242_11025498 | |||
| 994 | Ga0105248_10014079 | |||
| 995 | Ga0105248_10127471 | |||
| 996 | Ga0105248_10781248 | |||
| 997 | Ga0105248_11236919 | |||
| 998 | Ga0105237_10169266 | |||
| 999 | Ga0105238_10004061 | |||
| 1000 | Ga0105238_10011719 | |||
| 1001 | Ga0105238_10020534 | |||
| 1002 | Ga0105238_10116989 | |||
| 1003 | Ga0105238_10185285 | |||
| 1004 | Ga0105238_10409368 | |||
| 1005 | Ga0105249_10036317 | |||
| 1006 | Ga0105249_10267512 | |||
| 1007 | Ga0105239_10015271 | |||
| 1008 | Ga0105239_10573547 | |||
| 1009 | Ga0105239_10614792 | |||
| 1010 | Ga0105246_10076846 | |||
| 1011 | Ga0157371_10043128 | |||
| 1012 | Ga0157370_10000323 | |||
| 1013 | Ga0157370_10000800 | |||
| 1014 | Ga0157370_10131706 | |||
| 1015 | Ga0157370_10181073 | |||
| 1016 | Ga0157369_10000089 | |||
| 1017 | Ga0157369_10000280 | |||
| 1018 | Ga0157369_10005296 | |||
| 1019 | Ga0157369_10373347 | |||
| 1020 | Ga0157374_10206104 | |||
| 1021 | Ga0157378_10001155 | |||
| 1022 | Ga0157378_10011184 | |||
| 1023 | Ga0157378_10097287 | |||
| 1024 | Ga0163162_10044057 | |||
| 1025 | Ga0157372_10003769 | |||
| 1026 | Ga0157372_10189667 | |||
| 1027 | Ga0163163_10064988 | |||
| 1028 | Ga0157380_10025001 | |||
| 1029 | Ga0182008_10148842 | |||
| 1030 | Ga0182008_10174943 | |||
| 1031 | Ga0157377_10593855 | |||
| 1032 | Ga0157379_10049245 | |||
| 1033 | Ga0157379_10073141 | |||
| 1034 | Ga0157379_11311114 | |||
| 1035 | Ga0157376_10236762 | |||
| 1036 | Ga0157376_10858066 | |||
| 1037 | Ga0157376_11409576 | |||
| 1038 | Ga0182005_1022121 | |||
| 1039 | Ga0183361_10001 | |||
| 1040 | Ga0206356_10288866 | |||
| 1041 | Ga0206354_11251663 | |||
| 1042 | Ga0206353_10100041 | |||
| 1043 | Ga0206353_11289395 | |||
| 1044 | Ga0209566_100212 | |||
| 1045 | Ga0209566_103548 | |||
| 1046 | Ga0209674_100005 | |||
| 1047 | Ga0209674_100092 | |||
| 1048 | Ga0209672_100001 | |||
| 1049 | Ga0209672_100046 | |||
| 1050 | Ga0209672_100047 | |||
| 1051 | Ga0209147_100001 | |||
| 1052 | Ga0209147_100043 | |||
| 1053 | Ga0209147_100059 | |||
| 1054 | Ga0209147_100172 | |||
| 1055 | Ga0209563_101915 | |||
| 1056 | Ga0207427_101871 | |||
| 1057 | Ga0209258_100001 | |||
| 1058 | Ga0209258_100023 | |||
| 1059 | Ga0209258_100172 | |||
| 1060 | Ga0209148_1000003 | |||
| 1061 | Ga0209148_1000029 | |||
| 1062 | Ga0209148_1000353 | |||
| 1063 | Ga0209148_1002928 | |||
| 1064 | Ga0209759_1000053 | |||
| 1065 | Ga0209759_1000074 | |||
| 1066 | Ga0209759_1006543 | |||
| 1067 | Ga0209759_1016316 | |||
| 1068 | Ga0209233_1000204 | |||
| 1069 | Ga0209565_1004426 | |||
| 1070 | Ga0209455_1000001 | |||
| 1071 | Ga0209455_1000064 | |||
| 1072 | Ga0209455_1001734 | |||
| 1073 | Ga0209673_1000115 | |||
| 1074 | Ga0209564_1012724 | |||
| 1075 | Ga0207656_10000780 | |||
| 1076 | Ga0207696_1015815 | |||
| 1077 | Ga0207713_1000612 | |||
| 1078 | Ga0207642_10002640 | |||
| 1079 | Ga0207680_10062975 | |||
| 1080 | Ga0207647_10007911 | |||
| 1081 | Ga0207647_10018824 | |||
| 1082 | Ga0207643_10004018 | |||
| 1083 | Ga0207705_10009017 | |||
| 1084 | Ga0207705_10111689 | |||
| 1085 | Ga0207705_10205261 | |||
| 1086 | Ga0207654_10039027 | |||
| 1087 | Ga0207654_10259136 | |||
| 1088 | Ga0207707_10096540 | |||
| 1089 | Ga0207707_10601396 | |||
| 1090 | Ga0207695_10014762 | |||
| 1091 | Ga0207695_10026553 | |||
| 1092 | Ga0207695_10030603 | |||
| 1093 | Ga0207695_10046453 | |||
| 1094 | Ga0207695_10083723 | |||
| 1095 | Ga0207695_10261130 | |||
| 1096 | Ga0207695_10310481 | |||
| 1097 | Ga0207660_11097929 | |||
| 1098 | Ga0207662_10103267 | |||
| 1099 | Ga0207662_10201136 | |||
| 1100 | Ga0207657_10000008 | |||
| 1101 | Ga0207657_10227078 | |||
| 1102 | Ga0207657_10310332 | |||
| 1103 | Ga0207649_10118121 | |||
| 1104 | Ga0207649_10283837 | |||
| 1105 | Ga0207652_10033789 | |||
| 1106 | Ga0207694_10011555 | |||
| 1107 | Ga0207694_10043505 | |||
| 1108 | Ga0207694_10140524 | |||
| 1109 | Ga0207694_10489804 | |||
| 1110 | Ga0207659_10489214 | |||
| 1111 | Ga0207659_10571096 | |||
| 1112 | Ga0207687_10005161 | |||
| 1113 | Ga0207687_10285679 | |||
| 1114 | Ga0207687_10626601 | |||
| 1115 | Ga0207644_10335181 | |||
| 1116 | Ga0207690_10000013 | |||
| 1117 | Ga0207690_10025937 | |||
| 1118 | Ga0207690_11143349 | |||
| 1119 | Ga0207686_10019035 | |||
| 1120 | Ga0207686_10032139 | |||
| 1121 | Ga0207686_10135350 | |||
| 1122 | Ga0207686_10586233 | |||
| 1123 | Ga0207709_10021888 | |||
| 1124 | Ga0207709_10050230 | |||
| 1125 | Ga0207670_10012625 | |||
| 1126 | Ga0207670_10238588 | |||
| 1127 | Ga0207669_10185958 | |||
| 1128 | Ga0207669_10245659 | |||
| 1129 | Ga0207704_10015507 | |||
| 1130 | Ga0207691_10364750 | |||
| 1131 | Ga0207711_10074220 | |||
| 1132 | Ga0207711_10083570 | |||
| 1133 | Ga0207711_10768462 | |||
| 1134 | Ga0207689_10000474 | |||
| 1135 | Ga0207689_10253868 | |||
| 1136 | Ga0207667_10004312 | |||
| 1137 | Ga0207667_10013366 | |||
| 1138 | Ga0207667_10019690 | |||
| 1139 | Ga0207667_10020307 | |||
| 1140 | Ga0207667_10046287 | |||
| 1141 | Ga0207667_10146920 | |||
| 1142 | Ga0207667_10263651 | |||
| 1143 | Ga0207651_11030347 | |||
| 1144 | Ga0207712_10253976 | |||
| 1145 | Ga0207668_10146296 | |||
| 1146 | Ga0207640_10553529 | |||
| 1147 | Ga0207677_10063227 | |||
| 1148 | Ga0207677_10071403 | |||
| 1149 | Ga0207703_10007077 | |||
| 1150 | Ga0207703_10007310 | |||
| 1151 | Ga0207703_10177048 | |||
| 1152 | Ga0207639_10205559 | |||
| 1153 | Ga0207678_10000363 | |||
| 1154 | Ga0207678_10163228 | |||
| 1155 | Ga0207708_10000382 | |||
| 1156 | Ga0207708_10039444 | |||
| 1157 | Ga0207708_10162880 | |||
| 1158 | Ga0207702_10218111 | |||
| 1159 | Ga0207641_10106722 | |||
| 1160 | Ga0207648_10001543 | |||
| 1161 | Ga0207648_10026704 | |||
| 1162 | Ga0207648_10064949 | |||
| 1163 | Ga0207648_10338815 | |||
| 1164 | Ga0207648_11031949 | |||
| 1165 | Ga0207674_10210042 | |||
| 1166 | Ga0207675_100000178 | |||
| 1167 | Ga0207675_100154235 | |||
| 1168 | Ga0207675_100385324 | |||
| 1169 | Ga0207683_10205204 | |||
| 1170 | Ga0207683_10949433 | |||
| 1171 | Ga0207698_10003281 | |||
| 1172 | Ga0207698_10010646 | |||
| 1173 | Ga0207698_10013611 | |||
| 1174 | Ga0207698_10062676 | |||
| 1175 | Ga0209371_1000065 | |||
| 1176 | Ga0209371_1012184 | |||
| 1177 | Ga0209999_1045218 | |||
| 1178 | Ga0209282_1000002 | |||
| 1179 | Ga0209971_1078428 | |||
| 1180 | Ga0207428_10123033 | |||
| 1181 | Ga0268266_10601539 | |||
| 1182 | Ga0268266_11447287 | |||
| 1183 | Ga0268265_10026191 | |||
| 1184 | Ga0268265_10054596 | |||
| 1185 | Ga0268264_10046116 | |||
| 1186 | Ga0268264_10079355 | |||
| 1187 | Ga0265338_10170388 | |||
| 1188 | Ga0268256_1000118 | |||
| 1189 | Ga0268256_1013264 | |||
| 1190 | Ga0265340_10251813 | |||
| 1191 | Ga0307509_10606093 | |||
| 1192 | Ga0307408_100138227 | |||
| 1193 | Ga0307408_100411781 | |||
| 1194 | Ga0307408_100419049 | |||
| 1195 | Ga0316575_10072466 | |||
| 1196 | Ga0316579_10000868 | |||
| 1197 | Ga0316576_10029816 | |||
| 1198 | Ga0316576_10643769 | |||
| 1199 | Ga0316578_10000287 | |||
| 1200 | Ga0316578_10112401 | |||
| 1201 | Ga0316577_10000452 | |||
| 1202 | Ga0307412_10000014 | |||
| 1203 | Ga0307412_10236086 | |||
| 1204 | Ga0307416_100274273 | |||
| 1205 | Ga0307416_100670909 | |||
| 1206 | Ga0307416_101082790 | |||
| 1207 | Ga0316583_10031499 | |||
| 1208 | Ga0316585_10059956 | |||
| 1209 | Ga0316585_10124359 | |||
| 1210 | Ga0316580_10014936 | |||
| 1211 | Ga0316593_10001800 | |||
| 1212 | Ga0316592_1000185 | |||
| 1213 | Ga0316592_1014347 | |||
| 1214 | Ga0316592_1025935 | |||
| 1215 | Ga0316588_1001369 | |||
| 1216 | Ga0316588_1069153 | |||
| 1217 | Ga0316596_1000042 | |||
| 1218 | Ga0316596_1000390 | |||
| 1219 | Ga0373948_0143006 | |||
| 1220 | Ga0373939_0053240 | |||
| 1221 | Ga0373942_0002444 | |||
| 1222 | Ga0316574_0000074 | |||
| 1223 | Ga0316574_0123779 | |||
| 1224 | Ga0316574_0182225 | |||
| 1225 | Ga0316574_0396006 | |||
| 1226 | Ga0373931_0227594 | |||
| 1227 | Ga0373931_0463909 | |||
| 1228 | Ga0373931_0567110 | |||
| 1229 | Ga0373935_0343024 | |||
| 1230 | Ga0373947_0526743 | |||
| 1231 | Ga0373937_0169519 | |||
| 1232 | Ga0316582_0000999 | |||
| 1233 | Ga0316584_0442095 | |||
| 1234 | Ga0395899_0000031 | |||
| 1235 | Ga0395899_0042832 | |||
| 1236 | Ga0395899_0058255 | |||
| 1237 | Ga0395899_0315353 | |||
| 1238 | Ga0395900_0000158 | |||
| 1239 | Ga0395900_0003337 | |||
| 1240 | Ga0395900_0006577 | |||
| 1241 | Ga0395900_0018187 | |||
| 1242 | Ga0395898_0000040 | |||
| 1243 | Ga0395898_0003196 | |||
| 1244 | Ga0395898_0016977 | |||
| 1245 | Ga0395905_0013205 | |||
| 1246 | Ga0395901_0000002 | |||
| 1247 | Ga0395901_0000059 | |||
| 1248 | Ga0395901_0000196 | |||
| 1249 | Ga0395901_0051787 | |||
| 1250 | Ga0395901_0557232 | |||
| 1251 | Ga0400490_16935 | |||
| 1252 | Ga0400487_51885 | |||
| 1253 | Ga0436365_1241889 | |||
| 1254 | Ga0436365_1461145 | |||
| 1255 | Ga0436360_0835901 | |||
| 1256 | Ga0439441_001275 | |||
| 1257 | Ga0439444_0101316 | |||
| 1258 | Ga0466969_0016591 | |||
| 1259 | Ga0466977_0000619 | |||
| 1260 | Ga0466966_0000271 | |||
| 1261 | Ga0466966_0000465 | |||
| 1262 | Ga0466966_0036011 | |||
| 1263 | Ga0466966_0168392 | |||
| 1264 | Ga0466961_0000552 | |||
| 1265 | Ga0466961_0047304 | |||
| 1266 | Ga0466963_0004798 | |||
| 1267 | Ga0453684_0001497 | |||
| 1268 | Ga0466971_0016881 | |||
| 1269 | Ga0466971_0209040 | |||
| 1270 | Ga0466957_0012884 | |||
| 1271 | Ga0466957_0024533 | |||
| 1272 | Ga0466957_0158076 | |||
| 1273 | Ga0466957_0576827 | |||
| 1274 | Ga0466959_0003757 | |||
| 1275 | Ga0466959_0263943 | |||
| 1276 | Ga0466959_0297290 | |||
| 1277 | Ga0451576_0459654 | |||
| 1278 | Ga0466958_0000134 | |||
| 1279 | Ga0466958_0016502 | |||
| 1280 | Ga0466958_0077757 | |||
| 1281 | Ga0466958_0107714 | |||
| 1282 | Ga0466967_0194921 | |||
| 1283 | Ga0466967_0211233 | |||
| 1284 | Ga0466967_0510331 | |||
| 1285 | Ga0495592_0001159 | |||
| 1286 | Ga0495592_0038803 | |||
| 1287 | Ga0495592_0145136 | |||
| 1288 | Ga0495603_0167400 | |||
| 1289 | Ga0495603_0293811 | |||
| 1290 | Ga0495590_0011142 | |||
| 1291 | Ga0495590_0026463 | |||
| 1292 | Ga0495591_000961 | |||
| 1293 | Ga0495629_0000147 | |||
| 1294 | Ga0495629_0003838 | |||
| 1295 | Ga0495629_0008409 | |||
| 1296 | Ga0495629_0027982 | |||
| 1297 | Ga0495638_0011209 | |||
| 1298 | Ga0495641_0052781 | |||
| 1299 | Ga0495641_0126250 | |||
| 1300 | Ga0495651_0000955 | |||
| 1301 | Ga0495651_0117189 | |||
| 1302 | Ga0495651_0139799 | |||
| 1303 | Ga0495653_0000355 | |||
| 1304 | Ga0495653_0174570 | |||
| 1305 | Ga0495653_0259491 | |||
| 1306 | Ga0495653_0557342 | |||
| 1307 | Ga0495653_0644420 | |||
| 1308 | Ga0495650_0001394 | |||
| 1309 | Ga0495650_0008493 | |||
| 1310 | Ga0495650_0027190 | |||
| 1311 | Ga0495650_0046169 | |||
| 1312 | Ga0495650_0079938 | |||
| 1313 | Ga0495650_0246766 | |||
| 1314 | Ga0495580_0000541 | |||
| 1315 | Ga0495580_0000912 | |||
| 1316 | Ga0495580_0002115 | |||
| 1317 | Ga0495580_0006853 | |||
| 1318 | Ga0495580_0024558 | |||
| 1319 | Ga0495580_0286378 | |||
| 1320 | Ga0495582_0001753 | |||
| 1321 | Ga0495582_0014292 | |||
| 1322 | Ga0495582_0050896 | |||
| 1323 | Ga0495605_0020730 | |||
| 1324 | Ga0495605_0035003 | |||
| 1325 | Ga0495662_0057213 | |||
| 1326 | Ga0495662_0093675 | |||
| 1327 | Ga0495664_0011112 | |||
| 1328 | Ga0495664_0037595 | |||
| 1329 | Ga0495594_0364728 | |||
| 1330 | Ga0495596_0000982 | |||
| 1331 | Ga0495596_0013170 | |||
| 1332 | Ga0495596_0015181 | |||
| 1333 | Ga0495596_0077853 | |||
| 1334 | Ga0495607_0028850 | |||
| 1335 | Ga0495583_0003596 | |||
| 1336 | Ga0495606_0218575 | |||
| 1337 | Ga0495608_0000869 | |||
| 1338 | Ga0495608_0006410 | |||
| 1339 | Ga0495610_0005866 | |||
| 1340 | Ga0495618_0004312 | |||
| 1341 | Ga0495618_0011962 | |||
| 1342 | Ga0495618_0029276 | |||
| 1343 | Ga0495618_0064048 | |||
| 1344 | Ga0495620_0015676 | |||
| 1345 | Ga0495620_0082926 | |||
| 1346 | Ga0495628_0008297 | |||
| 1347 | Ga0495628_0025593 | |||
| 1348 | Ga0495628_0027989 | |||
| 1349 | Ga0495628_0060537 | |||
| 1350 | Ga0495628_0093840 | |||
| 1351 | Ga0495628_0171730 | |||
| 1352 | Ga0495628_0236376 | |||
| 1353 | Ga0495630_0008073 | |||
| 1354 | Ga0495630_0009649 | |||
| 1355 | Ga0495630_0067609 | |||
| 1356 | Ga0495630_0584111 | |||
| 1357 | Ga0495632_0198053 | |||
| 1358 | Ga0495643_0052370 | |||
| 1359 | Ga0495648_0020557 | |||
| 1360 | Ga0495648_0035144 | |||
| 1361 | Ga0495648_0043923 | |||
| 1362 | Ga0495666_0000266 | |||
| 1363 | Ga0495666_0003295 | |||
| 1364 | Ga0495666_0033743 | |||
| 1365 | Ga0495666_0047506 | |||
| 1366 | Ga0495642_0170941 | |||
| 1367 | Ga0495652_0029801 | |||
| 1368 | Ga0495652_0041513 | |||
| 1369 | Ga0495652_0070444 | |||
| 1370 | Ga0495654_0157719 | |||
| 1371 | Ga0495665_0005766 | |||
| 1372 | Ga0495665_0034674 | |||
| 1373 | Ga0495665_0034894 | |||
| 1374 | Ga0495665_0096157 | |||
| 1375 | Ga0495640_0004554 | |||
| 1376 | Ga0495640_0029879 | |||
| 1377 | Ga0495640_0058885 | |||
| 1378 | Ga0495586_0005854 | |||
| 1379 | Ga0495586_0072791 | |||
| 1380 | Ga0495586_0132550 | |||
| 1381 | Ga0495587_0002232 | |||
| 1382 | Ga0495587_0002649 | |||
| 1383 | Ga0495587_0294681 | |||
| 1384 | Ga0495598_0042104 | |||
| 1385 | Ga0495609_0043956 | |||
| 1386 | Ga0495621_0017865 | |||
| 1387 | Ga0495597_0049239 | |||
| 1388 | Ga0495645_0054557 | |||
| 1389 | Ga0495622_0002432 | |||
| 1390 | Ga0495667_0049295 | |||
| 1391 | Ga0495667_0153351 | |||
| 1392 | Ga0495668_0292950 | |||
| 1393 | Ga0495634_0011146 | |||
| 1394 | Ga0495634_0016716 | |||
| 1395 | Ga0495634_0059012 | |||
| 1396 | Ga0495611_0026130 | |||
| 1397 | Ga0495611_0039779 | |||
| 1398 | Ga0495625_0067430 | |||
| 1399 | Ga0495635_0002508 | |||
| 1400 | Ga0495635_0007855 | |||
| 1401 | Ga0495635_0126161 | |||
| 1402 | Ga0495661_0006883 | |||
| 1403 | Ga0495661_0027877 | |||
| 1404 | Ga0495661_0053466 | |||
| 1405 | Ga0495588_0037475 | |||
| 1406 | Ga0495657_0041820 | |||
| 1407 | Ga0495657_0044901 | |||
| 1408 | Ga0495599_0022115 | |||
| 1409 | Ga0495599_0486585 | |||
| 1410 | Ga0495623_0002158 | |||
| 1411 | Ga0495623_0104906 | |||
| 1412 | Ga0495623_0186666 | |||
| 1413 | Ga0495646_0002595 | |||
| 1414 | Ga0495646_0003268 | |||
| 1415 | Ga0495646_0023036 | |||
| 1416 | Ga0495646_0028757 | |||
| 1417 | Ga0495646_0137019 | |||
| 1418 | Ga0495646_0137730 | |||
| 1419 | Ga0495669_0075172 | |||
| 1420 | Ga0495613_0026567 | |||
| 1421 | Ga0495613_0161515 | |||
| 1422 | Ga0495613_0342540 | |||
| 1423 | Ga0495624_0004472 | |||
| 1424 | Ga0495624_0011607 | |||
| 1425 | Ga0495624_0014820 | |||
| 1426 | Ga0495624_0034815 | |||
| 1427 | Ga0495624_0054474 | |||
| 1428 | Ga0495671_0086235 | |||
| 1429 | Ga0495649_0058452 | |||
| 1430 | Ga0495649_0062548 | |||
| 1431 | Ga0495649_0205208 | |||
| 1432 | Ga0495589_0001698 | |||
| 1433 | Ga0495589_0074709 | |||
| 1434 | Ga0495589_0109009 | |||
| 1435 | Ga0495600_0014180 | |||
| 1436 | Ga0495600_0036521 | |||
| 1437 | Ga0495600_0370684 | |||
| 1438 | Ga0495660_0065446 | |||
| 1439 | Ga0495581_0021485 | |||
| 1440 | Ga0495604_0051457 | |||
| 1441 | Ga0495604_0092279 | |||
| 1442 | Ga0495604_0156072 | |||
| 1443 | Ga0495604_0263095 | |||
| 1444 | Ga0495674_0026860 | |||
| 1445 | Ga0495674_0220553 | |||
| 1446 | Ga0495672_0050089 | |||
| 1447 | Ga0495672_0132827 | |||
| 1448 | Ga0495676_0023757 | |||
| 1449 | Ga0495680_0034791 | |||
| 1450 | Ga0495680_0059708 | |||
| 1451 | Ga0495680_0119103 | |||
| 1452 | Ga0495683_0008360 | |||
| 1453 | Ga0495683_0016402 | |||
| 1454 | Ga0495683_0036102 | |||
| 1455 | Ga0495687_003598 | |||
| 1456 | Ga0495687_019609 | |||
| 1457 | Ga0495687_023030 | |||
| 1458 | Ga0495675_0033433 | |||
| 1459 | Ga0495675_0559502 | |||
| 1460 | Ga0495679_000007 | |||
| 1461 | Ga0495679_000777 | |||
| 1462 | Ga0495679_001594 | |||
| 1463 | Ga0495684_0031855 | |||
| 1464 | Ga0495684_0097697 | |||
| 1465 | Ga0495686_0000014 | |||
| 1466 | Ga0495686_0041678 | |||
| 1467 | Ga0495593_0001969 | |||
| 1468 | Ga0495593_0051260 | |||
| 1469 | Ga0495602_0046894 | |||
| 1470 | Ga0495602_0108452 | |||
| 1471 | Ga0495602_0113357 | |||
| 1472 | Ga0495602_0136196 | |||
| 1473 | Ga0495602_0308502 | |||
| 1474 | Ga0495614_0004727 | |||
| 1475 | Ga0495614_0010107 | |||
| 1476 | Ga0495614_0015034 | |||
| 1477 | Ga0495626_0016381 | |||
| 1478 | Ga0495626_0027635 | |||
| 1479 | Ga0496102_0037779 | |||
| 1480 | Ga0496102_1236989 | |||
| 1481 | Ga0496103_0006243 | |||
| 1482 | Ga0496104_0049450 | |||
| 1483 | Ga0496104_0572575 | |||
| 1484 | Ga0496106_0058018 | |||
| 1485 | Ga0496111_0253469 | |||
| 1486 | Ga0496116_0092416 | |||
| 1487 | Ga0496116_0159197 | |||
| 1488 | Ga0496116_0187770 | |||
| 1489 | Ga0496117_0005194 | |||
| 1490 | Ga0496117_0026344 | |||
| 1491 | Ga0496117_0029092 | |||
| 1492 | Ga0496117_0055022 | |||
| 1493 | Ga0496117_0094191 | |||
| 1494 | Ga0496118_0000282 | |||
| 1495 | Ga0496118_0002992 | |||
| 1496 | Ga0496118_0015903 | |||
| 1497 | Ga0496118_0068145 | |||
| 1498 | Ga0496118_0123823 | |||
| 1499 | Ga0496118_0312544 | |||
| 1500 | Ga0496121_0051751 | |||
| 1501 | Ga0496121_0468271 | |||
| 1502 | Ga0496126_0000061 | |||
| 1503 | Ga0496126_0001519 | |||
| 1504 | Ga0496126_0524237 | |||
| 1505 | Ga0495678_033374 | |||
| 1506 | Ga0495678_037703 | |||
| 1507 | Ga0495682_0049331 | |||
| 1508 | Ga0501299_084914 | |||
| 1509 | Ga0501034_0000456 | |||
| 1510 | Ga0501034_0040175 | |||
| 1511 | Ga0501034_0191279 | |||
| 1512 | Ga0501036_0718154 | |||
| 1513 | Ga0501037_0001334 | |||
| 1514 | Ga0501038_0064136 | |||
| 1515 | Ga0501039_0137223 | |||
| 1516 | Ga0501039_0264960 | |||
| 1517 | Ga0501043_0334329 | |||
| 1518 | Ga0501046_0012661 | |||
| 1519 | Ga0501047_0025488 | |||
| 1520 | Ga0501047_0144232 | |||
| 1521 | Ga0501048_0320806 | |||
| 1522 | Ga0501068_0022173 | |||
| 1523 | Ga0501068_0460653 | |||
| 1524 | Ga0501069_0009654 | |||
| 1525 | Ga0501070_0028182 | |||
| 1526 | Ga0501070_0035410 | |||
| 1527 | Ga0501070_0042923 | |||
| 1528 | Ga0501070_0521436 | |||
| 1529 | Ga0501070_1131760 | |||
| 1530 | Ga0501072_0016094 | |||
| 1531 | Ga0501073_0004611 | |||
| 1532 | Ga0501073_0008127 | |||
| 1533 | Ga0501074_0000309 | |||
| 1534 | Ga0501074_0011687 | |||
| 1535 | Ga0501074_0031959 | |||
| 1536 | Ga0501077_0408491 | |||
| 1537 | Ga0501079_0021387 | |||
| 1538 | Ga0501079_0466548 | |||
| 1539 | Ga0501080_0030890 | |||
| 1540 | Ga0501080_0119289 | |||
| 1541 | Ga0501080_0268733 | |||
| 1542 | Ga0501080_0328759 | |||
| 1543 | Ga0501080_0509019 | |||
| 1544 | Ga0501081_0051842 | |||
| 1545 | Ga0501083_0005715 | |||
| 1546 | Ga0501083_0017673 | |||
| 1547 | Ga0501083_0050134 | |||
| 1548 | Ga0501035_0218285 | |||
| 1549 | Ga0501035_0397289 | |||
| 1550 | Ga0501035_0905348 | |||
| 1551 | Ga0501044_0065144 | |||
| 1552 | Ga0501044_0561789 | |||
| 1553 | nmdc:mga03n38_472095_c1 | |||
| 1554 | nmdc:mga0k408_201082_c1 | |||
| 1555 | nmdc:mga0k408_33042_c1 | |||
| 1556 | nmdc:mga06z11_127541_c1 | |||
| 1557 | nmdc:mga07m45_158782_c1 | |||
| 1558 | nmdc:mga06r32_552569_c1 | |||
| 1559 | nmdc:mga08y16_1758_c1 | |||
| 1560 | nmdc:mga0n895_1797163_c1 | |||
| 1561 | nmdc:mga0n895_74366_c1 | |||
| 1562 | nmdc:mga0rr50_56142_c1 | |||
| 1563 | nmdc:mga08x19_22420_c1 | |||
| 1564 | nmdc:mga0a205_220133_c1 | |||
| 1565 | nmdc:mga0sz30_109693_c1 | |||
| 1566 | Ga0590077_021760 | |||
| 1567 | Ga0501082_0590995 | |||
| 1568 | Ga0466962_0002291 | |||
| 1569 | Ga0466962_0042464 | |||
| 1570 | Ga0466962_0169886 | |||
| 1571 | 2509129335 | |||
| 1572 | 2510253292 | |||
| 1573 | 2512347467 | |||
| 1574 | 2513962513 | |||
| 1575 | 2515679472 | |||
| 1576 | 2519459735 | |||
| 1577 | 2527079247 | |||
| 1578 | 2585291313 | |||
| 1579 | 2599739909 | |||
| 1580 | 2599748101 | |||
| 1581 | 2600210029 | |||
| 1582 | 2676746373 | |||
| 1583 | 2719639081 | |||
| 1584 | 2738820167 | |||
| 1585 | 2738832647 | |||
| 1586 | 2738874174 | |||
| 1587 | 2739185804 | |||
| 1588 | 2739220772 | |||
| 1589 | 2753565833 | |||
| 1590 | 2792834583 | |||
| 1591 | 2808968221 | |||
| 1592 | 2809003052 | |||
| 1593 | 2809010329 | |||
| 1594 | 2817262009 | |||
| 1595 | 2817279727 | |||
| 1596 | 2817453904 | |||
| 1597 | 2819633813 | |||
| 1598 | 2863426979 | |||
| 1599 | 2870070228 | |||
| 1600 | 2885277372 | |||
| 1601 | 2887379846 | |||
| 1602 | 2902689247 | |||
| 1603 | 2904488638 | |||
| 1604 | 2904570455 | |||
| 1605 | 2904577632 | |||
| 1606 | 2904620484 | |||
| 1607 | 2919532250 | |||
| 1608 | 2928109620 | |||
| 1609 | 2928136926 | |||
| 1610 | 2928161160 | |||
| 1611 | 2928169397 | |||
| 1612 | 2928175575 | |||
| 1613 | 2928506454 | |||
| 1614 | 2928542730 | |||
| 1615 | 2945935372 | |||
| 1616 | 2981992686 | |||
| 1617 | 2990704077 | |||
| 1618 | 642422234 | |||
| 1619 | 642416181 | |||
| 1620 | 8018851608 | |||
| 1621 | 8020813328 | |||
| 1622 | 8020945189 | |||
| 1623 | 8020948920 | |||
| 1624 | 8020955726 | |||
| 1625 | 8021125669 | |||
| 1626 | 8039101019 | |||
| 1627 | 8040169764 | |||
| 1628 | 8040178006 | |||
| 1629 | 8055266754 | |||
| 1630 | 8055303975 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l8h-assembly4.cif.gz_D | crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate | 0.9951 | 8 | 184 |
| 3l8h-assembly4.cif.gz_D | crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate | 0.9786 | 8 | 184 |
| 4pnh-assembly1.cif.gz_A | crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis | 0.939 | 8 | 183 |
| 4pnh-assembly1.cif.gz_A | crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis | 0.9216 | 8 | 183 |
| 2fps-assembly1.cif.gz_B | crystal structure of the n-terminal domain of e.coli hisb- apo ca model. | 0.8805 | 8 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l8hD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.993 | 8 | 184 | 3.40.50.1000 |
| 3l8hD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9817 | 8 | 184 | 3.40.50.1000 |
| 4jyrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9383 | 8 | 183 | 3.40.50.1000 |
| 4jyrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.921 | 8 | 183 | 3.40.50.1000 |
| af_P9WMV3_2_164_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9183 | 4 | 145 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A103RRL9-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase | 1.002 | 30 | 187 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |
| AF-A0A3D2R1F9-F1-model_v4 | D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase | 1.001 | 8 | 96 |
GO:0005975
GO:0016791 |
| AF-A0A3B0Z8E0-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase | 0.9991 | 8 | 114 |
GO:0005737
GO:0005975 GO:0016791 |
| AF-A0A7W8M8T6-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) | 0.999 | 8 | 181 |
GO:0005737
GO:0005975 GO:0034200 GO:0046872 |
| AF-A0A1I9YHL5-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) | 0.9988 | 5 | 187 |
GO:0005737
GO:0005975 GO:0016791 GO:0046872 |