F482012

General Info

Members Datasets Scaffolds Average Seq Length
815 324 1630 119

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101593708|Ga0075428_1015937081
Length 122
Sequence MRVTNAPASRKRRGRMLQAAKGFRLKRSKLYRYASDAVDHGRQYAYRDREFRYLWQIRINAAVRAAGLTYSRFMEGLKAAKVSLDRKVLADVAARDTVAFASIIDVAKNALKAKPAASLAKA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
168 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
174 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
231 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
319 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 0.74
Rhizosphere 98.65
Stem 0
Stem Tuber 0
Unclassified 26.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_101593708 3300006844 Unclassified 683
2 JGI26145J50221_1009864 3300003371 Bacteria 835
3 Ga0065707_10238720 3300005295 Bacteria 1163
4 Ga0070658_10116558 3300005327 Bacteria 2216
5 Ga0070658_10607157 3300005327 Bacteria 948
6 Ga0070658_11409434 3300005327 Bacteria 605
7 Ga0070683_100807062 3300005329 Unclassified 900
8 Ga0070683_101007885 3300005329 Bacteria 800
9 Ga0070683_102267492 3300005329 Unclassified 521
10 Ga0070690_100586380 3300005330 Bacteria 845
11 Ga0068869_100548325 3300005334 Bacteria 971
12 Ga0068869_100596781 3300005334 Bacteria 932
13 Ga0070680_100333819 3300005336 Bacteria 1288
14 Ga0070680_100666808 3300005336 Unclassified 894
15 Ga0068868_100564397 3300005338 Bacteria 1004
16 Ga0068868_101039436 3300005338 Bacteria 751
17 Ga0068868_102069211 3300005338 Bacteria 541
18 Ga0070660_100052070 3300005339 Bacteria 3154
19 Ga0070689_100002628 3300005340 Bacteria 11765
20 Ga0070689_100059599 3300005340 Bacteria 2967
21 Ga0070689_100272150 3300005340 Bacteria 1402
22 Ga0070689_100426252 3300005340 Unclassified 1125
23 Ga0070689_100680191 3300005340 Bacteria 897
24 Ga0070689_101365142 3300005340 Bacteria 640
25 Ga0070689_101624635 3300005340 Unclassified 587
26 Ga0070691_10405975 3300005341 Unclassified 769
27 Ga0070691_10897848 3300005341 Unclassified 546
28 Ga0070687_100158841 3300005343 Bacteria 1334
29 Ga0070687_100463855 3300005343 Unclassified 845
30 Ga0070661_100357840 3300005344 Bacteria 1146
31 Ga0070661_100459602 3300005344 Bacteria 1014
32 Ga0070692_10415497 3300005345 Unclassified 853
33 Ga0070668_100150488 3300005347 Bacteria 1882
34 Ga0070669_100376261 3300005353 Bacteria 1157
35 Ga0070675_100064748 3300005354 Bacteria 3022
36 Ga0070671_100378459 3300005355 Bacteria 1210
37 Ga0070674_100179140 3300005356 Bacteria 1622
38 Ga0070688_100036939 3300005365 Bacteria 2974
39 Ga0070659_100174500 3300005366 Bacteria 1762
40 Ga0070659_100453115 3300005366 Bacteria 1088
41 Ga0070659_100932418 3300005366 Bacteria 760
42 Ga0070667_100266794 3300005367 Bacteria 1534
43 Ga0070667_101847728 3300005367 Bacteria 569
44 Ga0070703_10484150 3300005406 Bacteria 554
45 Ga0070714_100013741 3300005435 Bacteria 6493
46 Ga0070714_100394148 3300005435 Bacteria 1307
47 Ga0070714_102350836 3300005435 Bacteria 518
48 Ga0070713_100017222 3300005436 Bacteria 5459
49 Ga0070713_100423363 3300005436 Unclassified 1247
50 Ga0070713_100867665 3300005436 Unclassified 867
51 Ga0070710_10191423 3300005437 Bacteria 1287
52 Ga0070701_10052677 3300005438 Bacteria 2115
53 Ga0070701_10692980 3300005438 Unclassified 684
54 Ga0070701_10964352 3300005438 Bacteria 593
55 Ga0070711_100033987 3300005439 Bacteria 3399
56 Ga0070711_100228833 3300005439 Unclassified 1449
57 Ga0070711_100234795 3300005439 Bacteria 1431
58 Ga0070700_100060780 3300005441 Unclassified 2382
59 Ga0070694_100409466 3300005444 Bacteria 1063
60 Ga0070694_100574506 3300005444 Bacteria 905
61 Ga0070694_100975180 3300005444 Bacteria 703
62 Ga0070694_101117618 3300005444 Unclassified 658
63 Ga0070708_100290653 3300005445 Bacteria 1539
64 Ga0070662_100125091 3300005457 Bacteria 1975
65 Ga0070681_10096362 3300005458 Bacteria 2906
66 Ga0070681_10408656 3300005458 Bacteria 1269
67 Ga0070681_10725791 3300005458 Bacteria 910
68 Ga0070681_10897796 3300005458 Bacteria 804
69 Ga0070681_11280522 3300005458 Bacteria 656
70 Ga0068867_101111306 3300005459 Unclassified 722
71 Ga0068867_101440615 3300005459 Bacteria 640
72 Ga0070685_10080142 3300005466 Unclassified 1955
73 Ga0070685_10577736 3300005466 Bacteria 806
74 Ga0070685_11091053 3300005466 Bacteria 603
75 Ga0070707_100737491 3300005468 Bacteria 948
76 Ga0070679_100111689 3300005530 Bacteria 2719
77 Ga0070679_100153177 3300005530 Bacteria 2281
78 Ga0070684_100233653 3300005535 Bacteria 1679
79 Ga0070684_100753254 3300005535 Unclassified 909
80 Ga0070684_101230921 3300005535 Bacteria 704
81 Ga0068853_100925426 3300005539 Unclassified 838
82 Ga0068853_101241975 3300005539 Bacteria 720
83 Ga0070672_100079779 3300005543 Bacteria 2621
84 Ga0070686_100037438 3300005544 Bacteria 3009
85 Ga0070686_100055517 3300005544 Bacteria 2538
86 Ga0070686_100638655 3300005544 Bacteria 843
87 Ga0070686_101348648 3300005544 Bacteria 597
88 Ga0070686_101631663 3300005544 Bacteria 546
89 Ga0070686_101922060 3300005544 Unclassified 505
90 Ga0070695_100719485 3300005545 Bacteria 794
91 Ga0070696_100002260 3300005546 Bacteria 12697
92 Ga0070696_101188673 3300005546 Bacteria 644
93 Ga0070696_101864530 3300005546 Unclassified 520
94 Ga0070693_100117278 3300005547 Bacteria 1646
95 Ga0070693_101277602 3300005547 Bacteria 566
96 Ga0070704_100018152 3300005549 Bacteria 4490
97 Ga0070704_100961706 3300005549 Bacteria 771
98 Ga0068855_100121181 3300005563 Bacteria 2993
99 Ga0068855_100179188 3300005563 Bacteria 2397
100 Ga0068855_100576436 3300005563 Bacteria 1216
101 Ga0070664_100487782 3300005564 Bacteria 1134
102 Ga0068857_100192877 3300005577 Bacteria 1856
103 Ga0068857_100795923 3300005577 Bacteria 903
104 Ga0068857_100798430 3300005577 Unclassified 901
105 Ga0068857_102047102 3300005577 Unclassified 562
106 Ga0068854_100968037 3300005578 Bacteria 752
107 Ga0068856_100000333 3300005614 Bacteria 51689
108 Ga0068856_100023624 3300005614 Bacteria 5978
109 Ga0068856_100854797 3300005614 Unclassified 929
110 Ga0068856_101375518 3300005614 Bacteria 720
111 Ga0068856_102608359 3300005614 Unclassified 511
112 Ga0070702_100300392 3300005615 Bacteria 1110
113 Ga0070702_100437744 3300005615 Bacteria 945
114 Ga0070702_101412786 3300005615 Unclassified 569
115 Ga0070702_101757066 3300005615 Unclassified 517
116 Ga0068852_100931109 3300005616 Bacteria 887
117 Ga0068852_101095378 3300005616 Bacteria 817
118 Ga0068859_100004959 3300005617 Bacteria 13519
119 Ga0068859_100139020 3300005617 Bacteria 2502
120 Ga0068859_100927605 3300005617 Bacteria 955
121 Ga0068859_101658710 3300005617 Unclassified 706
122 Ga0068859_102446850 3300005617 Bacteria 575
123 Ga0068864_100063696 3300005618 Unclassified 3196
124 Ga0068864_100701211 3300005618 Bacteria 989
125 Ga0068864_100889844 3300005618 Unclassified 879
126 Ga0068864_101921568 3300005618 Bacteria 598
127 Ga0068864_102661788 3300005618 Unclassified 506
128 Ga0068861_100759043 3300005719 Bacteria 907
129 Ga0068861_101383095 3300005719 Unclassified 687
130 Ga0068861_102188067 3300005719 Unclassified 554
131 Ga0068861_102202981 3300005719 Unclassified 552
132 Ga0068851_10397127 3300005834 Bacteria 811
133 Ga0068851_10720974 3300005834 Unclassified 615
134 Ga0068863_100008630 3300005841 Bacteria 9957
135 Ga0068863_100084221 3300005841 Unclassified 3014
136 Ga0068863_100292416 3300005841 Bacteria 1579
137 Ga0068863_100417521 3300005841 Bacteria 1314
138 Ga0068863_101616786 3300005841 Bacteria 657
139 Ga0068863_101617628 3300005841 Bacteria 657
140 Ga0068858_100479568 3300005842 Unclassified 1200
141 Ga0068858_100724832 3300005842 Unclassified 968
142 Ga0068860_100962671 3300005843 Bacteria 871
143 Ga0081455_10063110 3300005937 Bacteria 3110
144 Ga0070716_100127312 3300006173 Bacteria 1604
145 Ga0070712_100232344 3300006175 Bacteria 1465
146 Ga0070712_100440067 3300006175 Unclassified 1084
147 Ga0070712_100502228 3300006175 Bacteria 1017
148 Ga0070712_101303974 3300006175 Bacteria 633
149 Ga0097621_100801967 3300006237 Bacteria 872
150 Ga0097621_101831803 3300006237 Bacteria 579
151 Ga0068871_100475699 3300006358 Bacteria 1123
152 Ga0068871_101057368 3300006358 Bacteria 758
153 Ga0068871_101323069 3300006358 Bacteria 678
154 Ga0068871_102257318 3300006358 Bacteria 519
155 Ga0075428_100006818 3300006844 Bacteria 12704
156 Ga0075428_100086404 3300006844 Bacteria 3421
157 Ga0075428_100861661 3300006844 Unclassified 962
158 Ga0075428_100944744 3300006844 Bacteria 914
159 Ga0075430_100772963 3300006846 Unclassified 791
160 Ga0075431_100234992 3300006847 Bacteria 1866
161 Ga0075431_100566964 3300006847 Unclassified 1122
162 Ga0075433_11001944 3300006852 Bacteria 728
163 Ga0075434_100896515 3300006871 Bacteria 902
164 Ga0075434_100965968 3300006871 Unclassified 866
165 Ga0075434_101426855 3300006871 Unclassified 702
166 Ga0075434_101738840 3300006871 Unclassified 631
167 Ga0068865_100585338 3300006881 Unclassified 941
168 Ga0075436_100447533 3300006914 Unclassified 940
169 Ga0075436_100502456 3300006914 Bacteria 887
170 Ga0075436_100747422 3300006914 Unclassified 726
171 Ga0075436_101523610 3300006914 Bacteria 508
172 Ga0097620_100004959 3300006931 Bacteria 13519
173 Ga0097620_100139020 3300006931 Bacteria 2502
174 Ga0097620_100927579 3300006931 Bacteria 955
175 Ga0097620_101658190 3300006931 Unclassified 706
176 Ga0097620_102447691 3300006931 Bacteria 575
177 Ga0075435_100078589 3300007076 Bacteria 2706
178 Ga0075435_100524012 3300007076 Unclassified 1025
179 Ga0075435_101146329 3300007076 Unclassified 680
180 Ga0099794_10188183 3300007265 Bacteria 1055
181 Ga0099794_10439374 3300007265 Bacteria 684
182 Ga0099795_10118406 3300007788 Bacteria 1057
183 Ga0105240_10000711 3300009093 Bacteria 60985
184 Ga0105240_10041167 3300009093 Bacteria 5900
185 Ga0105240_10093999 3300009093 Bacteria 3658
186 Ga0105240_10146774 3300009093 Bacteria 2814
187 Ga0105240_10211357 3300009093 Unclassified 2267
188 Ga0105240_10316106 3300009093 Bacteria 1781
189 Ga0105240_10907929 3300009093 Bacteria 947
190 Ga0105240_12365030 3300009093 Bacteria 550
191 Ga0111539_10143389 3300009094 Bacteria 2796
192 Ga0111539_10147752 3300009094 Bacteria 2752
193 Ga0111539_10199190 3300009094 Unclassified 2335
194 Ga0111539_10247244 3300009094 Bacteria 2076
195 Ga0111539_10293584 3300009094 Bacteria 1892
196 Ga0111539_10415521 3300009094 Unclassified 1567
197 Ga0111539_10434634 3300009094 Unclassified 1528
198 Ga0111539_11187519 3300009094 Bacteria 886
199 Ga0111539_11931963 3300009094 Bacteria 684
200 Ga0105245_10843129 3300009098 Bacteria 956
201 Ga0105245_12618231 3300009098 Unclassified 558
202 Ga0105245_13272360 3300009098 Unclassified 502
203 Ga0114129_10308395 3300009147 Bacteria 2107
204 Ga0114129_11150348 3300009147 Bacteria 969
205 Ga0105243_11284138 3300009148 Bacteria 748
206 Ga0105243_12224788 3300009148 Unclassified 585
207 Ga0105241_10264853 3300009174 Bacteria 1462
208 Ga0105242_10049696 3300009176 Bacteria 3413
209 Ga0105242_10096426 3300009176 Unclassified 2498
210 Ga0105242_11706116 3300009176 Unclassified 666
211 Ga0105248_10002679 3300009177 Bacteria 19773
212 Ga0105248_10287924 3300009177 Bacteria 1850
213 Ga0105248_10696089 3300009177 Bacteria 1147
214 Ga0105248_10834565 3300009177 Bacteria 1040
215 Ga0105248_10989966 3300009177 Bacteria 950
216 Ga0105248_11154305 3300009177 Unclassified 876
217 Ga0105248_13050859 3300009177 Bacteria 533
218 Ga0105237_10377154 3300009545 Bacteria 1423
219 Ga0105237_11522772 3300009545 Bacteria 676
220 Ga0105238_10009790 3300009551 Bacteria 9595
221 Ga0105238_10029677 3300009551 Bacteria 5570
222 Ga0105238_10078731 3300009551 Bacteria 3286
223 Ga0105238_10219669 3300009551 Bacteria 1876
224 Ga0105238_10489331 3300009551 Bacteria 1230
225 Ga0105238_10820404 3300009551 Unclassified 946
226 Ga0105238_12366700 3300009551 Bacteria 566
227 Ga0105249_10600692 3300009553 Bacteria 1155
228 Ga0105249_12308474 3300009553 Bacteria 611
229 Ga0105239_10151904 3300010375 Bacteria 2584
230 Ga0105239_12197316 3300010375 Bacteria 642
231 Ga0105246_11171745 3300011119 Bacteria 706
232 Ga0157373_10255114 3300013100 Bacteria 1241
233 Ga0157373_10332625 3300013100 Bacteria 1082
234 Ga0157370_10067916 3300013104 Bacteria 3369
235 Ga0157370_10274932 3300013104 Unclassified 1556
236 Ga0157370_10309732 3300013104 Unclassified 1457
237 Ga0157370_10689703 3300013104 Bacteria 932
238 Ga0157369_10732018 3300013105 Bacteria 1018
239 Ga0157369_11372755 3300013105 Bacteria 720
240 Ga0157369_11894006 3300013105 Bacteria 605
241 Ga0157374_10131416 3300013296 Unclassified 2423
242 Ga0157374_11144739 3300013296 Bacteria 799
243 Ga0157374_11271070 3300013296 Unclassified 758
244 Ga0157378_10316020 3300013297 Bacteria 1516
245 Ga0157378_10665928 3300013297 Bacteria 1058
246 Ga0157378_10729749 3300013297 Bacteria 1012
247 Ga0157378_10862590 3300013297 Bacteria 934
248 Ga0157378_12477267 3300013297 Bacteria 571
249 Ga0157378_12676642 3300013297 Unclassified 551
250 Ga0163162_10296440 3300013306 Bacteria 1749
251 Ga0163162_11789026 3300013306 Unclassified 702
252 Ga0157372_10012520 3300013307 Bacteria 9034
253 Ga0157372_10039202 3300013307 Bacteria 5230
254 Ga0157372_10292207 3300013307 Unclassified 1895
255 Ga0157372_10786642 3300013307 Bacteria 1106
256 Ga0157372_11114440 3300013307 Unclassified 913
257 Ga0157375_10000036 3300013308 Bacteria 177008
258 Ga0157375_10624566 3300013308 Unclassified 1235
259 Ga0157375_11308405 3300013308 Unclassified 852
260 Ga0163163_10000067 3300014325 Bacteria 114831
261 Ga0163163_10040992 3300014325 Bacteria 4526
262 Ga0163163_10300912 3300014325 Bacteria 1656
263 Ga0163163_11559779 3300014325 Unclassified 721
264 Ga0157380_10801447 3300014326 Bacteria 959
265 Ga0157380_11040558 3300014326 Unclassified 854
266 Ga0157380_11557827 3300014326 Unclassified 715
267 Ga0157379_10086226 3300014968 Bacteria 2815
268 Ga0157379_10123194 3300014968 Unclassified 2333
269 Ga0157376_10296121 3300014969 Bacteria 1530
270 Ga0157376_12784382 3300014969 Unclassified 529
271 Ga0163161_11787587 3300017792 Bacteria 546
272 Ga0206356_11283718 3300020070 Bacteria 695
273 Ga0206353_10613002 3300020082 Bacteria 911
274 Ga0207656_10502415 3300025321 Unclassified 616
275 Ga0207692_10030925 3300025898 Bacteria 2559
276 Ga0207688_10203079 3300025901 Bacteria 1189
277 Ga0207699_10012821 3300025906 Bacteria 4270
278 Ga0207645_10680784 3300025907 Bacteria 699
279 Ga0207705_10560376 3300025909 Bacteria 888
280 Ga0207684_10838610 3300025910 Unclassified 775
281 Ga0207654_10370300 3300025911 Bacteria 990
282 Ga0207707_10163771 3300025912 Bacteria 1944
283 Ga0207695_10001486 3300025913 Bacteria 39184
284 Ga0207695_10039795 3300025913 Bacteria 5049
285 Ga0207695_10115378 3300025913 Bacteria 2660
286 Ga0207695_10191605 3300025913 Bacteria 1962
287 Ga0207695_10229821 3300025913 Unclassified 1760
288 Ga0207695_10265970 3300025913 Bacteria 1611
289 Ga0207695_11265214 3300025913 Bacteria 618
290 Ga0207671_10325858 3300025914 Bacteria 1216
291 Ga0207671_11391612 3300025914 Bacteria 544
292 Ga0207693_10153434 3300025915 Bacteria 1812
293 Ga0207693_10916670 3300025915 Bacteria 672
294 Ga0207663_10014922 3300025916 Unclassified 4271
295 Ga0207663_10090826 3300025916 Bacteria 2026
296 Ga0207663_11289515 3300025916 Bacteria 588
297 Ga0207660_10431121 3300025917 Unclassified 1064
298 Ga0207660_10841745 3300025917 Bacteria 749
299 Ga0207662_10103009 3300025918 Bacteria 1771
300 Ga0207662_10361414 3300025918 Unclassified 977
301 Ga0207662_10854118 3300025918 Unclassified 643
302 Ga0207657_10050715 3300025919 Bacteria 3610
303 Ga0207649_10276577 3300025920 Bacteria 1219
304 Ga0207649_10599038 3300025920 Bacteria 847
305 Ga0207652_10032134 3300025921 Bacteria 4408
306 Ga0207652_10187267 3300025921 Bacteria 1861
307 Ga0207652_11282099 3300025921 Unclassified 635
308 Ga0207646_10171037 3300025922 Unclassified 1962
309 Ga0207646_10983970 3300025922 Unclassified 746
310 Ga0207646_11172765 3300025922 Unclassified 674
311 Ga0207694_10020783 3300025924 Bacteria 4969
312 Ga0207694_10025236 3300025924 Bacteria 4517
313 Ga0207694_10215584 3300025924 Bacteria 1565
314 Ga0207694_10421574 3300025924 Bacteria 1112
315 Ga0207694_10792113 3300025924 Unclassified 801
316 Ga0207659_10603627 3300025926 Unclassified 936
317 Ga0207687_10367058 3300025927 Bacteria 1176
318 Ga0207687_11593944 3300025927 Unclassified 560
319 Ga0207700_10019165 3300025928 Bacteria 4617
320 Ga0207700_10528860 3300025928 Unclassified 1045
321 Ga0207700_11405544 3300025928 Unclassified 620
322 Ga0207664_10002691 3300025929 Bacteria 11789
323 Ga0207664_10006289 3300025929 Bacteria 8162
324 Ga0207644_10315241 3300025931 Bacteria 1263
325 Ga0207690_10065204 3300025932 Bacteria 2490
326 Ga0207690_10273171 3300025932 Bacteria 1314
327 Ga0207706_10050263 3300025933 Bacteria 3684
328 Ga0207686_10053853 3300025934 Bacteria 2518
329 Ga0207686_10156519 3300025934 Unclassified 1592
330 Ga0207686_10793290 3300025934 Bacteria 759
331 Ga0207670_10010394 3300025936 Bacteria 5359
332 Ga0207670_10038951 3300025936 Bacteria 3109
333 Ga0207670_10081443 3300025936 Bacteria 2265
334 Ga0207670_10150737 3300025936 Bacteria 1725
335 Ga0207670_10441721 3300025936 Bacteria 1047
336 Ga0207670_10491130 3300025936 Bacteria 996
337 Ga0207669_10614490 3300025937 Bacteria 885
338 Ga0207669_10994970 3300025937 Bacteria 704
339 Ga0207665_10305913 3300025939 Bacteria 1189
340 Ga0207665_11025648 3300025939 Bacteria 657
341 Ga0207665_11503111 3300025939 Unclassified 535
342 Ga0207691_10486771 3300025940 Bacteria 1048
343 Ga0207691_11377780 3300025940 Unclassified 580
344 Ga0207711_10011291 3300025941 Bacteria 7420
345 Ga0207689_10738908 3300025942 Bacteria 830
346 Ga0207689_11218347 3300025942 Bacteria 633
347 Ga0207661_10304455 3300025944 Unclassified 1430
348 Ga0207661_10606791 3300025944 Unclassified 1005
349 Ga0207679_11651340 3300025945 Bacteria 587
350 Ga0207667_10023109 3300025949 Bacteria 6849
351 Ga0207667_10203627 3300025949 Bacteria 2030
352 Ga0207667_10245694 3300025949 Bacteria 1831
353 Ga0207667_10349173 3300025949 Unclassified 1509
354 Ga0207667_10988737 3300025949 Bacteria 829
355 Ga0207651_11938690 3300025960 Bacteria 530
356 Ga0207712_12113299 3300025961 Unclassified 504
357 Ga0207668_11306736 3300025972 Bacteria 653
358 Ga0207658_11076035 3300025986 Bacteria 734
359 Ga0207658_11473376 3300025986 Bacteria 623
360 Ga0207677_10270475 3300026023 Bacteria 1390
361 Ga0207677_12024613 3300026023 Bacteria 535
362 Ga0207703_11444908 3300026035 Unclassified 662
363 Ga0207639_12076209 3300026041 Bacteria 529
364 Ga0207678_11201319 3300026067 Bacteria 671
365 Ga0207678_11768408 3300026067 Bacteria 542
366 Ga0207708_10274832 3300026075 Bacteria 1364
367 Ga0207708_10795981 3300026075 Bacteria 814
368 Ga0207702_10000259 3300026078 Bacteria 61188
369 Ga0207702_10042210 3300026078 Bacteria 3826
370 Ga0207702_10130463 3300026078 Unclassified 2261
371 Ga0207702_10788911 3300026078 Unclassified 939
372 Ga0207702_10991150 3300026078 Unclassified 833
373 Ga0207702_11268878 3300026078 Unclassified 731
374 Ga0207702_12232551 3300026078 Bacteria 536
375 Ga0207702_12493069 3300026078 Unclassified 504
376 Ga0207641_10482099 3300026088 Bacteria 1202
377 Ga0207641_11025422 3300026088 Bacteria 822
378 Ga0207641_11935646 3300026088 Unclassified 591
379 Ga0207641_12053081 3300026088 Unclassified 573
380 Ga0207648_10253690 3300026089 Bacteria 1568
381 Ga0207648_10405020 3300026089 Bacteria 1237
382 Ga0207648_10408174 3300026089 Unclassified 1232
383 Ga0207648_11808391 3300026089 Bacteria 573
384 Ga0207676_10138522 3300026095 Unclassified 2080
385 Ga0207676_11174478 3300026095 Bacteria 760
386 Ga0207674_10648540 3300026116 Bacteria 1020
387 Ga0207674_10749364 3300026116 Bacteria 943
388 Ga0207674_11269318 3300026116 Unclassified 706
389 Ga0207674_11280648 3300026116 Bacteria 703
390 Ga0207675_100190917 3300026118 Bacteria 1965
391 Ga0207675_100612160 3300026118 Bacteria 1093
392 Ga0207675_101428885 3300026118 Bacteria 712
393 Ga0207698_10292264 3300026142 Bacteria 1513
394 Ga0207698_11076212 3300026142 Unclassified 816
395 Ga0209981_1006505 3300027378 Bacteria 1564
396 Ga0209984_1033594 3300027424 Bacteria 729
397 Ga0210000_1002922 3300027462 Bacteria 2443
398 Ga0209999_1012191 3300027543 Bacteria 1556
399 Ga0209982_1010399 3300027552 Bacteria 1377
400 Ga0209983_1001526 3300027665 Bacteria 5145
401 Ga0209971_1006080 3300027682 Bacteria 2860
402 Ga0209974_10002416 3300027876 Bacteria 6766
403 Ga0207428_10113363 3300027907 Bacteria 2084
404 Ga0207428_10448079 3300027907 Bacteria 941
405 Ga0207428_10747964 3300027907 Bacteria 697
406 Ga0268264_10809127 3300028381 Bacteria 937
407 Ga0268264_11702785 3300028381 Unclassified 641
408 Ga0265337_1000269 3300028556 Bacteria 28329
409 Ga0265337_1006463 3300028556 Bacteria 4514
410 Ga0265337_1009750 3300028556 Bacteria 3410
411 Ga0265337_1014485 3300028556 Bacteria 2613
412 Ga0265337_1047643 3300028556 Bacteria 1214
413 Ga0265326_10002061 3300028558 Bacteria 6852
414 Ga0265326_10026223 3300028558 Bacteria 1662
415 Ga0265326_10029103 3300028558 Unclassified 1574
416 Ga0265326_10046844 3300028558 Bacteria 1226
417 Ga0265319_1000001 3300028563 Bacteria 549513
418 Ga0265319_1015923 3300028563 Bacteria 2894
419 Ga0265319_1085928 3300028563 Unclassified 996
420 Ga0265334_10017859 3300028573 Bacteria 2926
421 Ga0265334_10031370 3300028573 Bacteria 2124
422 Ga0265334_10191869 3300028573 Unclassified 712
423 Ga0265318_10122269 3300028577 Bacteria 957
424 Ga0265318_10140535 3300028577 Bacteria 887
425 Ga0265318_10147194 3300028577 Bacteria 864
426 Ga0265323_10001379 3300028653 Bacteria 12026
427 Ga0265323_10016104 3300028653 Bacteria 2926
428 Ga0265322_10015098 3300028654 Bacteria 2233
429 Ga0265322_10042408 3300028654 Unclassified 1295
430 Ga0265322_10254084 3300028654 Bacteria 505
431 Ga0265336_10000586 3300028666 Bacteria 20502
432 Ga0265336_10037892 3300028666 Bacteria 1481
433 Ga0265336_10075819 3300028666 Unclassified 1004
434 Ga0265336_10101511 3300028666 Bacteria 857
435 Ga0265336_10162811 3300028666 Bacteria 663
436 Ga0265336_10210789 3300028666 Bacteria 577
437 Ga0265338_10000030 3300028800 Bacteria 260974
438 Ga0265338_10000032 3300028800 Bacteria 257580
439 Ga0265338_10000041 3300028800 Bacteria 230676
440 Ga0265338_10001233 3300028800 Bacteria 42256
441 Ga0265338_10002413 3300028800 Bacteria 28135
442 Ga0265338_10002424 3300028800 Bacteria 28039
443 Ga0265338_10005324 3300028800 Bacteria 16845
444 Ga0265338_10007470 3300028800 Bacteria 13551
445 Ga0265338_10010884 3300028800 Bacteria 10585
446 Ga0265338_10011620 3300028800 Bacteria 10148
447 Ga0265338_10012697 3300028800 Bacteria 9586
448 Ga0265338_10026423 3300028800 Bacteria 5856
449 Ga0265338_10035706 3300028800 Bacteria 4770
450 Ga0265338_10039538 3300028800 Bacteria 4447
451 Ga0265338_10061058 3300028800 Bacteria 3306
452 Ga0265338_10096938 3300028800 Bacteria 2418
453 Ga0265338_10097818 3300028800 Bacteria 2403
454 Ga0265338_10116705 3300028800 Bacteria 2138
455 Ga0265338_10167914 3300028800 Unclassified 1687
456 Ga0265338_10175173 3300028800 Bacteria 1640
457 Ga0265338_10183037 3300028800 Bacteria 1595
458 Ga0265338_10584372 3300028800 Bacteria 779
459 Ga0265338_10648725 3300028800 Bacteria 732
460 Ga0265338_10850002 3300028800 Bacteria 623
461 Ga0265338_11142333 3300028800 Bacteria 524
462 Ga0265324_10012004 3300029957 Bacteria 3283
463 Ga0265324_10022204 3300029957 Bacteria 2270
464 Ga0265324_10026322 3300029957 Bacteria 2059
465 Ga0265324_10033066 3300029957 Bacteria 1806
466 Ga0265324_10033947 3300029957 Bacteria 1778
467 Ga0265324_10043437 3300029957 Unclassified 1551
468 Ga0265324_10068622 3300029957 Bacteria 1209
469 Ga0265324_10087808 3300029957 Bacteria 1057
470 Ga0265324_10113975 3300029957 Bacteria 918
471 Ga0265324_10268554 3300029957 Unclassified 580
472 Ga0265760_10209941 3300031090 Bacteria 660
473 Ga0265332_10045477 3300031238 Bacteria 1892
474 Ga0265332_10184899 3300031238 Bacteria 868
475 Ga0265328_10016270 3300031239 Bacteria 2897
476 Ga0265320_10000939 3300031240 Bacteria 21724
477 Ga0265320_10007536 3300031240 Bacteria 6750
478 Ga0265320_10027370 3300031240 Bacteria 2973
479 Ga0265320_10037960 3300031240 Bacteria 2422
480 Ga0265320_10169710 3300031240 Unclassified 980
481 Ga0265320_10281760 3300031240 Bacteria 736
482 Ga0265320_10290504 3300031240 Bacteria 723
483 Ga0265320_10546532 3300031240 Unclassified 512
484 Ga0265325_10041915 3300031241 Bacteria 2396
485 Ga0265325_10089147 3300031241 Bacteria 1523
486 Ga0265329_10002621 3300031242 Bacteria 8095
487 Ga0265329_10056518 3300031242 Bacteria 1244
488 Ga0265340_10000417 3300031247 Bacteria 22826
489 Ga0265340_10015340 3300031247 Unclassified 3981
490 Ga0265340_10341831 3300031247 Bacteria 661
491 Ga0265340_10434803 3300031247 Unclassified 578
492 Ga0265339_10118633 3300031249 Bacteria 1362
493 Ga0265339_10496491 3300031249 Unclassified 564
494 Ga0265339_10538592 3300031249 Unclassified 537
495 Ga0265331_10088866 3300031250 Bacteria 1429
496 Ga0265331_10422242 3300031250 Unclassified 598
497 Ga0265331_10427167 3300031250 Bacteria 595
498 Ga0265327_10000379 3300031251 Bacteria 83712
499 Ga0265327_10003825 3300031251 Bacteria 13914
500 Ga0265327_10055436 3300031251 Bacteria 2047
501 Ga0265327_10276771 3300031251 Bacteria 742
502 Ga0265316_10002569 3300031344 Bacteria 18754
503 Ga0265316_10009532 3300031344 Bacteria 8936
504 Ga0265316_10179213 3300031344 Bacteria 1578
505 Ga0265316_10205380 3300031344 Bacteria 1459
506 Ga0265316_10292055 3300031344 Bacteria 1189
507 Ga0265316_10339335 3300031344 Bacteria 1089
508 Ga0265316_10362513 3300031344 Bacteria 1048
509 Ga0265316_10881245 3300031344 Bacteria 626
510 Ga0265316_10912864 3300031344 Bacteria 613
511 Ga0265316_11080034 3300031344 Unclassified 557
512 Ga0307513_10768336 3300031456 Bacteria 669
513 Ga0265313_10000837 3300031595 Bacteria 31004
514 Ga0316575_10141479 3300031665 Bacteria 990
515 Ga0265314_10000070 3300031711 Bacteria 153096
516 Ga0265314_10075416 3300031711 Bacteria 2244
517 Ga0265314_10272126 3300031711 Bacteria 962
518 Ga0265342_10113918 3300031712 Bacteria 1528
519 Ga0265342_10226607 3300031712 Unclassified 1005
520 Ga0265342_10370617 3300031712 Unclassified 743
521 Ga0265342_10595381 3300031712 Unclassified 558
522 Ga0265342_10641493 3300031712 Bacteria 534
523 Ga0316576_10024532 3300031727 Bacteria 4211
524 Ga0316578_10216970 3300031728 Bacteria 1150
525 Ga0316578_10599944 3300031728 Unclassified 645
526 Ga0307406_11319145 3300031901 Bacteria 630
527 Ga0316583_10059453 3300032133 Bacteria 1341
528 Ga0307510_10255979 3300033180 Bacteria 1235
529 Ga0316596_1146570 3300033541 Unclassified 647
530 Ga0373950_0160536 3300034818 Unclassified 519
531 Ga0373959_0133970 3300034820 Bacteria 615
532 Ga0373926_0044445 3300035083 Bacteria 1591
533 Ga0373926_0144594 3300035083 Bacteria 904
534 Ga0373928_0001832 3300035084 Bacteria 4141
535 Ga0373929_0002598 3300035085 Bacteria 3310
536 Ga0373944_0000243 3300035089 Bacteria 11920
537 Ga0373944_0004703 3300035089 Bacteria 3567
538 Ga0373944_0156133 3300035089 Bacteria 807
539 Ga0373949_0008104 3300035090 Bacteria 2303
540 Ga0373951_0006156 3300035091 Bacteria 2754
541 Ga0373952_0176663 3300035092 Bacteria 613
542 Ga0373923_0129710 3300035111 Bacteria 1132
543 Ga0373923_0263914 3300035111 Unclassified 808
544 Ga0373932_0000003 3300035112 Bacteria 459351
545 Ga0373945_0030507 3300035116 Bacteria 1901
546 Ga0373954_0019308 3300035118 Unclassified 3073
547 Ga0373954_0033939 3300035118 Bacteria 2361
548 Ga0373954_0313055 3300035118 Bacteria 775
549 Ga0373956_0052640 3300035119 Bacteria 1831
550 Ga0373956_0058343 3300035119 Bacteria 1745
551 Ga0373957_0100716 3300035120 Bacteria 1156
552 Ga0373943_0040802 3300035170 Unclassified 2242
553 Ga0373943_0156505 3300035170 Bacteria 1238
554 Ga0373946_0087031 3300035171 Unclassified 1378
555 Ga0373946_0478896 3300035171 Bacteria 636
556 Ga0373955_0491452 3300035172 Unclassified 749
557 Ga0373962_0000059 3300035242 Bacteria 23801
558 Ga0373931_0000054 3300035691 Bacteria 58930
559 Ga0373931_0214402 3300035691 Unclassified 1156
560 Ga0373931_0809671 3300035691 Bacteria 625
561 Ga0373935_0049025 3300035692 Unclassified 2676
562 Ga0373935_0283923 3300035692 Bacteria 1166
563 Ga0373935_0381767 3300035692 Unclassified 1009
564 Ga0373927_0003514 3300035695 Bacteria 11216
565 Ga0373927_0065858 3300035695 Bacteria 2343
566 Ga0373927_0148529 3300035695 Unclassified 1535
567 Ga0373927_0408599 3300035695 Bacteria 896
568 Ga0373927_0817518 3300035695 Bacteria 615
569 Ga0373933_0079446 3300035724 Bacteria 2009
570 Ga0373933_0494709 3300035724 Bacteria 801
571 Ga0373933_0798320 3300035724 Unclassified 621
572 Ga0373947_0011605 3300035725 Bacteria 5055
573 Ga0373947_0098809 3300035725 Bacteria 1831
574 Ga0373937_0003348 3300036401 Bacteria 13454
575 Ga0373937_0123186 3300036401 Unclassified 2417
576 Ga0373937_0441780 3300036401 Bacteria 1235
577 Ga0373937_0447919 3300036401 Bacteria 1226
578 Ga0373937_0515944 3300036401 Bacteria 1136
579 Ga0373937_1005377 3300036401 Bacteria 783
580 Ga0373937_1589040 3300036401 Bacteria 601
581 Ga0316582_0822322 3300036647 Bacteria 636
582 Ga0373925_0000299 3300037068 Bacteria 51930
583 Ga0373925_0005364 3300037068 Bacteria 9565
584 Ga0373925_0030220 3300037068 Bacteria 3976
585 Ga0373925_0938501 3300037068 Unclassified 713
586 Ga0373925_1313777 3300037068 Unclassified 593
587 Ga0373925_1449351 3300037068 Unclassified 562
588 Ga0395905_0045482 3300037471 Bacteria 4117
589 Ga0395905_0184390 3300037471 Bacteria 1959
590 Ga0395905_0260350 3300037471 Unclassified 1620
591 Ga0395901_0197395 3300038443 Bacteria 2110
592 Ga0451804_0485622 3300041463 Bacteria 511
593 Ga0451839_0481867 3300041496 Bacteria 634
594 Ga0451851_0491892 3300041507 Bacteria 606
595 Ga0450912_037526 3300042116 Bacteria 519
596 Ga0451577_0000302 3300042876 Bacteria 95860
597 Ga0451577_0002102 3300042876 Bacteria 24536
598 Ga0451577_0047000 3300042876 Bacteria 3860
599 Ga0453683_0815480 3300044673 Bacteria 615
600 Ga0453684_0000255 3300044712 Bacteria 229708
601 Ga0453684_0014376 3300044712 Bacteria 12675
602 Ga0453684_0295425 3300044712 Bacteria 1843
603 Ga0453684_2419263 3300044712 Unclassified 520
604 Ga0451576_0028073 3300045051 Bacteria 6033
605 Ga0451576_0078450 3300045051 Bacteria 3437
606 Ga0451576_0098411 3300045051 Bacteria 3043
607 Ga0451576_0278083 3300045051 Unclassified 1750
608 Ga0451576_0289356 3300045051 Bacteria 1713
609 Ga0451576_0573757 3300045051 Unclassified 1185
610 Ga0451576_0618468 3300045051 Unclassified 1138
611 Ga0451576_0707622 3300045051 Bacteria 1058
612 Ga0451576_0741022 3300045051 Bacteria 1032
613 Ga0451576_0796110 3300045051 Bacteria 993
614 Ga0451576_0813245 3300045051 Unclassified 981
615 Ga0451576_0818669 3300045051 Bacteria 978
616 Ga0451576_0887473 3300045051 Unclassified 936
617 Ga0451576_0982660 3300045051 Bacteria 885
618 Ga0451576_1077264 3300045051 Unclassified 841
619 Ga0451576_1150472 3300045051 Bacteria 811
620 Ga0451576_1171125 3300045051 Bacteria 803
621 Ga0451576_1224609 3300045051 Unclassified 784
622 Ga0451576_1687171 3300045051 Archaea 656
623 Ga0451576_2237689 3300045051 Unclassified 561
624 Ga0451576_2541012 3300045051 Bacteria 523
625 Ga0466958_1145143 3300045836 Bacteria 508
626 Ga0495592_0104304 3300046454 Bacteria 2016
627 Ga0495592_0142410 3300046454 Bacteria 1666
628 Ga0495592_0347930 3300046454 Bacteria 951
629 Ga0495629_0374433 3300046459 Bacteria 969
630 Ga0495641_0013934 3300046461 Bacteria 4379
631 Ga0495651_0249801 3300046462 Unclassified 1212
632 Ga0495651_0304323 3300046462 Bacteria 1068
633 Ga0495653_0350351 3300046463 Unclassified 950
634 Ga0495653_0857388 3300046463 Unclassified 543
635 Ga0495580_0289484 3300046472 Bacteria 1117
636 Ga0495582_0127734 3300046473 Bacteria 1435
637 Ga0495582_0178275 3300046473 Bacteria 1210
638 Ga0495639_0236036 3300046475 Bacteria 902
639 Ga0495639_0247886 3300046475 Bacteria 880
640 Ga0495662_0057157 3300046476 Unclassified 1884
641 Ga0495662_0353147 3300046476 Unclassified 723
642 Ga0495594_0511638 3300046499 Bacteria 682
643 Ga0495608_0562719 3300046511 Bacteria 686
644 Ga0495618_0012160 3300046514 Bacteria 5225
645 Ga0495618_0409083 3300046514 Unclassified 829
646 Ga0495628_0216330 3300046516 Bacteria 1440
647 Ga0495628_0511221 3300046516 Unclassified 866
648 Ga0495628_0577689 3300046516 Bacteria 805
649 Ga0495628_1114512 3300046516 Unclassified 538
650 Ga0495630_0000171 3300046517 Bacteria 50810
651 Ga0495630_0008736 3300046517 Bacteria 7279
652 Ga0495630_0021595 3300046517 Bacteria 4753
653 Ga0495630_0136328 3300046517 Bacteria 1865
654 Ga0495630_0159722 3300046517 Bacteria 1716
655 Ga0495630_0164956 3300046517 Bacteria 1687
656 Ga0495630_0224930 3300046517 Bacteria 1433
657 Ga0495630_0269163 3300046517 Bacteria 1302
658 Ga0495630_0348341 3300046517 Bacteria 1134
659 Ga0495666_0063757 3300046526 Unclassified 1759
660 Ga0495666_0113782 3300046526 Bacteria 1270
661 Ga0495666_0235280 3300046526 Bacteria 837
662 Ga0495666_0352922 3300046526 Unclassified 662
663 Ga0495652_0211409 3300046529 Bacteria 1464
664 Ga0495665_0060321 3300046531 Unclassified 2003
665 Ga0495665_0647992 3300046531 Bacteria 526
666 Ga0495640_0024065 3300046533 Bacteria 4431
667 Ga0495640_0024615 3300046533 Unclassified 4378
668 Ga0495640_0116537 3300046533 Unclassified 1740
669 Ga0495640_0720718 3300046533 Bacteria 597
670 Ga0495586_0000676 3300046535 Bacteria 19447
671 Ga0495586_0002025 3300046535 Bacteria 11010
672 Ga0495586_0017220 3300046535 Bacteria 3840
673 Ga0495586_0408683 3300046535 Bacteria 781
674 Ga0495586_0515198 3300046535 Bacteria 690
675 Ga0495586_0589816 3300046535 Bacteria 642
676 Ga0495587_0143157 3300046536 Unclassified 1364
677 Ga0495587_0241645 3300046536 Bacteria 1016
678 Ga0495645_0104520 3300046543 Bacteria 2011
679 Ga0495645_0141154 3300046543 Bacteria 1680
680 Ga0495645_0177021 3300046543 Unclassified 1464
681 Ga0495645_0272826 3300046543 Unclassified 1116
682 Ga0495645_0476296 3300046543 Unclassified 784
683 Ga0495645_0952291 3300046543 Bacteria 507
684 Ga0495622_0018207 3300046557 Bacteria 3271
685 Ga0495667_0028304 3300046559 Bacteria 3773
686 Ga0495667_0079216 3300046559 Bacteria 2136
687 Ga0495667_0088801 3300046559 Bacteria 2004
688 Ga0495667_0520563 3300046559 Unclassified 744
689 Ga0495656_0687249 3300046615 Bacteria 550
690 Ga0495634_0001834 3300046642 Bacteria 18343
691 Ga0495634_0013425 3300046642 Bacteria 5918
692 Ga0495634_0029829 3300046642 Unclassified 3773
693 Ga0495634_0144530 3300046642 Unclassified 1508
694 Ga0495635_0537201 3300046663 Unclassified 767
695 Ga0495659_0498297 3300046664 Bacteria 534
696 Ga0495588_0419959 3300046674 Unclassified 702
697 Ga0495657_0397304 3300046675 Unclassified 812
698 Ga0495599_0076338 3300046678 Bacteria 2092
699 Ga0495599_0558560 3300046678 Bacteria 670
700 Ga0495599_0881717 3300046678 Bacteria 508
701 Ga0495646_0083348 3300046680 Bacteria 1859
702 Ga0495646_0127542 3300046680 Bacteria 1435
703 Ga0495647_0026574 3300046681 Bacteria 2122
704 Ga0495647_0329743 3300046681 Bacteria 692
705 Ga0495658_0004832 3300046683 Bacteria 6611
706 Ga0495658_0111329 3300046683 Bacteria 1646
707 Ga0495658_0646287 3300046683 Unclassified 677
708 Ga0495658_0779168 3300046683 Bacteria 612
709 Ga0495658_1070374 3300046683 Unclassified 514
710 Ga0495669_0510759 3300046684 Unclassified 584
711 Ga0495613_0001229 3300046689 Bacteria 19576
712 Ga0495613_0022793 3300046689 Bacteria 4666
713 Ga0495613_0075353 3300046689 Unclassified 2456
714 Ga0495613_0413463 3300046689 Unclassified 919
715 Ga0495613_0825739 3300046689 Bacteria 604
716 Ga0495624_0076883 3300046690 Bacteria 2071
717 Ga0495624_0915279 3300046690 Unclassified 516
718 Ga0495600_0196028 3300046809 Bacteria 1298
719 Ga0495581_0134909 3300047315 Bacteria 1439
720 Ga0495581_0206184 3300047315 Bacteria 1150
721 Ga0495581_0277114 3300047315 Bacteria 980
722 Ga0495581_0279667 3300047315 Bacteria 976
723 Ga0495581_0897648 3300047315 Bacteria 506
724 Ga0495604_0414836 3300047317 Bacteria 885
725 Ga0495604_0494594 3300047317 Unclassified 794
726 Ga0495604_0727532 3300047317 Bacteria 629
727 Ga0495604_0755529 3300047317 Bacteria 615
728 Ga0495674_0000893 3300047319 Bacteria 28550
729 Ga0495674_0380454 3300047319 Unclassified 1142
730 Ga0495674_1132499 3300047319 Unclassified 594
731 Ga0495676_0098712 3300047321 Bacteria 2166
732 Ga0495676_0199887 3300047321 Bacteria 1389
733 Ga0495680_0005511 3300047322 Bacteria 11887
734 Ga0495680_0288908 3300047322 Unclassified 1154
735 Ga0495680_0592973 3300047322 Unclassified 742
736 Ga0495683_0197224 3300047323 Bacteria 910
737 Ga0495675_0016595 3300047444 Bacteria 4659
738 Ga0495675_0291933 3300047444 Bacteria 970
739 Ga0495675_0570108 3300047444 Unclassified 644
740 Ga0495675_0765763 3300047444 Unclassified 536
741 Ga0495684_0224674 3300047471 Bacteria 1375
742 Ga0495684_0264697 3300047471 Bacteria 1246
743 Ga0495684_0512520 3300047471 Unclassified 823
744 Ga0495602_0760648 3300048088 Bacteria 653
745 Ga0495614_0094310 3300048089 Bacteria 1304
746 Ga0496101_0417748 3300048904 Bacteria 1057
747 Ga0496102_1503299 3300048905 Bacteria 592
748 Ga0496107_0079500 3300048910 Bacteria 2390
749 Ga0496111_0264976 3300048914 Bacteria 1275
750 Ga0496115_0008782 3300048918 Bacteria 7491
751 Ga0501310_048925 3300049130 Bacteria 607
752 Ga0501312_039381 3300049528 Unclassified 768
753 Ga0501323_044494 3300049539 Unclassified 659
754 Ga0501031_0000004 3300049568 Bacteria 202781
755 Ga0501032_0003532 3300049569 Bacteria 11929
756 Ga0501033_0000212 3300049570 Bacteria 55695
757 Ga0501033_0059670 3300049570 Bacteria 2817
758 Ga0501033_0415284 3300049570 Bacteria 937
759 Ga0501034_0273207 3300049571 Bacteria 1631
760 Ga0501034_0328613 3300049571 Bacteria 1461
761 Ga0501034_0615071 3300049571 Bacteria 991
762 Ga0501036_0207560 3300049572 Bacteria 1647
763 Ga0501036_0216650 3300049572 Bacteria 1608
764 Ga0501036_0225793 3300049572 Bacteria 1572
765 Ga0501037_1067374 3300049573 Bacteria 524
766 Ga0501038_0294757 3300049574 Bacteria 1274
767 Ga0501039_0190015 3300049575 Bacteria 1615
768 Ga0501039_0733260 3300049575 Bacteria 772
769 Ga0501043_0108786 3300049579 Bacteria 2177
770 Ga0501043_0849653 3300049579 Bacteria 657
771 Ga0501046_0190002 3300049580 Bacteria 1532
772 Ga0501046_0690433 3300049580 Bacteria 720
773 Ga0501047_0673740 3300049581 Bacteria 853
774 Ga0501047_0822310 3300049581 Bacteria 743
775 Ga0501047_1047185 3300049581 Unclassified 629
776 Ga0501239_028619 3300049672 Bacteria 721
777 Ga0501080_0495742 3300049742 Bacteria 1092
778 Ga0501080_1346085 3300049742 Bacteria 610
779 Ga0501083_0559525 3300049744 Unclassified 744
780 Ga0501035_0002904 3300049822 Bacteria 16500
781 Ga0501035_0032128 3300049822 Unclassified 4777
782 Ga0501035_0987901 3300049822 Bacteria 662
783 Ga0501044_0000024 3300049823 Bacteria 194302
784 Ga0501044_0030760 3300049823 Bacteria 5655
785 Ga0501044_0811392 3300049823 Bacteria 814
786 nmdc:mga05p37_408903_c1 3300050507 Bacteria 1582
787 nmdc:mga05p37_864718_c1 3300050507 Bacteria 980
788 nmdc:mga09592_1090926_c1 3300050508 Unclassified 664
789 nmdc:mga09592_861884_c1 3300050508 Bacteria 763
790 nmdc:mga0qj67_1232995_c1 3300050509 Unclassified 581
791 nmdc:mga06r32_126147_c1 3300050510 Bacteria 2528
792 nmdc:mga06r32_413116_c1 3300050510 Unclassified 1331
793 nmdc:mga08y16_471682_c1 3300050511 Unclassified 1278
794 nmdc:mga08y16_48884_c1 3300050511 Unclassified 4426
795 nmdc:mga08y16_5086_c1 3300050511 Bacteria 13746
796 nmdc:mga08y16_510012_c1 3300050511 Bacteria 1221
797 nmdc:mga08y16_98604_c1 3300050511 Bacteria 3043
798 nmdc:mga0n895_1480916_c1 3300050512 Bacteria 645
799 nmdc:mga0n895_1541018_c1 3300050512 Unclassified 630
800 nmdc:mga0n895_2114719_c1 3300050512 Bacteria 519
801 nmdc:mga0n895_865149_c1 3300050512 Bacteria 891
802 nmdc:mga0rr50_1626617_c1 3300050513 Unclassified 545
803 nmdc:mga0rr50_1678816_c1 3300050513 Unclassified 535
804 nmdc:mga0rr50_542674_c1 3300050513 Unclassified 990
805 nmdc:mga08x19_479653_c1 3300050514 Unclassified 877
806 nmdc:mga0a205_636554_c1 3300050515 Unclassified 918
807 nmdc:mga0a205_997176_c1 3300050515 Bacteria 684
808 Ga0495601_0156116 3300053077 Unclassified 1490
809 Ga0500636_0019369 3300053177 Bacteria 4028
810 Ga0587066_050738 3300059490 Bacteria 816
811 Ga0587092_058943 3300059512 Bacteria 714
812 Ga0587109_113762 3300059624 Bacteria 635
813 Ga0587075_062277 3300059644 Bacteria 675
814 Ga0587079_252238 3300059647 Bacteria 503
815 Ga0466962_0220335 3300061719 Bacteria 929
816 Ga0075428_101593708
817 JGI26145J50221_1009864
818 Ga0065707_10238720
819 Ga0070658_10116558
820 Ga0070658_10607157
821 Ga0070658_11409434
822 Ga0070683_100807062
823 Ga0070683_101007885
824 Ga0070683_102267492
825 Ga0070690_100586380
826 Ga0068869_100548325
827 Ga0068869_100596781
828 Ga0070680_100333819
829 Ga0070680_100666808
830 Ga0068868_100564397
831 Ga0068868_101039436
832 Ga0068868_102069211
833 Ga0070660_100052070
834 Ga0070689_100002628
835 Ga0070689_100059599
836 Ga0070689_100272150
837 Ga0070689_100426252
838 Ga0070689_100680191
839 Ga0070689_101365142
840 Ga0070689_101624635
841 Ga0070691_10405975
842 Ga0070691_10897848
843 Ga0070687_100158841
844 Ga0070687_100463855
845 Ga0070661_100357840
846 Ga0070661_100459602
847 Ga0070692_10415497
848 Ga0070668_100150488
849 Ga0070669_100376261
850 Ga0070675_100064748
851 Ga0070671_100378459
852 Ga0070674_100179140
853 Ga0070688_100036939
854 Ga0070659_100174500
855 Ga0070659_100453115
856 Ga0070659_100932418
857 Ga0070667_100266794
858 Ga0070667_101847728
859 Ga0070703_10484150
860 Ga0070714_100013741
861 Ga0070714_100394148
862 Ga0070714_102350836
863 Ga0070713_100017222
864 Ga0070713_100423363
865 Ga0070713_100867665
866 Ga0070710_10191423
867 Ga0070701_10052677
868 Ga0070701_10692980
869 Ga0070701_10964352
870 Ga0070711_100033987
871 Ga0070711_100228833
872 Ga0070711_100234795
873 Ga0070700_100060780
874 Ga0070694_100409466
875 Ga0070694_100574506
876 Ga0070694_100975180
877 Ga0070694_101117618
878 Ga0070708_100290653
879 Ga0070662_100125091
880 Ga0070681_10096362
881 Ga0070681_10408656
882 Ga0070681_10725791
883 Ga0070681_10897796
884 Ga0070681_11280522
885 Ga0068867_101111306
886 Ga0068867_101440615
887 Ga0070685_10080142
888 Ga0070685_10577736
889 Ga0070685_11091053
890 Ga0070707_100737491
891 Ga0070679_100111689
892 Ga0070679_100153177
893 Ga0070684_100233653
894 Ga0070684_100753254
895 Ga0070684_101230921
896 Ga0068853_100925426
897 Ga0068853_101241975
898 Ga0070672_100079779
899 Ga0070686_100037438
900 Ga0070686_100055517
901 Ga0070686_100638655
902 Ga0070686_101348648
903 Ga0070686_101631663
904 Ga0070686_101922060
905 Ga0070695_100719485
906 Ga0070696_100002260
907 Ga0070696_101188673
908 Ga0070696_101864530
909 Ga0070693_100117278
910 Ga0070693_101277602
911 Ga0070704_100018152
912 Ga0070704_100961706
913 Ga0068855_100121181
914 Ga0068855_100179188
915 Ga0068855_100576436
916 Ga0070664_100487782
917 Ga0068857_100192877
918 Ga0068857_100795923
919 Ga0068857_100798430
920 Ga0068857_102047102
921 Ga0068854_100968037
922 Ga0068856_100000333
923 Ga0068856_100023624
924 Ga0068856_100854797
925 Ga0068856_101375518
926 Ga0068856_102608359
927 Ga0070702_100300392
928 Ga0070702_100437744
929 Ga0070702_101412786
930 Ga0070702_101757066
931 Ga0068852_100931109
932 Ga0068852_101095378
933 Ga0068859_100004959
934 Ga0068859_100139020
935 Ga0068859_100927605
936 Ga0068859_101658710
937 Ga0068859_102446850
938 Ga0068864_100063696
939 Ga0068864_100701211
940 Ga0068864_100889844
941 Ga0068864_101921568
942 Ga0068864_102661788
943 Ga0068861_100759043
944 Ga0068861_101383095
945 Ga0068861_102188067
946 Ga0068861_102202981
947 Ga0068851_10397127
948 Ga0068851_10720974
949 Ga0068863_100008630
950 Ga0068863_100084221
951 Ga0068863_100292416
952 Ga0068863_100417521
953 Ga0068863_101616786
954 Ga0068863_101617628
955 Ga0068858_100479568
956 Ga0068858_100724832
957 Ga0068860_100962671
958 Ga0081455_10063110
959 Ga0070716_100127312
960 Ga0070712_100232344
961 Ga0070712_100440067
962 Ga0070712_100502228
963 Ga0070712_101303974
964 Ga0097621_100801967
965 Ga0097621_101831803
966 Ga0068871_100475699
967 Ga0068871_101057368
968 Ga0068871_101323069
969 Ga0068871_102257318
970 Ga0075428_100006818
971 Ga0075428_100086404
972 Ga0075428_100861661
973 Ga0075428_100944744
974 Ga0075430_100772963
975 Ga0075431_100234992
976 Ga0075431_100566964
977 Ga0075433_11001944
978 Ga0075434_100896515
979 Ga0075434_100965968
980 Ga0075434_101426855
981 Ga0075434_101738840
982 Ga0068865_100585338
983 Ga0075436_100447533
984 Ga0075436_100502456
985 Ga0075436_100747422
986 Ga0075436_101523610
987 Ga0097620_100004959
988 Ga0097620_100139020
989 Ga0097620_100927579
990 Ga0097620_101658190
991 Ga0097620_102447691
992 Ga0075435_100078589
993 Ga0075435_100524012
994 Ga0075435_101146329
995 Ga0099794_10188183
996 Ga0099794_10439374
997 Ga0099795_10118406
998 Ga0105240_10000711
999 Ga0105240_10041167
1000 Ga0105240_10093999
1001 Ga0105240_10146774
1002 Ga0105240_10211357
1003 Ga0105240_10316106
1004 Ga0105240_10907929
1005 Ga0105240_12365030
1006 Ga0111539_10143389
1007 Ga0111539_10147752
1008 Ga0111539_10199190
1009 Ga0111539_10247244
1010 Ga0111539_10293584
1011 Ga0111539_10415521
1012 Ga0111539_10434634
1013 Ga0111539_11187519
1014 Ga0111539_11931963
1015 Ga0105245_10843129
1016 Ga0105245_12618231
1017 Ga0105245_13272360
1018 Ga0114129_10308395
1019 Ga0114129_11150348
1020 Ga0105243_11284138
1021 Ga0105243_12224788
1022 Ga0105241_10264853
1023 Ga0105242_10049696
1024 Ga0105242_10096426
1025 Ga0105242_11706116
1026 Ga0105248_10002679
1027 Ga0105248_10287924
1028 Ga0105248_10696089
1029 Ga0105248_10834565
1030 Ga0105248_10989966
1031 Ga0105248_11154305
1032 Ga0105248_13050859
1033 Ga0105237_10377154
1034 Ga0105237_11522772
1035 Ga0105238_10009790
1036 Ga0105238_10029677
1037 Ga0105238_10078731
1038 Ga0105238_10219669
1039 Ga0105238_10489331
1040 Ga0105238_10820404
1041 Ga0105238_12366700
1042 Ga0105249_10600692
1043 Ga0105249_12308474
1044 Ga0105239_10151904
1045 Ga0105239_12197316
1046 Ga0105246_11171745
1047 Ga0157373_10255114
1048 Ga0157373_10332625
1049 Ga0157370_10067916
1050 Ga0157370_10274932
1051 Ga0157370_10309732
1052 Ga0157370_10689703
1053 Ga0157369_10732018
1054 Ga0157369_11372755
1055 Ga0157369_11894006
1056 Ga0157374_10131416
1057 Ga0157374_11144739
1058 Ga0157374_11271070
1059 Ga0157378_10316020
1060 Ga0157378_10665928
1061 Ga0157378_10729749
1062 Ga0157378_10862590
1063 Ga0157378_12477267
1064 Ga0157378_12676642
1065 Ga0163162_10296440
1066 Ga0163162_11789026
1067 Ga0157372_10012520
1068 Ga0157372_10039202
1069 Ga0157372_10292207
1070 Ga0157372_10786642
1071 Ga0157372_11114440
1072 Ga0157375_10000036
1073 Ga0157375_10624566
1074 Ga0157375_11308405
1075 Ga0163163_10000067
1076 Ga0163163_10040992
1077 Ga0163163_10300912
1078 Ga0163163_11559779
1079 Ga0157380_10801447
1080 Ga0157380_11040558
1081 Ga0157380_11557827
1082 Ga0157379_10086226
1083 Ga0157379_10123194
1084 Ga0157376_10296121
1085 Ga0157376_12784382
1086 Ga0163161_11787587
1087 Ga0206356_11283718
1088 Ga0206353_10613002
1089 Ga0207656_10502415
1090 Ga0207692_10030925
1091 Ga0207688_10203079
1092 Ga0207699_10012821
1093 Ga0207645_10680784
1094 Ga0207705_10560376
1095 Ga0207684_10838610
1096 Ga0207654_10370300
1097 Ga0207707_10163771
1098 Ga0207695_10001486
1099 Ga0207695_10039795
1100 Ga0207695_10115378
1101 Ga0207695_10191605
1102 Ga0207695_10229821
1103 Ga0207695_10265970
1104 Ga0207695_11265214
1105 Ga0207671_10325858
1106 Ga0207671_11391612
1107 Ga0207693_10153434
1108 Ga0207693_10916670
1109 Ga0207663_10014922
1110 Ga0207663_10090826
1111 Ga0207663_11289515
1112 Ga0207660_10431121
1113 Ga0207660_10841745
1114 Ga0207662_10103009
1115 Ga0207662_10361414
1116 Ga0207662_10854118
1117 Ga0207657_10050715
1118 Ga0207649_10276577
1119 Ga0207649_10599038
1120 Ga0207652_10032134
1121 Ga0207652_10187267
1122 Ga0207652_11282099
1123 Ga0207646_10171037
1124 Ga0207646_10983970
1125 Ga0207646_11172765
1126 Ga0207694_10020783
1127 Ga0207694_10025236
1128 Ga0207694_10215584
1129 Ga0207694_10421574
1130 Ga0207694_10792113
1131 Ga0207659_10603627
1132 Ga0207687_10367058
1133 Ga0207687_11593944
1134 Ga0207700_10019165
1135 Ga0207700_10528860
1136 Ga0207700_11405544
1137 Ga0207664_10002691
1138 Ga0207664_10006289
1139 Ga0207644_10315241
1140 Ga0207690_10065204
1141 Ga0207690_10273171
1142 Ga0207706_10050263
1143 Ga0207686_10053853
1144 Ga0207686_10156519
1145 Ga0207686_10793290
1146 Ga0207670_10010394
1147 Ga0207670_10038951
1148 Ga0207670_10081443
1149 Ga0207670_10150737
1150 Ga0207670_10441721
1151 Ga0207670_10491130
1152 Ga0207669_10614490
1153 Ga0207669_10994970
1154 Ga0207665_10305913
1155 Ga0207665_11025648
1156 Ga0207665_11503111
1157 Ga0207691_10486771
1158 Ga0207691_11377780
1159 Ga0207711_10011291
1160 Ga0207689_10738908
1161 Ga0207689_11218347
1162 Ga0207661_10304455
1163 Ga0207661_10606791
1164 Ga0207679_11651340
1165 Ga0207667_10023109
1166 Ga0207667_10203627
1167 Ga0207667_10245694
1168 Ga0207667_10349173
1169 Ga0207667_10988737
1170 Ga0207651_11938690
1171 Ga0207712_12113299
1172 Ga0207668_11306736
1173 Ga0207658_11076035
1174 Ga0207658_11473376
1175 Ga0207677_10270475
1176 Ga0207677_12024613
1177 Ga0207703_11444908
1178 Ga0207639_12076209
1179 Ga0207678_11201319
1180 Ga0207678_11768408
1181 Ga0207708_10274832
1182 Ga0207708_10795981
1183 Ga0207702_10000259
1184 Ga0207702_10042210
1185 Ga0207702_10130463
1186 Ga0207702_10788911
1187 Ga0207702_10991150
1188 Ga0207702_11268878
1189 Ga0207702_12232551
1190 Ga0207702_12493069
1191 Ga0207641_10482099
1192 Ga0207641_11025422
1193 Ga0207641_11935646
1194 Ga0207641_12053081
1195 Ga0207648_10253690
1196 Ga0207648_10405020
1197 Ga0207648_10408174
1198 Ga0207648_11808391
1199 Ga0207676_10138522
1200 Ga0207676_11174478
1201 Ga0207674_10648540
1202 Ga0207674_10749364
1203 Ga0207674_11269318
1204 Ga0207674_11280648
1205 Ga0207675_100190917
1206 Ga0207675_100612160
1207 Ga0207675_101428885
1208 Ga0207698_10292264
1209 Ga0207698_11076212
1210 Ga0209981_1006505
1211 Ga0209984_1033594
1212 Ga0210000_1002922
1213 Ga0209999_1012191
1214 Ga0209982_1010399
1215 Ga0209983_1001526
1216 Ga0209971_1006080
1217 Ga0209974_10002416
1218 Ga0207428_10113363
1219 Ga0207428_10448079
1220 Ga0207428_10747964
1221 Ga0268264_10809127
1222 Ga0268264_11702785
1223 Ga0265337_1000269
1224 Ga0265337_1006463
1225 Ga0265337_1009750
1226 Ga0265337_1014485
1227 Ga0265337_1047643
1228 Ga0265326_10002061
1229 Ga0265326_10026223
1230 Ga0265326_10029103
1231 Ga0265326_10046844
1232 Ga0265319_1000001
1233 Ga0265319_1015923
1234 Ga0265319_1085928
1235 Ga0265334_10017859
1236 Ga0265334_10031370
1237 Ga0265334_10191869
1238 Ga0265318_10122269
1239 Ga0265318_10140535
1240 Ga0265318_10147194
1241 Ga0265323_10001379
1242 Ga0265323_10016104
1243 Ga0265322_10015098
1244 Ga0265322_10042408
1245 Ga0265322_10254084
1246 Ga0265336_10000586
1247 Ga0265336_10037892
1248 Ga0265336_10075819
1249 Ga0265336_10101511
1250 Ga0265336_10162811
1251 Ga0265336_10210789
1252 Ga0265338_10000030
1253 Ga0265338_10000032
1254 Ga0265338_10000041
1255 Ga0265338_10001233
1256 Ga0265338_10002413
1257 Ga0265338_10002424
1258 Ga0265338_10005324
1259 Ga0265338_10007470
1260 Ga0265338_10010884
1261 Ga0265338_10011620
1262 Ga0265338_10012697
1263 Ga0265338_10026423
1264 Ga0265338_10035706
1265 Ga0265338_10039538
1266 Ga0265338_10061058
1267 Ga0265338_10096938
1268 Ga0265338_10097818
1269 Ga0265338_10116705
1270 Ga0265338_10167914
1271 Ga0265338_10175173
1272 Ga0265338_10183037
1273 Ga0265338_10584372
1274 Ga0265338_10648725
1275 Ga0265338_10850002
1276 Ga0265338_11142333
1277 Ga0265324_10012004
1278 Ga0265324_10022204
1279 Ga0265324_10026322
1280 Ga0265324_10033066
1281 Ga0265324_10033947
1282 Ga0265324_10043437
1283 Ga0265324_10068622
1284 Ga0265324_10087808
1285 Ga0265324_10113975
1286 Ga0265324_10268554
1287 Ga0265760_10209941
1288 Ga0265332_10045477
1289 Ga0265332_10184899
1290 Ga0265328_10016270
1291 Ga0265320_10000939
1292 Ga0265320_10007536
1293 Ga0265320_10027370
1294 Ga0265320_10037960
1295 Ga0265320_10169710
1296 Ga0265320_10281760
1297 Ga0265320_10290504
1298 Ga0265320_10546532
1299 Ga0265325_10041915
1300 Ga0265325_10089147
1301 Ga0265329_10002621
1302 Ga0265329_10056518
1303 Ga0265340_10000417
1304 Ga0265340_10015340
1305 Ga0265340_10341831
1306 Ga0265340_10434803
1307 Ga0265339_10118633
1308 Ga0265339_10496491
1309 Ga0265339_10538592
1310 Ga0265331_10088866
1311 Ga0265331_10422242
1312 Ga0265331_10427167
1313 Ga0265327_10000379
1314 Ga0265327_10003825
1315 Ga0265327_10055436
1316 Ga0265327_10276771
1317 Ga0265316_10002569
1318 Ga0265316_10009532
1319 Ga0265316_10179213
1320 Ga0265316_10205380
1321 Ga0265316_10292055
1322 Ga0265316_10339335
1323 Ga0265316_10362513
1324 Ga0265316_10881245
1325 Ga0265316_10912864
1326 Ga0265316_11080034
1327 Ga0307513_10768336
1328 Ga0265313_10000837
1329 Ga0316575_10141479
1330 Ga0265314_10000070
1331 Ga0265314_10075416
1332 Ga0265314_10272126
1333 Ga0265342_10113918
1334 Ga0265342_10226607
1335 Ga0265342_10370617
1336 Ga0265342_10595381
1337 Ga0265342_10641493
1338 Ga0316576_10024532
1339 Ga0316578_10216970
1340 Ga0316578_10599944
1341 Ga0307406_11319145
1342 Ga0316583_10059453
1343 Ga0307510_10255979
1344 Ga0316596_1146570
1345 Ga0373950_0160536
1346 Ga0373959_0133970
1347 Ga0373926_0044445
1348 Ga0373926_0144594
1349 Ga0373928_0001832
1350 Ga0373929_0002598
1351 Ga0373944_0000243
1352 Ga0373944_0004703
1353 Ga0373944_0156133
1354 Ga0373949_0008104
1355 Ga0373951_0006156
1356 Ga0373952_0176663
1357 Ga0373923_0129710
1358 Ga0373923_0263914
1359 Ga0373932_0000003
1360 Ga0373945_0030507
1361 Ga0373954_0019308
1362 Ga0373954_0033939
1363 Ga0373954_0313055
1364 Ga0373956_0052640
1365 Ga0373956_0058343
1366 Ga0373957_0100716
1367 Ga0373943_0040802
1368 Ga0373943_0156505
1369 Ga0373946_0087031
1370 Ga0373946_0478896
1371 Ga0373955_0491452
1372 Ga0373962_0000059
1373 Ga0373931_0000054
1374 Ga0373931_0214402
1375 Ga0373931_0809671
1376 Ga0373935_0049025
1377 Ga0373935_0283923
1378 Ga0373935_0381767
1379 Ga0373927_0003514
1380 Ga0373927_0065858
1381 Ga0373927_0148529
1382 Ga0373927_0408599
1383 Ga0373927_0817518
1384 Ga0373933_0079446
1385 Ga0373933_0494709
1386 Ga0373933_0798320
1387 Ga0373947_0011605
1388 Ga0373947_0098809
1389 Ga0373937_0003348
1390 Ga0373937_0123186
1391 Ga0373937_0441780
1392 Ga0373937_0447919
1393 Ga0373937_0515944
1394 Ga0373937_1005377
1395 Ga0373937_1589040
1396 Ga0316582_0822322
1397 Ga0373925_0000299
1398 Ga0373925_0005364
1399 Ga0373925_0030220
1400 Ga0373925_0938501
1401 Ga0373925_1313777
1402 Ga0373925_1449351
1403 Ga0395905_0045482
1404 Ga0395905_0184390
1405 Ga0395905_0260350
1406 Ga0395901_0197395
1407 Ga0451804_0485622
1408 Ga0451839_0481867
1409 Ga0451851_0491892
1410 Ga0450912_037526
1411 Ga0451577_0000302
1412 Ga0451577_0002102
1413 Ga0451577_0047000
1414 Ga0453683_0815480
1415 Ga0453684_0000255
1416 Ga0453684_0014376
1417 Ga0453684_0295425
1418 Ga0453684_2419263
1419 Ga0451576_0028073
1420 Ga0451576_0078450
1421 Ga0451576_0098411
1422 Ga0451576_0278083
1423 Ga0451576_0289356
1424 Ga0451576_0573757
1425 Ga0451576_0618468
1426 Ga0451576_0707622
1427 Ga0451576_0741022
1428 Ga0451576_0796110
1429 Ga0451576_0813245
1430 Ga0451576_0818669
1431 Ga0451576_0887473
1432 Ga0451576_0982660
1433 Ga0451576_1077264
1434 Ga0451576_1150472
1435 Ga0451576_1171125
1436 Ga0451576_1224609
1437 Ga0451576_1687171
1438 Ga0451576_2237689
1439 Ga0451576_2541012
1440 Ga0466958_1145143
1441 Ga0495592_0104304
1442 Ga0495592_0142410
1443 Ga0495592_0347930
1444 Ga0495629_0374433
1445 Ga0495641_0013934
1446 Ga0495651_0249801
1447 Ga0495651_0304323
1448 Ga0495653_0350351
1449 Ga0495653_0857388
1450 Ga0495580_0289484
1451 Ga0495582_0127734
1452 Ga0495582_0178275
1453 Ga0495639_0236036
1454 Ga0495639_0247886
1455 Ga0495662_0057157
1456 Ga0495662_0353147
1457 Ga0495594_0511638
1458 Ga0495608_0562719
1459 Ga0495618_0012160
1460 Ga0495618_0409083
1461 Ga0495628_0216330
1462 Ga0495628_0511221
1463 Ga0495628_0577689
1464 Ga0495628_1114512
1465 Ga0495630_0000171
1466 Ga0495630_0008736
1467 Ga0495630_0021595
1468 Ga0495630_0136328
1469 Ga0495630_0159722
1470 Ga0495630_0164956
1471 Ga0495630_0224930
1472 Ga0495630_0269163
1473 Ga0495630_0348341
1474 Ga0495666_0063757
1475 Ga0495666_0113782
1476 Ga0495666_0235280
1477 Ga0495666_0352922
1478 Ga0495652_0211409
1479 Ga0495665_0060321
1480 Ga0495665_0647992
1481 Ga0495640_0024065
1482 Ga0495640_0024615
1483 Ga0495640_0116537
1484 Ga0495640_0720718
1485 Ga0495586_0000676
1486 Ga0495586_0002025
1487 Ga0495586_0017220
1488 Ga0495586_0408683
1489 Ga0495586_0515198
1490 Ga0495586_0589816
1491 Ga0495587_0143157
1492 Ga0495587_0241645
1493 Ga0495645_0104520
1494 Ga0495645_0141154
1495 Ga0495645_0177021
1496 Ga0495645_0272826
1497 Ga0495645_0476296
1498 Ga0495645_0952291
1499 Ga0495622_0018207
1500 Ga0495667_0028304
1501 Ga0495667_0079216
1502 Ga0495667_0088801
1503 Ga0495667_0520563
1504 Ga0495656_0687249
1505 Ga0495634_0001834
1506 Ga0495634_0013425
1507 Ga0495634_0029829
1508 Ga0495634_0144530
1509 Ga0495635_0537201
1510 Ga0495659_0498297
1511 Ga0495588_0419959
1512 Ga0495657_0397304
1513 Ga0495599_0076338
1514 Ga0495599_0558560
1515 Ga0495599_0881717
1516 Ga0495646_0083348
1517 Ga0495646_0127542
1518 Ga0495647_0026574
1519 Ga0495647_0329743
1520 Ga0495658_0004832
1521 Ga0495658_0111329
1522 Ga0495658_0646287
1523 Ga0495658_0779168
1524 Ga0495658_1070374
1525 Ga0495669_0510759
1526 Ga0495613_0001229
1527 Ga0495613_0022793
1528 Ga0495613_0075353
1529 Ga0495613_0413463
1530 Ga0495613_0825739
1531 Ga0495624_0076883
1532 Ga0495624_0915279
1533 Ga0495600_0196028
1534 Ga0495581_0134909
1535 Ga0495581_0206184
1536 Ga0495581_0277114
1537 Ga0495581_0279667
1538 Ga0495581_0897648
1539 Ga0495604_0414836
1540 Ga0495604_0494594
1541 Ga0495604_0727532
1542 Ga0495604_0755529
1543 Ga0495674_0000893
1544 Ga0495674_0380454
1545 Ga0495674_1132499
1546 Ga0495676_0098712
1547 Ga0495676_0199887
1548 Ga0495680_0005511
1549 Ga0495680_0288908
1550 Ga0495680_0592973
1551 Ga0495683_0197224
1552 Ga0495675_0016595
1553 Ga0495675_0291933
1554 Ga0495675_0570108
1555 Ga0495675_0765763
1556 Ga0495684_0224674
1557 Ga0495684_0264697
1558 Ga0495684_0512520
1559 Ga0495602_0760648
1560 Ga0495614_0094310
1561 Ga0496101_0417748
1562 Ga0496102_1503299
1563 Ga0496107_0079500
1564 Ga0496111_0264976
1565 Ga0496115_0008782
1566 Ga0501310_048925
1567 Ga0501312_039381
1568 Ga0501323_044494
1569 Ga0501031_0000004
1570 Ga0501032_0003532
1571 Ga0501033_0000212
1572 Ga0501033_0059670
1573 Ga0501033_0415284
1574 Ga0501034_0273207
1575 Ga0501034_0328613
1576 Ga0501034_0615071
1577 Ga0501036_0207560
1578 Ga0501036_0216650
1579 Ga0501036_0225793
1580 Ga0501037_1067374
1581 Ga0501038_0294757
1582 Ga0501039_0190015
1583 Ga0501039_0733260
1584 Ga0501043_0108786
1585 Ga0501043_0849653
1586 Ga0501046_0190002
1587 Ga0501046_0690433
1588 Ga0501047_0673740
1589 Ga0501047_0822310
1590 Ga0501047_1047185
1591 Ga0501239_028619
1592 Ga0501080_0495742
1593 Ga0501080_1346085
1594 Ga0501083_0559525
1595 Ga0501035_0002904
1596 Ga0501035_0032128
1597 Ga0501035_0987901
1598 Ga0501044_0000024
1599 Ga0501044_0030760
1600 Ga0501044_0811392
1601 nmdc:mga05p37_408903_c1
1602 nmdc:mga05p37_864718_c1
1603 nmdc:mga09592_1090926_c1
1604 nmdc:mga09592_861884_c1
1605 nmdc:mga0qj67_1232995_c1
1606 nmdc:mga06r32_126147_c1
1607 nmdc:mga06r32_413116_c1
1608 nmdc:mga08y16_471682_c1
1609 nmdc:mga08y16_48884_c1
1610 nmdc:mga08y16_5086_c1
1611 nmdc:mga08y16_510012_c1
1612 nmdc:mga08y16_98604_c1
1613 nmdc:mga0n895_1480916_c1
1614 nmdc:mga0n895_1541018_c1
1615 nmdc:mga0n895_2114719_c1
1616 nmdc:mga0n895_865149_c1
1617 nmdc:mga0rr50_1626617_c1
1618 nmdc:mga0rr50_1678816_c1
1619 nmdc:mga0rr50_542674_c1
1620 nmdc:mga08x19_479653_c1
1621 nmdc:mga0a205_636554_c1
1622 nmdc:mga0a205_997176_c1
1623 Ga0495601_0156116
1624 Ga0500636_0019369
1625 Ga0587066_050738
1626 Ga0587092_058943
1627 Ga0587109_113762
1628 Ga0587075_062277
1629 Ga0587079_252238
1630 Ga0466962_0220335

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

2

103

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8882 61 117
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8736 51 116
2ghj-assembly1.cif.gz_A crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 0.8474 21 117
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8401 51 116
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8361 61 117
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9723 53 118 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9174 53 118 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9122 58 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8882 61 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8361 61 117 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.006 61 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2D8YKH1-F1-model_v4 deleted 1.005 58 117
AF-A0A7Y7CN64-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.003 64 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A659UR08-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.002 56 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A354QTS7-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.001 53 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map