F482012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 815 | 324 | 1630 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_101593708|Ga0075428_1015937081 |
| Length | 122 |
| Sequence | MRVTNAPASRKRRGRMLQAAKGFRLKRSKLYRYASDAVDHGRQYAYRDREFRYLWQIRINAAVRAAGLTYSRFMEGLKAAKVSLDRKVLADVAARDTVAFASIIDVAKNALKAKPAASLAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 230 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 231 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 319 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 1.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 0.74 |
| Rhizosphere | 98.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_101593708 | 3300006844 | Unclassified | 683 |
| 2 | JGI26145J50221_1009864 | 3300003371 | Bacteria | 835 |
| 3 | Ga0065707_10238720 | 3300005295 | Bacteria | 1163 |
| 4 | Ga0070658_10116558 | 3300005327 | Bacteria | 2216 |
| 5 | Ga0070658_10607157 | 3300005327 | Bacteria | 948 |
| 6 | Ga0070658_11409434 | 3300005327 | Bacteria | 605 |
| 7 | Ga0070683_100807062 | 3300005329 | Unclassified | 900 |
| 8 | Ga0070683_101007885 | 3300005329 | Bacteria | 800 |
| 9 | Ga0070683_102267492 | 3300005329 | Unclassified | 521 |
| 10 | Ga0070690_100586380 | 3300005330 | Bacteria | 845 |
| 11 | Ga0068869_100548325 | 3300005334 | Bacteria | 971 |
| 12 | Ga0068869_100596781 | 3300005334 | Bacteria | 932 |
| 13 | Ga0070680_100333819 | 3300005336 | Bacteria | 1288 |
| 14 | Ga0070680_100666808 | 3300005336 | Unclassified | 894 |
| 15 | Ga0068868_100564397 | 3300005338 | Bacteria | 1004 |
| 16 | Ga0068868_101039436 | 3300005338 | Bacteria | 751 |
| 17 | Ga0068868_102069211 | 3300005338 | Bacteria | 541 |
| 18 | Ga0070660_100052070 | 3300005339 | Bacteria | 3154 |
| 19 | Ga0070689_100002628 | 3300005340 | Bacteria | 11765 |
| 20 | Ga0070689_100059599 | 3300005340 | Bacteria | 2967 |
| 21 | Ga0070689_100272150 | 3300005340 | Bacteria | 1402 |
| 22 | Ga0070689_100426252 | 3300005340 | Unclassified | 1125 |
| 23 | Ga0070689_100680191 | 3300005340 | Bacteria | 897 |
| 24 | Ga0070689_101365142 | 3300005340 | Bacteria | 640 |
| 25 | Ga0070689_101624635 | 3300005340 | Unclassified | 587 |
| 26 | Ga0070691_10405975 | 3300005341 | Unclassified | 769 |
| 27 | Ga0070691_10897848 | 3300005341 | Unclassified | 546 |
| 28 | Ga0070687_100158841 | 3300005343 | Bacteria | 1334 |
| 29 | Ga0070687_100463855 | 3300005343 | Unclassified | 845 |
| 30 | Ga0070661_100357840 | 3300005344 | Bacteria | 1146 |
| 31 | Ga0070661_100459602 | 3300005344 | Bacteria | 1014 |
| 32 | Ga0070692_10415497 | 3300005345 | Unclassified | 853 |
| 33 | Ga0070668_100150488 | 3300005347 | Bacteria | 1882 |
| 34 | Ga0070669_100376261 | 3300005353 | Bacteria | 1157 |
| 35 | Ga0070675_100064748 | 3300005354 | Bacteria | 3022 |
| 36 | Ga0070671_100378459 | 3300005355 | Bacteria | 1210 |
| 37 | Ga0070674_100179140 | 3300005356 | Bacteria | 1622 |
| 38 | Ga0070688_100036939 | 3300005365 | Bacteria | 2974 |
| 39 | Ga0070659_100174500 | 3300005366 | Bacteria | 1762 |
| 40 | Ga0070659_100453115 | 3300005366 | Bacteria | 1088 |
| 41 | Ga0070659_100932418 | 3300005366 | Bacteria | 760 |
| 42 | Ga0070667_100266794 | 3300005367 | Bacteria | 1534 |
| 43 | Ga0070667_101847728 | 3300005367 | Bacteria | 569 |
| 44 | Ga0070703_10484150 | 3300005406 | Bacteria | 554 |
| 45 | Ga0070714_100013741 | 3300005435 | Bacteria | 6493 |
| 46 | Ga0070714_100394148 | 3300005435 | Bacteria | 1307 |
| 47 | Ga0070714_102350836 | 3300005435 | Bacteria | 518 |
| 48 | Ga0070713_100017222 | 3300005436 | Bacteria | 5459 |
| 49 | Ga0070713_100423363 | 3300005436 | Unclassified | 1247 |
| 50 | Ga0070713_100867665 | 3300005436 | Unclassified | 867 |
| 51 | Ga0070710_10191423 | 3300005437 | Bacteria | 1287 |
| 52 | Ga0070701_10052677 | 3300005438 | Bacteria | 2115 |
| 53 | Ga0070701_10692980 | 3300005438 | Unclassified | 684 |
| 54 | Ga0070701_10964352 | 3300005438 | Bacteria | 593 |
| 55 | Ga0070711_100033987 | 3300005439 | Bacteria | 3399 |
| 56 | Ga0070711_100228833 | 3300005439 | Unclassified | 1449 |
| 57 | Ga0070711_100234795 | 3300005439 | Bacteria | 1431 |
| 58 | Ga0070700_100060780 | 3300005441 | Unclassified | 2382 |
| 59 | Ga0070694_100409466 | 3300005444 | Bacteria | 1063 |
| 60 | Ga0070694_100574506 | 3300005444 | Bacteria | 905 |
| 61 | Ga0070694_100975180 | 3300005444 | Bacteria | 703 |
| 62 | Ga0070694_101117618 | 3300005444 | Unclassified | 658 |
| 63 | Ga0070708_100290653 | 3300005445 | Bacteria | 1539 |
| 64 | Ga0070662_100125091 | 3300005457 | Bacteria | 1975 |
| 65 | Ga0070681_10096362 | 3300005458 | Bacteria | 2906 |
| 66 | Ga0070681_10408656 | 3300005458 | Bacteria | 1269 |
| 67 | Ga0070681_10725791 | 3300005458 | Bacteria | 910 |
| 68 | Ga0070681_10897796 | 3300005458 | Bacteria | 804 |
| 69 | Ga0070681_11280522 | 3300005458 | Bacteria | 656 |
| 70 | Ga0068867_101111306 | 3300005459 | Unclassified | 722 |
| 71 | Ga0068867_101440615 | 3300005459 | Bacteria | 640 |
| 72 | Ga0070685_10080142 | 3300005466 | Unclassified | 1955 |
| 73 | Ga0070685_10577736 | 3300005466 | Bacteria | 806 |
| 74 | Ga0070685_11091053 | 3300005466 | Bacteria | 603 |
| 75 | Ga0070707_100737491 | 3300005468 | Bacteria | 948 |
| 76 | Ga0070679_100111689 | 3300005530 | Bacteria | 2719 |
| 77 | Ga0070679_100153177 | 3300005530 | Bacteria | 2281 |
| 78 | Ga0070684_100233653 | 3300005535 | Bacteria | 1679 |
| 79 | Ga0070684_100753254 | 3300005535 | Unclassified | 909 |
| 80 | Ga0070684_101230921 | 3300005535 | Bacteria | 704 |
| 81 | Ga0068853_100925426 | 3300005539 | Unclassified | 838 |
| 82 | Ga0068853_101241975 | 3300005539 | Bacteria | 720 |
| 83 | Ga0070672_100079779 | 3300005543 | Bacteria | 2621 |
| 84 | Ga0070686_100037438 | 3300005544 | Bacteria | 3009 |
| 85 | Ga0070686_100055517 | 3300005544 | Bacteria | 2538 |
| 86 | Ga0070686_100638655 | 3300005544 | Bacteria | 843 |
| 87 | Ga0070686_101348648 | 3300005544 | Bacteria | 597 |
| 88 | Ga0070686_101631663 | 3300005544 | Bacteria | 546 |
| 89 | Ga0070686_101922060 | 3300005544 | Unclassified | 505 |
| 90 | Ga0070695_100719485 | 3300005545 | Bacteria | 794 |
| 91 | Ga0070696_100002260 | 3300005546 | Bacteria | 12697 |
| 92 | Ga0070696_101188673 | 3300005546 | Bacteria | 644 |
| 93 | Ga0070696_101864530 | 3300005546 | Unclassified | 520 |
| 94 | Ga0070693_100117278 | 3300005547 | Bacteria | 1646 |
| 95 | Ga0070693_101277602 | 3300005547 | Bacteria | 566 |
| 96 | Ga0070704_100018152 | 3300005549 | Bacteria | 4490 |
| 97 | Ga0070704_100961706 | 3300005549 | Bacteria | 771 |
| 98 | Ga0068855_100121181 | 3300005563 | Bacteria | 2993 |
| 99 | Ga0068855_100179188 | 3300005563 | Bacteria | 2397 |
| 100 | Ga0068855_100576436 | 3300005563 | Bacteria | 1216 |
| 101 | Ga0070664_100487782 | 3300005564 | Bacteria | 1134 |
| 102 | Ga0068857_100192877 | 3300005577 | Bacteria | 1856 |
| 103 | Ga0068857_100795923 | 3300005577 | Bacteria | 903 |
| 104 | Ga0068857_100798430 | 3300005577 | Unclassified | 901 |
| 105 | Ga0068857_102047102 | 3300005577 | Unclassified | 562 |
| 106 | Ga0068854_100968037 | 3300005578 | Bacteria | 752 |
| 107 | Ga0068856_100000333 | 3300005614 | Bacteria | 51689 |
| 108 | Ga0068856_100023624 | 3300005614 | Bacteria | 5978 |
| 109 | Ga0068856_100854797 | 3300005614 | Unclassified | 929 |
| 110 | Ga0068856_101375518 | 3300005614 | Bacteria | 720 |
| 111 | Ga0068856_102608359 | 3300005614 | Unclassified | 511 |
| 112 | Ga0070702_100300392 | 3300005615 | Bacteria | 1110 |
| 113 | Ga0070702_100437744 | 3300005615 | Bacteria | 945 |
| 114 | Ga0070702_101412786 | 3300005615 | Unclassified | 569 |
| 115 | Ga0070702_101757066 | 3300005615 | Unclassified | 517 |
| 116 | Ga0068852_100931109 | 3300005616 | Bacteria | 887 |
| 117 | Ga0068852_101095378 | 3300005616 | Bacteria | 817 |
| 118 | Ga0068859_100004959 | 3300005617 | Bacteria | 13519 |
| 119 | Ga0068859_100139020 | 3300005617 | Bacteria | 2502 |
| 120 | Ga0068859_100927605 | 3300005617 | Bacteria | 955 |
| 121 | Ga0068859_101658710 | 3300005617 | Unclassified | 706 |
| 122 | Ga0068859_102446850 | 3300005617 | Bacteria | 575 |
| 123 | Ga0068864_100063696 | 3300005618 | Unclassified | 3196 |
| 124 | Ga0068864_100701211 | 3300005618 | Bacteria | 989 |
| 125 | Ga0068864_100889844 | 3300005618 | Unclassified | 879 |
| 126 | Ga0068864_101921568 | 3300005618 | Bacteria | 598 |
| 127 | Ga0068864_102661788 | 3300005618 | Unclassified | 506 |
| 128 | Ga0068861_100759043 | 3300005719 | Bacteria | 907 |
| 129 | Ga0068861_101383095 | 3300005719 | Unclassified | 687 |
| 130 | Ga0068861_102188067 | 3300005719 | Unclassified | 554 |
| 131 | Ga0068861_102202981 | 3300005719 | Unclassified | 552 |
| 132 | Ga0068851_10397127 | 3300005834 | Bacteria | 811 |
| 133 | Ga0068851_10720974 | 3300005834 | Unclassified | 615 |
| 134 | Ga0068863_100008630 | 3300005841 | Bacteria | 9957 |
| 135 | Ga0068863_100084221 | 3300005841 | Unclassified | 3014 |
| 136 | Ga0068863_100292416 | 3300005841 | Bacteria | 1579 |
| 137 | Ga0068863_100417521 | 3300005841 | Bacteria | 1314 |
| 138 | Ga0068863_101616786 | 3300005841 | Bacteria | 657 |
| 139 | Ga0068863_101617628 | 3300005841 | Bacteria | 657 |
| 140 | Ga0068858_100479568 | 3300005842 | Unclassified | 1200 |
| 141 | Ga0068858_100724832 | 3300005842 | Unclassified | 968 |
| 142 | Ga0068860_100962671 | 3300005843 | Bacteria | 871 |
| 143 | Ga0081455_10063110 | 3300005937 | Bacteria | 3110 |
| 144 | Ga0070716_100127312 | 3300006173 | Bacteria | 1604 |
| 145 | Ga0070712_100232344 | 3300006175 | Bacteria | 1465 |
| 146 | Ga0070712_100440067 | 3300006175 | Unclassified | 1084 |
| 147 | Ga0070712_100502228 | 3300006175 | Bacteria | 1017 |
| 148 | Ga0070712_101303974 | 3300006175 | Bacteria | 633 |
| 149 | Ga0097621_100801967 | 3300006237 | Bacteria | 872 |
| 150 | Ga0097621_101831803 | 3300006237 | Bacteria | 579 |
| 151 | Ga0068871_100475699 | 3300006358 | Bacteria | 1123 |
| 152 | Ga0068871_101057368 | 3300006358 | Bacteria | 758 |
| 153 | Ga0068871_101323069 | 3300006358 | Bacteria | 678 |
| 154 | Ga0068871_102257318 | 3300006358 | Bacteria | 519 |
| 155 | Ga0075428_100006818 | 3300006844 | Bacteria | 12704 |
| 156 | Ga0075428_100086404 | 3300006844 | Bacteria | 3421 |
| 157 | Ga0075428_100861661 | 3300006844 | Unclassified | 962 |
| 158 | Ga0075428_100944744 | 3300006844 | Bacteria | 914 |
| 159 | Ga0075430_100772963 | 3300006846 | Unclassified | 791 |
| 160 | Ga0075431_100234992 | 3300006847 | Bacteria | 1866 |
| 161 | Ga0075431_100566964 | 3300006847 | Unclassified | 1122 |
| 162 | Ga0075433_11001944 | 3300006852 | Bacteria | 728 |
| 163 | Ga0075434_100896515 | 3300006871 | Bacteria | 902 |
| 164 | Ga0075434_100965968 | 3300006871 | Unclassified | 866 |
| 165 | Ga0075434_101426855 | 3300006871 | Unclassified | 702 |
| 166 | Ga0075434_101738840 | 3300006871 | Unclassified | 631 |
| 167 | Ga0068865_100585338 | 3300006881 | Unclassified | 941 |
| 168 | Ga0075436_100447533 | 3300006914 | Unclassified | 940 |
| 169 | Ga0075436_100502456 | 3300006914 | Bacteria | 887 |
| 170 | Ga0075436_100747422 | 3300006914 | Unclassified | 726 |
| 171 | Ga0075436_101523610 | 3300006914 | Bacteria | 508 |
| 172 | Ga0097620_100004959 | 3300006931 | Bacteria | 13519 |
| 173 | Ga0097620_100139020 | 3300006931 | Bacteria | 2502 |
| 174 | Ga0097620_100927579 | 3300006931 | Bacteria | 955 |
| 175 | Ga0097620_101658190 | 3300006931 | Unclassified | 706 |
| 176 | Ga0097620_102447691 | 3300006931 | Bacteria | 575 |
| 177 | Ga0075435_100078589 | 3300007076 | Bacteria | 2706 |
| 178 | Ga0075435_100524012 | 3300007076 | Unclassified | 1025 |
| 179 | Ga0075435_101146329 | 3300007076 | Unclassified | 680 |
| 180 | Ga0099794_10188183 | 3300007265 | Bacteria | 1055 |
| 181 | Ga0099794_10439374 | 3300007265 | Bacteria | 684 |
| 182 | Ga0099795_10118406 | 3300007788 | Bacteria | 1057 |
| 183 | Ga0105240_10000711 | 3300009093 | Bacteria | 60985 |
| 184 | Ga0105240_10041167 | 3300009093 | Bacteria | 5900 |
| 185 | Ga0105240_10093999 | 3300009093 | Bacteria | 3658 |
| 186 | Ga0105240_10146774 | 3300009093 | Bacteria | 2814 |
| 187 | Ga0105240_10211357 | 3300009093 | Unclassified | 2267 |
| 188 | Ga0105240_10316106 | 3300009093 | Bacteria | 1781 |
| 189 | Ga0105240_10907929 | 3300009093 | Bacteria | 947 |
| 190 | Ga0105240_12365030 | 3300009093 | Bacteria | 550 |
| 191 | Ga0111539_10143389 | 3300009094 | Bacteria | 2796 |
| 192 | Ga0111539_10147752 | 3300009094 | Bacteria | 2752 |
| 193 | Ga0111539_10199190 | 3300009094 | Unclassified | 2335 |
| 194 | Ga0111539_10247244 | 3300009094 | Bacteria | 2076 |
| 195 | Ga0111539_10293584 | 3300009094 | Bacteria | 1892 |
| 196 | Ga0111539_10415521 | 3300009094 | Unclassified | 1567 |
| 197 | Ga0111539_10434634 | 3300009094 | Unclassified | 1528 |
| 198 | Ga0111539_11187519 | 3300009094 | Bacteria | 886 |
| 199 | Ga0111539_11931963 | 3300009094 | Bacteria | 684 |
| 200 | Ga0105245_10843129 | 3300009098 | Bacteria | 956 |
| 201 | Ga0105245_12618231 | 3300009098 | Unclassified | 558 |
| 202 | Ga0105245_13272360 | 3300009098 | Unclassified | 502 |
| 203 | Ga0114129_10308395 | 3300009147 | Bacteria | 2107 |
| 204 | Ga0114129_11150348 | 3300009147 | Bacteria | 969 |
| 205 | Ga0105243_11284138 | 3300009148 | Bacteria | 748 |
| 206 | Ga0105243_12224788 | 3300009148 | Unclassified | 585 |
| 207 | Ga0105241_10264853 | 3300009174 | Bacteria | 1462 |
| 208 | Ga0105242_10049696 | 3300009176 | Bacteria | 3413 |
| 209 | Ga0105242_10096426 | 3300009176 | Unclassified | 2498 |
| 210 | Ga0105242_11706116 | 3300009176 | Unclassified | 666 |
| 211 | Ga0105248_10002679 | 3300009177 | Bacteria | 19773 |
| 212 | Ga0105248_10287924 | 3300009177 | Bacteria | 1850 |
| 213 | Ga0105248_10696089 | 3300009177 | Bacteria | 1147 |
| 214 | Ga0105248_10834565 | 3300009177 | Bacteria | 1040 |
| 215 | Ga0105248_10989966 | 3300009177 | Bacteria | 950 |
| 216 | Ga0105248_11154305 | 3300009177 | Unclassified | 876 |
| 217 | Ga0105248_13050859 | 3300009177 | Bacteria | 533 |
| 218 | Ga0105237_10377154 | 3300009545 | Bacteria | 1423 |
| 219 | Ga0105237_11522772 | 3300009545 | Bacteria | 676 |
| 220 | Ga0105238_10009790 | 3300009551 | Bacteria | 9595 |
| 221 | Ga0105238_10029677 | 3300009551 | Bacteria | 5570 |
| 222 | Ga0105238_10078731 | 3300009551 | Bacteria | 3286 |
| 223 | Ga0105238_10219669 | 3300009551 | Bacteria | 1876 |
| 224 | Ga0105238_10489331 | 3300009551 | Bacteria | 1230 |
| 225 | Ga0105238_10820404 | 3300009551 | Unclassified | 946 |
| 226 | Ga0105238_12366700 | 3300009551 | Bacteria | 566 |
| 227 | Ga0105249_10600692 | 3300009553 | Bacteria | 1155 |
| 228 | Ga0105249_12308474 | 3300009553 | Bacteria | 611 |
| 229 | Ga0105239_10151904 | 3300010375 | Bacteria | 2584 |
| 230 | Ga0105239_12197316 | 3300010375 | Bacteria | 642 |
| 231 | Ga0105246_11171745 | 3300011119 | Bacteria | 706 |
| 232 | Ga0157373_10255114 | 3300013100 | Bacteria | 1241 |
| 233 | Ga0157373_10332625 | 3300013100 | Bacteria | 1082 |
| 234 | Ga0157370_10067916 | 3300013104 | Bacteria | 3369 |
| 235 | Ga0157370_10274932 | 3300013104 | Unclassified | 1556 |
| 236 | Ga0157370_10309732 | 3300013104 | Unclassified | 1457 |
| 237 | Ga0157370_10689703 | 3300013104 | Bacteria | 932 |
| 238 | Ga0157369_10732018 | 3300013105 | Bacteria | 1018 |
| 239 | Ga0157369_11372755 | 3300013105 | Bacteria | 720 |
| 240 | Ga0157369_11894006 | 3300013105 | Bacteria | 605 |
| 241 | Ga0157374_10131416 | 3300013296 | Unclassified | 2423 |
| 242 | Ga0157374_11144739 | 3300013296 | Bacteria | 799 |
| 243 | Ga0157374_11271070 | 3300013296 | Unclassified | 758 |
| 244 | Ga0157378_10316020 | 3300013297 | Bacteria | 1516 |
| 245 | Ga0157378_10665928 | 3300013297 | Bacteria | 1058 |
| 246 | Ga0157378_10729749 | 3300013297 | Bacteria | 1012 |
| 247 | Ga0157378_10862590 | 3300013297 | Bacteria | 934 |
| 248 | Ga0157378_12477267 | 3300013297 | Bacteria | 571 |
| 249 | Ga0157378_12676642 | 3300013297 | Unclassified | 551 |
| 250 | Ga0163162_10296440 | 3300013306 | Bacteria | 1749 |
| 251 | Ga0163162_11789026 | 3300013306 | Unclassified | 702 |
| 252 | Ga0157372_10012520 | 3300013307 | Bacteria | 9034 |
| 253 | Ga0157372_10039202 | 3300013307 | Bacteria | 5230 |
| 254 | Ga0157372_10292207 | 3300013307 | Unclassified | 1895 |
| 255 | Ga0157372_10786642 | 3300013307 | Bacteria | 1106 |
| 256 | Ga0157372_11114440 | 3300013307 | Unclassified | 913 |
| 257 | Ga0157375_10000036 | 3300013308 | Bacteria | 177008 |
| 258 | Ga0157375_10624566 | 3300013308 | Unclassified | 1235 |
| 259 | Ga0157375_11308405 | 3300013308 | Unclassified | 852 |
| 260 | Ga0163163_10000067 | 3300014325 | Bacteria | 114831 |
| 261 | Ga0163163_10040992 | 3300014325 | Bacteria | 4526 |
| 262 | Ga0163163_10300912 | 3300014325 | Bacteria | 1656 |
| 263 | Ga0163163_11559779 | 3300014325 | Unclassified | 721 |
| 264 | Ga0157380_10801447 | 3300014326 | Bacteria | 959 |
| 265 | Ga0157380_11040558 | 3300014326 | Unclassified | 854 |
| 266 | Ga0157380_11557827 | 3300014326 | Unclassified | 715 |
| 267 | Ga0157379_10086226 | 3300014968 | Bacteria | 2815 |
| 268 | Ga0157379_10123194 | 3300014968 | Unclassified | 2333 |
| 269 | Ga0157376_10296121 | 3300014969 | Bacteria | 1530 |
| 270 | Ga0157376_12784382 | 3300014969 | Unclassified | 529 |
| 271 | Ga0163161_11787587 | 3300017792 | Bacteria | 546 |
| 272 | Ga0206356_11283718 | 3300020070 | Bacteria | 695 |
| 273 | Ga0206353_10613002 | 3300020082 | Bacteria | 911 |
| 274 | Ga0207656_10502415 | 3300025321 | Unclassified | 616 |
| 275 | Ga0207692_10030925 | 3300025898 | Bacteria | 2559 |
| 276 | Ga0207688_10203079 | 3300025901 | Bacteria | 1189 |
| 277 | Ga0207699_10012821 | 3300025906 | Bacteria | 4270 |
| 278 | Ga0207645_10680784 | 3300025907 | Bacteria | 699 |
| 279 | Ga0207705_10560376 | 3300025909 | Bacteria | 888 |
| 280 | Ga0207684_10838610 | 3300025910 | Unclassified | 775 |
| 281 | Ga0207654_10370300 | 3300025911 | Bacteria | 990 |
| 282 | Ga0207707_10163771 | 3300025912 | Bacteria | 1944 |
| 283 | Ga0207695_10001486 | 3300025913 | Bacteria | 39184 |
| 284 | Ga0207695_10039795 | 3300025913 | Bacteria | 5049 |
| 285 | Ga0207695_10115378 | 3300025913 | Bacteria | 2660 |
| 286 | Ga0207695_10191605 | 3300025913 | Bacteria | 1962 |
| 287 | Ga0207695_10229821 | 3300025913 | Unclassified | 1760 |
| 288 | Ga0207695_10265970 | 3300025913 | Bacteria | 1611 |
| 289 | Ga0207695_11265214 | 3300025913 | Bacteria | 618 |
| 290 | Ga0207671_10325858 | 3300025914 | Bacteria | 1216 |
| 291 | Ga0207671_11391612 | 3300025914 | Bacteria | 544 |
| 292 | Ga0207693_10153434 | 3300025915 | Bacteria | 1812 |
| 293 | Ga0207693_10916670 | 3300025915 | Bacteria | 672 |
| 294 | Ga0207663_10014922 | 3300025916 | Unclassified | 4271 |
| 295 | Ga0207663_10090826 | 3300025916 | Bacteria | 2026 |
| 296 | Ga0207663_11289515 | 3300025916 | Bacteria | 588 |
| 297 | Ga0207660_10431121 | 3300025917 | Unclassified | 1064 |
| 298 | Ga0207660_10841745 | 3300025917 | Bacteria | 749 |
| 299 | Ga0207662_10103009 | 3300025918 | Bacteria | 1771 |
| 300 | Ga0207662_10361414 | 3300025918 | Unclassified | 977 |
| 301 | Ga0207662_10854118 | 3300025918 | Unclassified | 643 |
| 302 | Ga0207657_10050715 | 3300025919 | Bacteria | 3610 |
| 303 | Ga0207649_10276577 | 3300025920 | Bacteria | 1219 |
| 304 | Ga0207649_10599038 | 3300025920 | Bacteria | 847 |
| 305 | Ga0207652_10032134 | 3300025921 | Bacteria | 4408 |
| 306 | Ga0207652_10187267 | 3300025921 | Bacteria | 1861 |
| 307 | Ga0207652_11282099 | 3300025921 | Unclassified | 635 |
| 308 | Ga0207646_10171037 | 3300025922 | Unclassified | 1962 |
| 309 | Ga0207646_10983970 | 3300025922 | Unclassified | 746 |
| 310 | Ga0207646_11172765 | 3300025922 | Unclassified | 674 |
| 311 | Ga0207694_10020783 | 3300025924 | Bacteria | 4969 |
| 312 | Ga0207694_10025236 | 3300025924 | Bacteria | 4517 |
| 313 | Ga0207694_10215584 | 3300025924 | Bacteria | 1565 |
| 314 | Ga0207694_10421574 | 3300025924 | Bacteria | 1112 |
| 315 | Ga0207694_10792113 | 3300025924 | Unclassified | 801 |
| 316 | Ga0207659_10603627 | 3300025926 | Unclassified | 936 |
| 317 | Ga0207687_10367058 | 3300025927 | Bacteria | 1176 |
| 318 | Ga0207687_11593944 | 3300025927 | Unclassified | 560 |
| 319 | Ga0207700_10019165 | 3300025928 | Bacteria | 4617 |
| 320 | Ga0207700_10528860 | 3300025928 | Unclassified | 1045 |
| 321 | Ga0207700_11405544 | 3300025928 | Unclassified | 620 |
| 322 | Ga0207664_10002691 | 3300025929 | Bacteria | 11789 |
| 323 | Ga0207664_10006289 | 3300025929 | Bacteria | 8162 |
| 324 | Ga0207644_10315241 | 3300025931 | Bacteria | 1263 |
| 325 | Ga0207690_10065204 | 3300025932 | Bacteria | 2490 |
| 326 | Ga0207690_10273171 | 3300025932 | Bacteria | 1314 |
| 327 | Ga0207706_10050263 | 3300025933 | Bacteria | 3684 |
| 328 | Ga0207686_10053853 | 3300025934 | Bacteria | 2518 |
| 329 | Ga0207686_10156519 | 3300025934 | Unclassified | 1592 |
| 330 | Ga0207686_10793290 | 3300025934 | Bacteria | 759 |
| 331 | Ga0207670_10010394 | 3300025936 | Bacteria | 5359 |
| 332 | Ga0207670_10038951 | 3300025936 | Bacteria | 3109 |
| 333 | Ga0207670_10081443 | 3300025936 | Bacteria | 2265 |
| 334 | Ga0207670_10150737 | 3300025936 | Bacteria | 1725 |
| 335 | Ga0207670_10441721 | 3300025936 | Bacteria | 1047 |
| 336 | Ga0207670_10491130 | 3300025936 | Bacteria | 996 |
| 337 | Ga0207669_10614490 | 3300025937 | Bacteria | 885 |
| 338 | Ga0207669_10994970 | 3300025937 | Bacteria | 704 |
| 339 | Ga0207665_10305913 | 3300025939 | Bacteria | 1189 |
| 340 | Ga0207665_11025648 | 3300025939 | Bacteria | 657 |
| 341 | Ga0207665_11503111 | 3300025939 | Unclassified | 535 |
| 342 | Ga0207691_10486771 | 3300025940 | Bacteria | 1048 |
| 343 | Ga0207691_11377780 | 3300025940 | Unclassified | 580 |
| 344 | Ga0207711_10011291 | 3300025941 | Bacteria | 7420 |
| 345 | Ga0207689_10738908 | 3300025942 | Bacteria | 830 |
| 346 | Ga0207689_11218347 | 3300025942 | Bacteria | 633 |
| 347 | Ga0207661_10304455 | 3300025944 | Unclassified | 1430 |
| 348 | Ga0207661_10606791 | 3300025944 | Unclassified | 1005 |
| 349 | Ga0207679_11651340 | 3300025945 | Bacteria | 587 |
| 350 | Ga0207667_10023109 | 3300025949 | Bacteria | 6849 |
| 351 | Ga0207667_10203627 | 3300025949 | Bacteria | 2030 |
| 352 | Ga0207667_10245694 | 3300025949 | Bacteria | 1831 |
| 353 | Ga0207667_10349173 | 3300025949 | Unclassified | 1509 |
| 354 | Ga0207667_10988737 | 3300025949 | Bacteria | 829 |
| 355 | Ga0207651_11938690 | 3300025960 | Bacteria | 530 |
| 356 | Ga0207712_12113299 | 3300025961 | Unclassified | 504 |
| 357 | Ga0207668_11306736 | 3300025972 | Bacteria | 653 |
| 358 | Ga0207658_11076035 | 3300025986 | Bacteria | 734 |
| 359 | Ga0207658_11473376 | 3300025986 | Bacteria | 623 |
| 360 | Ga0207677_10270475 | 3300026023 | Bacteria | 1390 |
| 361 | Ga0207677_12024613 | 3300026023 | Bacteria | 535 |
| 362 | Ga0207703_11444908 | 3300026035 | Unclassified | 662 |
| 363 | Ga0207639_12076209 | 3300026041 | Bacteria | 529 |
| 364 | Ga0207678_11201319 | 3300026067 | Bacteria | 671 |
| 365 | Ga0207678_11768408 | 3300026067 | Bacteria | 542 |
| 366 | Ga0207708_10274832 | 3300026075 | Bacteria | 1364 |
| 367 | Ga0207708_10795981 | 3300026075 | Bacteria | 814 |
| 368 | Ga0207702_10000259 | 3300026078 | Bacteria | 61188 |
| 369 | Ga0207702_10042210 | 3300026078 | Bacteria | 3826 |
| 370 | Ga0207702_10130463 | 3300026078 | Unclassified | 2261 |
| 371 | Ga0207702_10788911 | 3300026078 | Unclassified | 939 |
| 372 | Ga0207702_10991150 | 3300026078 | Unclassified | 833 |
| 373 | Ga0207702_11268878 | 3300026078 | Unclassified | 731 |
| 374 | Ga0207702_12232551 | 3300026078 | Bacteria | 536 |
| 375 | Ga0207702_12493069 | 3300026078 | Unclassified | 504 |
| 376 | Ga0207641_10482099 | 3300026088 | Bacteria | 1202 |
| 377 | Ga0207641_11025422 | 3300026088 | Bacteria | 822 |
| 378 | Ga0207641_11935646 | 3300026088 | Unclassified | 591 |
| 379 | Ga0207641_12053081 | 3300026088 | Unclassified | 573 |
| 380 | Ga0207648_10253690 | 3300026089 | Bacteria | 1568 |
| 381 | Ga0207648_10405020 | 3300026089 | Bacteria | 1237 |
| 382 | Ga0207648_10408174 | 3300026089 | Unclassified | 1232 |
| 383 | Ga0207648_11808391 | 3300026089 | Bacteria | 573 |
| 384 | Ga0207676_10138522 | 3300026095 | Unclassified | 2080 |
| 385 | Ga0207676_11174478 | 3300026095 | Bacteria | 760 |
| 386 | Ga0207674_10648540 | 3300026116 | Bacteria | 1020 |
| 387 | Ga0207674_10749364 | 3300026116 | Bacteria | 943 |
| 388 | Ga0207674_11269318 | 3300026116 | Unclassified | 706 |
| 389 | Ga0207674_11280648 | 3300026116 | Bacteria | 703 |
| 390 | Ga0207675_100190917 | 3300026118 | Bacteria | 1965 |
| 391 | Ga0207675_100612160 | 3300026118 | Bacteria | 1093 |
| 392 | Ga0207675_101428885 | 3300026118 | Bacteria | 712 |
| 393 | Ga0207698_10292264 | 3300026142 | Bacteria | 1513 |
| 394 | Ga0207698_11076212 | 3300026142 | Unclassified | 816 |
| 395 | Ga0209981_1006505 | 3300027378 | Bacteria | 1564 |
| 396 | Ga0209984_1033594 | 3300027424 | Bacteria | 729 |
| 397 | Ga0210000_1002922 | 3300027462 | Bacteria | 2443 |
| 398 | Ga0209999_1012191 | 3300027543 | Bacteria | 1556 |
| 399 | Ga0209982_1010399 | 3300027552 | Bacteria | 1377 |
| 400 | Ga0209983_1001526 | 3300027665 | Bacteria | 5145 |
| 401 | Ga0209971_1006080 | 3300027682 | Bacteria | 2860 |
| 402 | Ga0209974_10002416 | 3300027876 | Bacteria | 6766 |
| 403 | Ga0207428_10113363 | 3300027907 | Bacteria | 2084 |
| 404 | Ga0207428_10448079 | 3300027907 | Bacteria | 941 |
| 405 | Ga0207428_10747964 | 3300027907 | Bacteria | 697 |
| 406 | Ga0268264_10809127 | 3300028381 | Bacteria | 937 |
| 407 | Ga0268264_11702785 | 3300028381 | Unclassified | 641 |
| 408 | Ga0265337_1000269 | 3300028556 | Bacteria | 28329 |
| 409 | Ga0265337_1006463 | 3300028556 | Bacteria | 4514 |
| 410 | Ga0265337_1009750 | 3300028556 | Bacteria | 3410 |
| 411 | Ga0265337_1014485 | 3300028556 | Bacteria | 2613 |
| 412 | Ga0265337_1047643 | 3300028556 | Bacteria | 1214 |
| 413 | Ga0265326_10002061 | 3300028558 | Bacteria | 6852 |
| 414 | Ga0265326_10026223 | 3300028558 | Bacteria | 1662 |
| 415 | Ga0265326_10029103 | 3300028558 | Unclassified | 1574 |
| 416 | Ga0265326_10046844 | 3300028558 | Bacteria | 1226 |
| 417 | Ga0265319_1000001 | 3300028563 | Bacteria | 549513 |
| 418 | Ga0265319_1015923 | 3300028563 | Bacteria | 2894 |
| 419 | Ga0265319_1085928 | 3300028563 | Unclassified | 996 |
| 420 | Ga0265334_10017859 | 3300028573 | Bacteria | 2926 |
| 421 | Ga0265334_10031370 | 3300028573 | Bacteria | 2124 |
| 422 | Ga0265334_10191869 | 3300028573 | Unclassified | 712 |
| 423 | Ga0265318_10122269 | 3300028577 | Bacteria | 957 |
| 424 | Ga0265318_10140535 | 3300028577 | Bacteria | 887 |
| 425 | Ga0265318_10147194 | 3300028577 | Bacteria | 864 |
| 426 | Ga0265323_10001379 | 3300028653 | Bacteria | 12026 |
| 427 | Ga0265323_10016104 | 3300028653 | Bacteria | 2926 |
| 428 | Ga0265322_10015098 | 3300028654 | Bacteria | 2233 |
| 429 | Ga0265322_10042408 | 3300028654 | Unclassified | 1295 |
| 430 | Ga0265322_10254084 | 3300028654 | Bacteria | 505 |
| 431 | Ga0265336_10000586 | 3300028666 | Bacteria | 20502 |
| 432 | Ga0265336_10037892 | 3300028666 | Bacteria | 1481 |
| 433 | Ga0265336_10075819 | 3300028666 | Unclassified | 1004 |
| 434 | Ga0265336_10101511 | 3300028666 | Bacteria | 857 |
| 435 | Ga0265336_10162811 | 3300028666 | Bacteria | 663 |
| 436 | Ga0265336_10210789 | 3300028666 | Bacteria | 577 |
| 437 | Ga0265338_10000030 | 3300028800 | Bacteria | 260974 |
| 438 | Ga0265338_10000032 | 3300028800 | Bacteria | 257580 |
| 439 | Ga0265338_10000041 | 3300028800 | Bacteria | 230676 |
| 440 | Ga0265338_10001233 | 3300028800 | Bacteria | 42256 |
| 441 | Ga0265338_10002413 | 3300028800 | Bacteria | 28135 |
| 442 | Ga0265338_10002424 | 3300028800 | Bacteria | 28039 |
| 443 | Ga0265338_10005324 | 3300028800 | Bacteria | 16845 |
| 444 | Ga0265338_10007470 | 3300028800 | Bacteria | 13551 |
| 445 | Ga0265338_10010884 | 3300028800 | Bacteria | 10585 |
| 446 | Ga0265338_10011620 | 3300028800 | Bacteria | 10148 |
| 447 | Ga0265338_10012697 | 3300028800 | Bacteria | 9586 |
| 448 | Ga0265338_10026423 | 3300028800 | Bacteria | 5856 |
| 449 | Ga0265338_10035706 | 3300028800 | Bacteria | 4770 |
| 450 | Ga0265338_10039538 | 3300028800 | Bacteria | 4447 |
| 451 | Ga0265338_10061058 | 3300028800 | Bacteria | 3306 |
| 452 | Ga0265338_10096938 | 3300028800 | Bacteria | 2418 |
| 453 | Ga0265338_10097818 | 3300028800 | Bacteria | 2403 |
| 454 | Ga0265338_10116705 | 3300028800 | Bacteria | 2138 |
| 455 | Ga0265338_10167914 | 3300028800 | Unclassified | 1687 |
| 456 | Ga0265338_10175173 | 3300028800 | Bacteria | 1640 |
| 457 | Ga0265338_10183037 | 3300028800 | Bacteria | 1595 |
| 458 | Ga0265338_10584372 | 3300028800 | Bacteria | 779 |
| 459 | Ga0265338_10648725 | 3300028800 | Bacteria | 732 |
| 460 | Ga0265338_10850002 | 3300028800 | Bacteria | 623 |
| 461 | Ga0265338_11142333 | 3300028800 | Bacteria | 524 |
| 462 | Ga0265324_10012004 | 3300029957 | Bacteria | 3283 |
| 463 | Ga0265324_10022204 | 3300029957 | Bacteria | 2270 |
| 464 | Ga0265324_10026322 | 3300029957 | Bacteria | 2059 |
| 465 | Ga0265324_10033066 | 3300029957 | Bacteria | 1806 |
| 466 | Ga0265324_10033947 | 3300029957 | Bacteria | 1778 |
| 467 | Ga0265324_10043437 | 3300029957 | Unclassified | 1551 |
| 468 | Ga0265324_10068622 | 3300029957 | Bacteria | 1209 |
| 469 | Ga0265324_10087808 | 3300029957 | Bacteria | 1057 |
| 470 | Ga0265324_10113975 | 3300029957 | Bacteria | 918 |
| 471 | Ga0265324_10268554 | 3300029957 | Unclassified | 580 |
| 472 | Ga0265760_10209941 | 3300031090 | Bacteria | 660 |
| 473 | Ga0265332_10045477 | 3300031238 | Bacteria | 1892 |
| 474 | Ga0265332_10184899 | 3300031238 | Bacteria | 868 |
| 475 | Ga0265328_10016270 | 3300031239 | Bacteria | 2897 |
| 476 | Ga0265320_10000939 | 3300031240 | Bacteria | 21724 |
| 477 | Ga0265320_10007536 | 3300031240 | Bacteria | 6750 |
| 478 | Ga0265320_10027370 | 3300031240 | Bacteria | 2973 |
| 479 | Ga0265320_10037960 | 3300031240 | Bacteria | 2422 |
| 480 | Ga0265320_10169710 | 3300031240 | Unclassified | 980 |
| 481 | Ga0265320_10281760 | 3300031240 | Bacteria | 736 |
| 482 | Ga0265320_10290504 | 3300031240 | Bacteria | 723 |
| 483 | Ga0265320_10546532 | 3300031240 | Unclassified | 512 |
| 484 | Ga0265325_10041915 | 3300031241 | Bacteria | 2396 |
| 485 | Ga0265325_10089147 | 3300031241 | Bacteria | 1523 |
| 486 | Ga0265329_10002621 | 3300031242 | Bacteria | 8095 |
| 487 | Ga0265329_10056518 | 3300031242 | Bacteria | 1244 |
| 488 | Ga0265340_10000417 | 3300031247 | Bacteria | 22826 |
| 489 | Ga0265340_10015340 | 3300031247 | Unclassified | 3981 |
| 490 | Ga0265340_10341831 | 3300031247 | Bacteria | 661 |
| 491 | Ga0265340_10434803 | 3300031247 | Unclassified | 578 |
| 492 | Ga0265339_10118633 | 3300031249 | Bacteria | 1362 |
| 493 | Ga0265339_10496491 | 3300031249 | Unclassified | 564 |
| 494 | Ga0265339_10538592 | 3300031249 | Unclassified | 537 |
| 495 | Ga0265331_10088866 | 3300031250 | Bacteria | 1429 |
| 496 | Ga0265331_10422242 | 3300031250 | Unclassified | 598 |
| 497 | Ga0265331_10427167 | 3300031250 | Bacteria | 595 |
| 498 | Ga0265327_10000379 | 3300031251 | Bacteria | 83712 |
| 499 | Ga0265327_10003825 | 3300031251 | Bacteria | 13914 |
| 500 | Ga0265327_10055436 | 3300031251 | Bacteria | 2047 |
| 501 | Ga0265327_10276771 | 3300031251 | Bacteria | 742 |
| 502 | Ga0265316_10002569 | 3300031344 | Bacteria | 18754 |
| 503 | Ga0265316_10009532 | 3300031344 | Bacteria | 8936 |
| 504 | Ga0265316_10179213 | 3300031344 | Bacteria | 1578 |
| 505 | Ga0265316_10205380 | 3300031344 | Bacteria | 1459 |
| 506 | Ga0265316_10292055 | 3300031344 | Bacteria | 1189 |
| 507 | Ga0265316_10339335 | 3300031344 | Bacteria | 1089 |
| 508 | Ga0265316_10362513 | 3300031344 | Bacteria | 1048 |
| 509 | Ga0265316_10881245 | 3300031344 | Bacteria | 626 |
| 510 | Ga0265316_10912864 | 3300031344 | Bacteria | 613 |
| 511 | Ga0265316_11080034 | 3300031344 | Unclassified | 557 |
| 512 | Ga0307513_10768336 | 3300031456 | Bacteria | 669 |
| 513 | Ga0265313_10000837 | 3300031595 | Bacteria | 31004 |
| 514 | Ga0316575_10141479 | 3300031665 | Bacteria | 990 |
| 515 | Ga0265314_10000070 | 3300031711 | Bacteria | 153096 |
| 516 | Ga0265314_10075416 | 3300031711 | Bacteria | 2244 |
| 517 | Ga0265314_10272126 | 3300031711 | Bacteria | 962 |
| 518 | Ga0265342_10113918 | 3300031712 | Bacteria | 1528 |
| 519 | Ga0265342_10226607 | 3300031712 | Unclassified | 1005 |
| 520 | Ga0265342_10370617 | 3300031712 | Unclassified | 743 |
| 521 | Ga0265342_10595381 | 3300031712 | Unclassified | 558 |
| 522 | Ga0265342_10641493 | 3300031712 | Bacteria | 534 |
| 523 | Ga0316576_10024532 | 3300031727 | Bacteria | 4211 |
| 524 | Ga0316578_10216970 | 3300031728 | Bacteria | 1150 |
| 525 | Ga0316578_10599944 | 3300031728 | Unclassified | 645 |
| 526 | Ga0307406_11319145 | 3300031901 | Bacteria | 630 |
| 527 | Ga0316583_10059453 | 3300032133 | Bacteria | 1341 |
| 528 | Ga0307510_10255979 | 3300033180 | Bacteria | 1235 |
| 529 | Ga0316596_1146570 | 3300033541 | Unclassified | 647 |
| 530 | Ga0373950_0160536 | 3300034818 | Unclassified | 519 |
| 531 | Ga0373959_0133970 | 3300034820 | Bacteria | 615 |
| 532 | Ga0373926_0044445 | 3300035083 | Bacteria | 1591 |
| 533 | Ga0373926_0144594 | 3300035083 | Bacteria | 904 |
| 534 | Ga0373928_0001832 | 3300035084 | Bacteria | 4141 |
| 535 | Ga0373929_0002598 | 3300035085 | Bacteria | 3310 |
| 536 | Ga0373944_0000243 | 3300035089 | Bacteria | 11920 |
| 537 | Ga0373944_0004703 | 3300035089 | Bacteria | 3567 |
| 538 | Ga0373944_0156133 | 3300035089 | Bacteria | 807 |
| 539 | Ga0373949_0008104 | 3300035090 | Bacteria | 2303 |
| 540 | Ga0373951_0006156 | 3300035091 | Bacteria | 2754 |
| 541 | Ga0373952_0176663 | 3300035092 | Bacteria | 613 |
| 542 | Ga0373923_0129710 | 3300035111 | Bacteria | 1132 |
| 543 | Ga0373923_0263914 | 3300035111 | Unclassified | 808 |
| 544 | Ga0373932_0000003 | 3300035112 | Bacteria | 459351 |
| 545 | Ga0373945_0030507 | 3300035116 | Bacteria | 1901 |
| 546 | Ga0373954_0019308 | 3300035118 | Unclassified | 3073 |
| 547 | Ga0373954_0033939 | 3300035118 | Bacteria | 2361 |
| 548 | Ga0373954_0313055 | 3300035118 | Bacteria | 775 |
| 549 | Ga0373956_0052640 | 3300035119 | Bacteria | 1831 |
| 550 | Ga0373956_0058343 | 3300035119 | Bacteria | 1745 |
| 551 | Ga0373957_0100716 | 3300035120 | Bacteria | 1156 |
| 552 | Ga0373943_0040802 | 3300035170 | Unclassified | 2242 |
| 553 | Ga0373943_0156505 | 3300035170 | Bacteria | 1238 |
| 554 | Ga0373946_0087031 | 3300035171 | Unclassified | 1378 |
| 555 | Ga0373946_0478896 | 3300035171 | Bacteria | 636 |
| 556 | Ga0373955_0491452 | 3300035172 | Unclassified | 749 |
| 557 | Ga0373962_0000059 | 3300035242 | Bacteria | 23801 |
| 558 | Ga0373931_0000054 | 3300035691 | Bacteria | 58930 |
| 559 | Ga0373931_0214402 | 3300035691 | Unclassified | 1156 |
| 560 | Ga0373931_0809671 | 3300035691 | Bacteria | 625 |
| 561 | Ga0373935_0049025 | 3300035692 | Unclassified | 2676 |
| 562 | Ga0373935_0283923 | 3300035692 | Bacteria | 1166 |
| 563 | Ga0373935_0381767 | 3300035692 | Unclassified | 1009 |
| 564 | Ga0373927_0003514 | 3300035695 | Bacteria | 11216 |
| 565 | Ga0373927_0065858 | 3300035695 | Bacteria | 2343 |
| 566 | Ga0373927_0148529 | 3300035695 | Unclassified | 1535 |
| 567 | Ga0373927_0408599 | 3300035695 | Bacteria | 896 |
| 568 | Ga0373927_0817518 | 3300035695 | Bacteria | 615 |
| 569 | Ga0373933_0079446 | 3300035724 | Bacteria | 2009 |
| 570 | Ga0373933_0494709 | 3300035724 | Bacteria | 801 |
| 571 | Ga0373933_0798320 | 3300035724 | Unclassified | 621 |
| 572 | Ga0373947_0011605 | 3300035725 | Bacteria | 5055 |
| 573 | Ga0373947_0098809 | 3300035725 | Bacteria | 1831 |
| 574 | Ga0373937_0003348 | 3300036401 | Bacteria | 13454 |
| 575 | Ga0373937_0123186 | 3300036401 | Unclassified | 2417 |
| 576 | Ga0373937_0441780 | 3300036401 | Bacteria | 1235 |
| 577 | Ga0373937_0447919 | 3300036401 | Bacteria | 1226 |
| 578 | Ga0373937_0515944 | 3300036401 | Bacteria | 1136 |
| 579 | Ga0373937_1005377 | 3300036401 | Bacteria | 783 |
| 580 | Ga0373937_1589040 | 3300036401 | Bacteria | 601 |
| 581 | Ga0316582_0822322 | 3300036647 | Bacteria | 636 |
| 582 | Ga0373925_0000299 | 3300037068 | Bacteria | 51930 |
| 583 | Ga0373925_0005364 | 3300037068 | Bacteria | 9565 |
| 584 | Ga0373925_0030220 | 3300037068 | Bacteria | 3976 |
| 585 | Ga0373925_0938501 | 3300037068 | Unclassified | 713 |
| 586 | Ga0373925_1313777 | 3300037068 | Unclassified | 593 |
| 587 | Ga0373925_1449351 | 3300037068 | Unclassified | 562 |
| 588 | Ga0395905_0045482 | 3300037471 | Bacteria | 4117 |
| 589 | Ga0395905_0184390 | 3300037471 | Bacteria | 1959 |
| 590 | Ga0395905_0260350 | 3300037471 | Unclassified | 1620 |
| 591 | Ga0395901_0197395 | 3300038443 | Bacteria | 2110 |
| 592 | Ga0451804_0485622 | 3300041463 | Bacteria | 511 |
| 593 | Ga0451839_0481867 | 3300041496 | Bacteria | 634 |
| 594 | Ga0451851_0491892 | 3300041507 | Bacteria | 606 |
| 595 | Ga0450912_037526 | 3300042116 | Bacteria | 519 |
| 596 | Ga0451577_0000302 | 3300042876 | Bacteria | 95860 |
| 597 | Ga0451577_0002102 | 3300042876 | Bacteria | 24536 |
| 598 | Ga0451577_0047000 | 3300042876 | Bacteria | 3860 |
| 599 | Ga0453683_0815480 | 3300044673 | Bacteria | 615 |
| 600 | Ga0453684_0000255 | 3300044712 | Bacteria | 229708 |
| 601 | Ga0453684_0014376 | 3300044712 | Bacteria | 12675 |
| 602 | Ga0453684_0295425 | 3300044712 | Bacteria | 1843 |
| 603 | Ga0453684_2419263 | 3300044712 | Unclassified | 520 |
| 604 | Ga0451576_0028073 | 3300045051 | Bacteria | 6033 |
| 605 | Ga0451576_0078450 | 3300045051 | Bacteria | 3437 |
| 606 | Ga0451576_0098411 | 3300045051 | Bacteria | 3043 |
| 607 | Ga0451576_0278083 | 3300045051 | Unclassified | 1750 |
| 608 | Ga0451576_0289356 | 3300045051 | Bacteria | 1713 |
| 609 | Ga0451576_0573757 | 3300045051 | Unclassified | 1185 |
| 610 | Ga0451576_0618468 | 3300045051 | Unclassified | 1138 |
| 611 | Ga0451576_0707622 | 3300045051 | Bacteria | 1058 |
| 612 | Ga0451576_0741022 | 3300045051 | Bacteria | 1032 |
| 613 | Ga0451576_0796110 | 3300045051 | Bacteria | 993 |
| 614 | Ga0451576_0813245 | 3300045051 | Unclassified | 981 |
| 615 | Ga0451576_0818669 | 3300045051 | Bacteria | 978 |
| 616 | Ga0451576_0887473 | 3300045051 | Unclassified | 936 |
| 617 | Ga0451576_0982660 | 3300045051 | Bacteria | 885 |
| 618 | Ga0451576_1077264 | 3300045051 | Unclassified | 841 |
| 619 | Ga0451576_1150472 | 3300045051 | Bacteria | 811 |
| 620 | Ga0451576_1171125 | 3300045051 | Bacteria | 803 |
| 621 | Ga0451576_1224609 | 3300045051 | Unclassified | 784 |
| 622 | Ga0451576_1687171 | 3300045051 | Archaea | 656 |
| 623 | Ga0451576_2237689 | 3300045051 | Unclassified | 561 |
| 624 | Ga0451576_2541012 | 3300045051 | Bacteria | 523 |
| 625 | Ga0466958_1145143 | 3300045836 | Bacteria | 508 |
| 626 | Ga0495592_0104304 | 3300046454 | Bacteria | 2016 |
| 627 | Ga0495592_0142410 | 3300046454 | Bacteria | 1666 |
| 628 | Ga0495592_0347930 | 3300046454 | Bacteria | 951 |
| 629 | Ga0495629_0374433 | 3300046459 | Bacteria | 969 |
| 630 | Ga0495641_0013934 | 3300046461 | Bacteria | 4379 |
| 631 | Ga0495651_0249801 | 3300046462 | Unclassified | 1212 |
| 632 | Ga0495651_0304323 | 3300046462 | Bacteria | 1068 |
| 633 | Ga0495653_0350351 | 3300046463 | Unclassified | 950 |
| 634 | Ga0495653_0857388 | 3300046463 | Unclassified | 543 |
| 635 | Ga0495580_0289484 | 3300046472 | Bacteria | 1117 |
| 636 | Ga0495582_0127734 | 3300046473 | Bacteria | 1435 |
| 637 | Ga0495582_0178275 | 3300046473 | Bacteria | 1210 |
| 638 | Ga0495639_0236036 | 3300046475 | Bacteria | 902 |
| 639 | Ga0495639_0247886 | 3300046475 | Bacteria | 880 |
| 640 | Ga0495662_0057157 | 3300046476 | Unclassified | 1884 |
| 641 | Ga0495662_0353147 | 3300046476 | Unclassified | 723 |
| 642 | Ga0495594_0511638 | 3300046499 | Bacteria | 682 |
| 643 | Ga0495608_0562719 | 3300046511 | Bacteria | 686 |
| 644 | Ga0495618_0012160 | 3300046514 | Bacteria | 5225 |
| 645 | Ga0495618_0409083 | 3300046514 | Unclassified | 829 |
| 646 | Ga0495628_0216330 | 3300046516 | Bacteria | 1440 |
| 647 | Ga0495628_0511221 | 3300046516 | Unclassified | 866 |
| 648 | Ga0495628_0577689 | 3300046516 | Bacteria | 805 |
| 649 | Ga0495628_1114512 | 3300046516 | Unclassified | 538 |
| 650 | Ga0495630_0000171 | 3300046517 | Bacteria | 50810 |
| 651 | Ga0495630_0008736 | 3300046517 | Bacteria | 7279 |
| 652 | Ga0495630_0021595 | 3300046517 | Bacteria | 4753 |
| 653 | Ga0495630_0136328 | 3300046517 | Bacteria | 1865 |
| 654 | Ga0495630_0159722 | 3300046517 | Bacteria | 1716 |
| 655 | Ga0495630_0164956 | 3300046517 | Bacteria | 1687 |
| 656 | Ga0495630_0224930 | 3300046517 | Bacteria | 1433 |
| 657 | Ga0495630_0269163 | 3300046517 | Bacteria | 1302 |
| 658 | Ga0495630_0348341 | 3300046517 | Bacteria | 1134 |
| 659 | Ga0495666_0063757 | 3300046526 | Unclassified | 1759 |
| 660 | Ga0495666_0113782 | 3300046526 | Bacteria | 1270 |
| 661 | Ga0495666_0235280 | 3300046526 | Bacteria | 837 |
| 662 | Ga0495666_0352922 | 3300046526 | Unclassified | 662 |
| 663 | Ga0495652_0211409 | 3300046529 | Bacteria | 1464 |
| 664 | Ga0495665_0060321 | 3300046531 | Unclassified | 2003 |
| 665 | Ga0495665_0647992 | 3300046531 | Bacteria | 526 |
| 666 | Ga0495640_0024065 | 3300046533 | Bacteria | 4431 |
| 667 | Ga0495640_0024615 | 3300046533 | Unclassified | 4378 |
| 668 | Ga0495640_0116537 | 3300046533 | Unclassified | 1740 |
| 669 | Ga0495640_0720718 | 3300046533 | Bacteria | 597 |
| 670 | Ga0495586_0000676 | 3300046535 | Bacteria | 19447 |
| 671 | Ga0495586_0002025 | 3300046535 | Bacteria | 11010 |
| 672 | Ga0495586_0017220 | 3300046535 | Bacteria | 3840 |
| 673 | Ga0495586_0408683 | 3300046535 | Bacteria | 781 |
| 674 | Ga0495586_0515198 | 3300046535 | Bacteria | 690 |
| 675 | Ga0495586_0589816 | 3300046535 | Bacteria | 642 |
| 676 | Ga0495587_0143157 | 3300046536 | Unclassified | 1364 |
| 677 | Ga0495587_0241645 | 3300046536 | Bacteria | 1016 |
| 678 | Ga0495645_0104520 | 3300046543 | Bacteria | 2011 |
| 679 | Ga0495645_0141154 | 3300046543 | Bacteria | 1680 |
| 680 | Ga0495645_0177021 | 3300046543 | Unclassified | 1464 |
| 681 | Ga0495645_0272826 | 3300046543 | Unclassified | 1116 |
| 682 | Ga0495645_0476296 | 3300046543 | Unclassified | 784 |
| 683 | Ga0495645_0952291 | 3300046543 | Bacteria | 507 |
| 684 | Ga0495622_0018207 | 3300046557 | Bacteria | 3271 |
| 685 | Ga0495667_0028304 | 3300046559 | Bacteria | 3773 |
| 686 | Ga0495667_0079216 | 3300046559 | Bacteria | 2136 |
| 687 | Ga0495667_0088801 | 3300046559 | Bacteria | 2004 |
| 688 | Ga0495667_0520563 | 3300046559 | Unclassified | 744 |
| 689 | Ga0495656_0687249 | 3300046615 | Bacteria | 550 |
| 690 | Ga0495634_0001834 | 3300046642 | Bacteria | 18343 |
| 691 | Ga0495634_0013425 | 3300046642 | Bacteria | 5918 |
| 692 | Ga0495634_0029829 | 3300046642 | Unclassified | 3773 |
| 693 | Ga0495634_0144530 | 3300046642 | Unclassified | 1508 |
| 694 | Ga0495635_0537201 | 3300046663 | Unclassified | 767 |
| 695 | Ga0495659_0498297 | 3300046664 | Bacteria | 534 |
| 696 | Ga0495588_0419959 | 3300046674 | Unclassified | 702 |
| 697 | Ga0495657_0397304 | 3300046675 | Unclassified | 812 |
| 698 | Ga0495599_0076338 | 3300046678 | Bacteria | 2092 |
| 699 | Ga0495599_0558560 | 3300046678 | Bacteria | 670 |
| 700 | Ga0495599_0881717 | 3300046678 | Bacteria | 508 |
| 701 | Ga0495646_0083348 | 3300046680 | Bacteria | 1859 |
| 702 | Ga0495646_0127542 | 3300046680 | Bacteria | 1435 |
| 703 | Ga0495647_0026574 | 3300046681 | Bacteria | 2122 |
| 704 | Ga0495647_0329743 | 3300046681 | Bacteria | 692 |
| 705 | Ga0495658_0004832 | 3300046683 | Bacteria | 6611 |
| 706 | Ga0495658_0111329 | 3300046683 | Bacteria | 1646 |
| 707 | Ga0495658_0646287 | 3300046683 | Unclassified | 677 |
| 708 | Ga0495658_0779168 | 3300046683 | Bacteria | 612 |
| 709 | Ga0495658_1070374 | 3300046683 | Unclassified | 514 |
| 710 | Ga0495669_0510759 | 3300046684 | Unclassified | 584 |
| 711 | Ga0495613_0001229 | 3300046689 | Bacteria | 19576 |
| 712 | Ga0495613_0022793 | 3300046689 | Bacteria | 4666 |
| 713 | Ga0495613_0075353 | 3300046689 | Unclassified | 2456 |
| 714 | Ga0495613_0413463 | 3300046689 | Unclassified | 919 |
| 715 | Ga0495613_0825739 | 3300046689 | Bacteria | 604 |
| 716 | Ga0495624_0076883 | 3300046690 | Bacteria | 2071 |
| 717 | Ga0495624_0915279 | 3300046690 | Unclassified | 516 |
| 718 | Ga0495600_0196028 | 3300046809 | Bacteria | 1298 |
| 719 | Ga0495581_0134909 | 3300047315 | Bacteria | 1439 |
| 720 | Ga0495581_0206184 | 3300047315 | Bacteria | 1150 |
| 721 | Ga0495581_0277114 | 3300047315 | Bacteria | 980 |
| 722 | Ga0495581_0279667 | 3300047315 | Bacteria | 976 |
| 723 | Ga0495581_0897648 | 3300047315 | Bacteria | 506 |
| 724 | Ga0495604_0414836 | 3300047317 | Bacteria | 885 |
| 725 | Ga0495604_0494594 | 3300047317 | Unclassified | 794 |
| 726 | Ga0495604_0727532 | 3300047317 | Bacteria | 629 |
| 727 | Ga0495604_0755529 | 3300047317 | Bacteria | 615 |
| 728 | Ga0495674_0000893 | 3300047319 | Bacteria | 28550 |
| 729 | Ga0495674_0380454 | 3300047319 | Unclassified | 1142 |
| 730 | Ga0495674_1132499 | 3300047319 | Unclassified | 594 |
| 731 | Ga0495676_0098712 | 3300047321 | Bacteria | 2166 |
| 732 | Ga0495676_0199887 | 3300047321 | Bacteria | 1389 |
| 733 | Ga0495680_0005511 | 3300047322 | Bacteria | 11887 |
| 734 | Ga0495680_0288908 | 3300047322 | Unclassified | 1154 |
| 735 | Ga0495680_0592973 | 3300047322 | Unclassified | 742 |
| 736 | Ga0495683_0197224 | 3300047323 | Bacteria | 910 |
| 737 | Ga0495675_0016595 | 3300047444 | Bacteria | 4659 |
| 738 | Ga0495675_0291933 | 3300047444 | Bacteria | 970 |
| 739 | Ga0495675_0570108 | 3300047444 | Unclassified | 644 |
| 740 | Ga0495675_0765763 | 3300047444 | Unclassified | 536 |
| 741 | Ga0495684_0224674 | 3300047471 | Bacteria | 1375 |
| 742 | Ga0495684_0264697 | 3300047471 | Bacteria | 1246 |
| 743 | Ga0495684_0512520 | 3300047471 | Unclassified | 823 |
| 744 | Ga0495602_0760648 | 3300048088 | Bacteria | 653 |
| 745 | Ga0495614_0094310 | 3300048089 | Bacteria | 1304 |
| 746 | Ga0496101_0417748 | 3300048904 | Bacteria | 1057 |
| 747 | Ga0496102_1503299 | 3300048905 | Bacteria | 592 |
| 748 | Ga0496107_0079500 | 3300048910 | Bacteria | 2390 |
| 749 | Ga0496111_0264976 | 3300048914 | Bacteria | 1275 |
| 750 | Ga0496115_0008782 | 3300048918 | Bacteria | 7491 |
| 751 | Ga0501310_048925 | 3300049130 | Bacteria | 607 |
| 752 | Ga0501312_039381 | 3300049528 | Unclassified | 768 |
| 753 | Ga0501323_044494 | 3300049539 | Unclassified | 659 |
| 754 | Ga0501031_0000004 | 3300049568 | Bacteria | 202781 |
| 755 | Ga0501032_0003532 | 3300049569 | Bacteria | 11929 |
| 756 | Ga0501033_0000212 | 3300049570 | Bacteria | 55695 |
| 757 | Ga0501033_0059670 | 3300049570 | Bacteria | 2817 |
| 758 | Ga0501033_0415284 | 3300049570 | Bacteria | 937 |
| 759 | Ga0501034_0273207 | 3300049571 | Bacteria | 1631 |
| 760 | Ga0501034_0328613 | 3300049571 | Bacteria | 1461 |
| 761 | Ga0501034_0615071 | 3300049571 | Bacteria | 991 |
| 762 | Ga0501036_0207560 | 3300049572 | Bacteria | 1647 |
| 763 | Ga0501036_0216650 | 3300049572 | Bacteria | 1608 |
| 764 | Ga0501036_0225793 | 3300049572 | Bacteria | 1572 |
| 765 | Ga0501037_1067374 | 3300049573 | Bacteria | 524 |
| 766 | Ga0501038_0294757 | 3300049574 | Bacteria | 1274 |
| 767 | Ga0501039_0190015 | 3300049575 | Bacteria | 1615 |
| 768 | Ga0501039_0733260 | 3300049575 | Bacteria | 772 |
| 769 | Ga0501043_0108786 | 3300049579 | Bacteria | 2177 |
| 770 | Ga0501043_0849653 | 3300049579 | Bacteria | 657 |
| 771 | Ga0501046_0190002 | 3300049580 | Bacteria | 1532 |
| 772 | Ga0501046_0690433 | 3300049580 | Bacteria | 720 |
| 773 | Ga0501047_0673740 | 3300049581 | Bacteria | 853 |
| 774 | Ga0501047_0822310 | 3300049581 | Bacteria | 743 |
| 775 | Ga0501047_1047185 | 3300049581 | Unclassified | 629 |
| 776 | Ga0501239_028619 | 3300049672 | Bacteria | 721 |
| 777 | Ga0501080_0495742 | 3300049742 | Bacteria | 1092 |
| 778 | Ga0501080_1346085 | 3300049742 | Bacteria | 610 |
| 779 | Ga0501083_0559525 | 3300049744 | Unclassified | 744 |
| 780 | Ga0501035_0002904 | 3300049822 | Bacteria | 16500 |
| 781 | Ga0501035_0032128 | 3300049822 | Unclassified | 4777 |
| 782 | Ga0501035_0987901 | 3300049822 | Bacteria | 662 |
| 783 | Ga0501044_0000024 | 3300049823 | Bacteria | 194302 |
| 784 | Ga0501044_0030760 | 3300049823 | Bacteria | 5655 |
| 785 | Ga0501044_0811392 | 3300049823 | Bacteria | 814 |
| 786 | nmdc:mga05p37_408903_c1 | 3300050507 | Bacteria | 1582 |
| 787 | nmdc:mga05p37_864718_c1 | 3300050507 | Bacteria | 980 |
| 788 | nmdc:mga09592_1090926_c1 | 3300050508 | Unclassified | 664 |
| 789 | nmdc:mga09592_861884_c1 | 3300050508 | Bacteria | 763 |
| 790 | nmdc:mga0qj67_1232995_c1 | 3300050509 | Unclassified | 581 |
| 791 | nmdc:mga06r32_126147_c1 | 3300050510 | Bacteria | 2528 |
| 792 | nmdc:mga06r32_413116_c1 | 3300050510 | Unclassified | 1331 |
| 793 | nmdc:mga08y16_471682_c1 | 3300050511 | Unclassified | 1278 |
| 794 | nmdc:mga08y16_48884_c1 | 3300050511 | Unclassified | 4426 |
| 795 | nmdc:mga08y16_5086_c1 | 3300050511 | Bacteria | 13746 |
| 796 | nmdc:mga08y16_510012_c1 | 3300050511 | Bacteria | 1221 |
| 797 | nmdc:mga08y16_98604_c1 | 3300050511 | Bacteria | 3043 |
| 798 | nmdc:mga0n895_1480916_c1 | 3300050512 | Bacteria | 645 |
| 799 | nmdc:mga0n895_1541018_c1 | 3300050512 | Unclassified | 630 |
| 800 | nmdc:mga0n895_2114719_c1 | 3300050512 | Bacteria | 519 |
| 801 | nmdc:mga0n895_865149_c1 | 3300050512 | Bacteria | 891 |
| 802 | nmdc:mga0rr50_1626617_c1 | 3300050513 | Unclassified | 545 |
| 803 | nmdc:mga0rr50_1678816_c1 | 3300050513 | Unclassified | 535 |
| 804 | nmdc:mga0rr50_542674_c1 | 3300050513 | Unclassified | 990 |
| 805 | nmdc:mga08x19_479653_c1 | 3300050514 | Unclassified | 877 |
| 806 | nmdc:mga0a205_636554_c1 | 3300050515 | Unclassified | 918 |
| 807 | nmdc:mga0a205_997176_c1 | 3300050515 | Bacteria | 684 |
| 808 | Ga0495601_0156116 | 3300053077 | Unclassified | 1490 |
| 809 | Ga0500636_0019369 | 3300053177 | Bacteria | 4028 |
| 810 | Ga0587066_050738 | 3300059490 | Bacteria | 816 |
| 811 | Ga0587092_058943 | 3300059512 | Bacteria | 714 |
| 812 | Ga0587109_113762 | 3300059624 | Bacteria | 635 |
| 813 | Ga0587075_062277 | 3300059644 | Bacteria | 675 |
| 814 | Ga0587079_252238 | 3300059647 | Bacteria | 503 |
| 815 | Ga0466962_0220335 | 3300061719 | Bacteria | 929 |
| 816 | Ga0075428_101593708 | |||
| 817 | JGI26145J50221_1009864 | |||
| 818 | Ga0065707_10238720 | |||
| 819 | Ga0070658_10116558 | |||
| 820 | Ga0070658_10607157 | |||
| 821 | Ga0070658_11409434 | |||
| 822 | Ga0070683_100807062 | |||
| 823 | Ga0070683_101007885 | |||
| 824 | Ga0070683_102267492 | |||
| 825 | Ga0070690_100586380 | |||
| 826 | Ga0068869_100548325 | |||
| 827 | Ga0068869_100596781 | |||
| 828 | Ga0070680_100333819 | |||
| 829 | Ga0070680_100666808 | |||
| 830 | Ga0068868_100564397 | |||
| 831 | Ga0068868_101039436 | |||
| 832 | Ga0068868_102069211 | |||
| 833 | Ga0070660_100052070 | |||
| 834 | Ga0070689_100002628 | |||
| 835 | Ga0070689_100059599 | |||
| 836 | Ga0070689_100272150 | |||
| 837 | Ga0070689_100426252 | |||
| 838 | Ga0070689_100680191 | |||
| 839 | Ga0070689_101365142 | |||
| 840 | Ga0070689_101624635 | |||
| 841 | Ga0070691_10405975 | |||
| 842 | Ga0070691_10897848 | |||
| 843 | Ga0070687_100158841 | |||
| 844 | Ga0070687_100463855 | |||
| 845 | Ga0070661_100357840 | |||
| 846 | Ga0070661_100459602 | |||
| 847 | Ga0070692_10415497 | |||
| 848 | Ga0070668_100150488 | |||
| 849 | Ga0070669_100376261 | |||
| 850 | Ga0070675_100064748 | |||
| 851 | Ga0070671_100378459 | |||
| 852 | Ga0070674_100179140 | |||
| 853 | Ga0070688_100036939 | |||
| 854 | Ga0070659_100174500 | |||
| 855 | Ga0070659_100453115 | |||
| 856 | Ga0070659_100932418 | |||
| 857 | Ga0070667_100266794 | |||
| 858 | Ga0070667_101847728 | |||
| 859 | Ga0070703_10484150 | |||
| 860 | Ga0070714_100013741 | |||
| 861 | Ga0070714_100394148 | |||
| 862 | Ga0070714_102350836 | |||
| 863 | Ga0070713_100017222 | |||
| 864 | Ga0070713_100423363 | |||
| 865 | Ga0070713_100867665 | |||
| 866 | Ga0070710_10191423 | |||
| 867 | Ga0070701_10052677 | |||
| 868 | Ga0070701_10692980 | |||
| 869 | Ga0070701_10964352 | |||
| 870 | Ga0070711_100033987 | |||
| 871 | Ga0070711_100228833 | |||
| 872 | Ga0070711_100234795 | |||
| 873 | Ga0070700_100060780 | |||
| 874 | Ga0070694_100409466 | |||
| 875 | Ga0070694_100574506 | |||
| 876 | Ga0070694_100975180 | |||
| 877 | Ga0070694_101117618 | |||
| 878 | Ga0070708_100290653 | |||
| 879 | Ga0070662_100125091 | |||
| 880 | Ga0070681_10096362 | |||
| 881 | Ga0070681_10408656 | |||
| 882 | Ga0070681_10725791 | |||
| 883 | Ga0070681_10897796 | |||
| 884 | Ga0070681_11280522 | |||
| 885 | Ga0068867_101111306 | |||
| 886 | Ga0068867_101440615 | |||
| 887 | Ga0070685_10080142 | |||
| 888 | Ga0070685_10577736 | |||
| 889 | Ga0070685_11091053 | |||
| 890 | Ga0070707_100737491 | |||
| 891 | Ga0070679_100111689 | |||
| 892 | Ga0070679_100153177 | |||
| 893 | Ga0070684_100233653 | |||
| 894 | Ga0070684_100753254 | |||
| 895 | Ga0070684_101230921 | |||
| 896 | Ga0068853_100925426 | |||
| 897 | Ga0068853_101241975 | |||
| 898 | Ga0070672_100079779 | |||
| 899 | Ga0070686_100037438 | |||
| 900 | Ga0070686_100055517 | |||
| 901 | Ga0070686_100638655 | |||
| 902 | Ga0070686_101348648 | |||
| 903 | Ga0070686_101631663 | |||
| 904 | Ga0070686_101922060 | |||
| 905 | Ga0070695_100719485 | |||
| 906 | Ga0070696_100002260 | |||
| 907 | Ga0070696_101188673 | |||
| 908 | Ga0070696_101864530 | |||
| 909 | Ga0070693_100117278 | |||
| 910 | Ga0070693_101277602 | |||
| 911 | Ga0070704_100018152 | |||
| 912 | Ga0070704_100961706 | |||
| 913 | Ga0068855_100121181 | |||
| 914 | Ga0068855_100179188 | |||
| 915 | Ga0068855_100576436 | |||
| 916 | Ga0070664_100487782 | |||
| 917 | Ga0068857_100192877 | |||
| 918 | Ga0068857_100795923 | |||
| 919 | Ga0068857_100798430 | |||
| 920 | Ga0068857_102047102 | |||
| 921 | Ga0068854_100968037 | |||
| 922 | Ga0068856_100000333 | |||
| 923 | Ga0068856_100023624 | |||
| 924 | Ga0068856_100854797 | |||
| 925 | Ga0068856_101375518 | |||
| 926 | Ga0068856_102608359 | |||
| 927 | Ga0070702_100300392 | |||
| 928 | Ga0070702_100437744 | |||
| 929 | Ga0070702_101412786 | |||
| 930 | Ga0070702_101757066 | |||
| 931 | Ga0068852_100931109 | |||
| 932 | Ga0068852_101095378 | |||
| 933 | Ga0068859_100004959 | |||
| 934 | Ga0068859_100139020 | |||
| 935 | Ga0068859_100927605 | |||
| 936 | Ga0068859_101658710 | |||
| 937 | Ga0068859_102446850 | |||
| 938 | Ga0068864_100063696 | |||
| 939 | Ga0068864_100701211 | |||
| 940 | Ga0068864_100889844 | |||
| 941 | Ga0068864_101921568 | |||
| 942 | Ga0068864_102661788 | |||
| 943 | Ga0068861_100759043 | |||
| 944 | Ga0068861_101383095 | |||
| 945 | Ga0068861_102188067 | |||
| 946 | Ga0068861_102202981 | |||
| 947 | Ga0068851_10397127 | |||
| 948 | Ga0068851_10720974 | |||
| 949 | Ga0068863_100008630 | |||
| 950 | Ga0068863_100084221 | |||
| 951 | Ga0068863_100292416 | |||
| 952 | Ga0068863_100417521 | |||
| 953 | Ga0068863_101616786 | |||
| 954 | Ga0068863_101617628 | |||
| 955 | Ga0068858_100479568 | |||
| 956 | Ga0068858_100724832 | |||
| 957 | Ga0068860_100962671 | |||
| 958 | Ga0081455_10063110 | |||
| 959 | Ga0070716_100127312 | |||
| 960 | Ga0070712_100232344 | |||
| 961 | Ga0070712_100440067 | |||
| 962 | Ga0070712_100502228 | |||
| 963 | Ga0070712_101303974 | |||
| 964 | Ga0097621_100801967 | |||
| 965 | Ga0097621_101831803 | |||
| 966 | Ga0068871_100475699 | |||
| 967 | Ga0068871_101057368 | |||
| 968 | Ga0068871_101323069 | |||
| 969 | Ga0068871_102257318 | |||
| 970 | Ga0075428_100006818 | |||
| 971 | Ga0075428_100086404 | |||
| 972 | Ga0075428_100861661 | |||
| 973 | Ga0075428_100944744 | |||
| 974 | Ga0075430_100772963 | |||
| 975 | Ga0075431_100234992 | |||
| 976 | Ga0075431_100566964 | |||
| 977 | Ga0075433_11001944 | |||
| 978 | Ga0075434_100896515 | |||
| 979 | Ga0075434_100965968 | |||
| 980 | Ga0075434_101426855 | |||
| 981 | Ga0075434_101738840 | |||
| 982 | Ga0068865_100585338 | |||
| 983 | Ga0075436_100447533 | |||
| 984 | Ga0075436_100502456 | |||
| 985 | Ga0075436_100747422 | |||
| 986 | Ga0075436_101523610 | |||
| 987 | Ga0097620_100004959 | |||
| 988 | Ga0097620_100139020 | |||
| 989 | Ga0097620_100927579 | |||
| 990 | Ga0097620_101658190 | |||
| 991 | Ga0097620_102447691 | |||
| 992 | Ga0075435_100078589 | |||
| 993 | Ga0075435_100524012 | |||
| 994 | Ga0075435_101146329 | |||
| 995 | Ga0099794_10188183 | |||
| 996 | Ga0099794_10439374 | |||
| 997 | Ga0099795_10118406 | |||
| 998 | Ga0105240_10000711 | |||
| 999 | Ga0105240_10041167 | |||
| 1000 | Ga0105240_10093999 | |||
| 1001 | Ga0105240_10146774 | |||
| 1002 | Ga0105240_10211357 | |||
| 1003 | Ga0105240_10316106 | |||
| 1004 | Ga0105240_10907929 | |||
| 1005 | Ga0105240_12365030 | |||
| 1006 | Ga0111539_10143389 | |||
| 1007 | Ga0111539_10147752 | |||
| 1008 | Ga0111539_10199190 | |||
| 1009 | Ga0111539_10247244 | |||
| 1010 | Ga0111539_10293584 | |||
| 1011 | Ga0111539_10415521 | |||
| 1012 | Ga0111539_10434634 | |||
| 1013 | Ga0111539_11187519 | |||
| 1014 | Ga0111539_11931963 | |||
| 1015 | Ga0105245_10843129 | |||
| 1016 | Ga0105245_12618231 | |||
| 1017 | Ga0105245_13272360 | |||
| 1018 | Ga0114129_10308395 | |||
| 1019 | Ga0114129_11150348 | |||
| 1020 | Ga0105243_11284138 | |||
| 1021 | Ga0105243_12224788 | |||
| 1022 | Ga0105241_10264853 | |||
| 1023 | Ga0105242_10049696 | |||
| 1024 | Ga0105242_10096426 | |||
| 1025 | Ga0105242_11706116 | |||
| 1026 | Ga0105248_10002679 | |||
| 1027 | Ga0105248_10287924 | |||
| 1028 | Ga0105248_10696089 | |||
| 1029 | Ga0105248_10834565 | |||
| 1030 | Ga0105248_10989966 | |||
| 1031 | Ga0105248_11154305 | |||
| 1032 | Ga0105248_13050859 | |||
| 1033 | Ga0105237_10377154 | |||
| 1034 | Ga0105237_11522772 | |||
| 1035 | Ga0105238_10009790 | |||
| 1036 | Ga0105238_10029677 | |||
| 1037 | Ga0105238_10078731 | |||
| 1038 | Ga0105238_10219669 | |||
| 1039 | Ga0105238_10489331 | |||
| 1040 | Ga0105238_10820404 | |||
| 1041 | Ga0105238_12366700 | |||
| 1042 | Ga0105249_10600692 | |||
| 1043 | Ga0105249_12308474 | |||
| 1044 | Ga0105239_10151904 | |||
| 1045 | Ga0105239_12197316 | |||
| 1046 | Ga0105246_11171745 | |||
| 1047 | Ga0157373_10255114 | |||
| 1048 | Ga0157373_10332625 | |||
| 1049 | Ga0157370_10067916 | |||
| 1050 | Ga0157370_10274932 | |||
| 1051 | Ga0157370_10309732 | |||
| 1052 | Ga0157370_10689703 | |||
| 1053 | Ga0157369_10732018 | |||
| 1054 | Ga0157369_11372755 | |||
| 1055 | Ga0157369_11894006 | |||
| 1056 | Ga0157374_10131416 | |||
| 1057 | Ga0157374_11144739 | |||
| 1058 | Ga0157374_11271070 | |||
| 1059 | Ga0157378_10316020 | |||
| 1060 | Ga0157378_10665928 | |||
| 1061 | Ga0157378_10729749 | |||
| 1062 | Ga0157378_10862590 | |||
| 1063 | Ga0157378_12477267 | |||
| 1064 | Ga0157378_12676642 | |||
| 1065 | Ga0163162_10296440 | |||
| 1066 | Ga0163162_11789026 | |||
| 1067 | Ga0157372_10012520 | |||
| 1068 | Ga0157372_10039202 | |||
| 1069 | Ga0157372_10292207 | |||
| 1070 | Ga0157372_10786642 | |||
| 1071 | Ga0157372_11114440 | |||
| 1072 | Ga0157375_10000036 | |||
| 1073 | Ga0157375_10624566 | |||
| 1074 | Ga0157375_11308405 | |||
| 1075 | Ga0163163_10000067 | |||
| 1076 | Ga0163163_10040992 | |||
| 1077 | Ga0163163_10300912 | |||
| 1078 | Ga0163163_11559779 | |||
| 1079 | Ga0157380_10801447 | |||
| 1080 | Ga0157380_11040558 | |||
| 1081 | Ga0157380_11557827 | |||
| 1082 | Ga0157379_10086226 | |||
| 1083 | Ga0157379_10123194 | |||
| 1084 | Ga0157376_10296121 | |||
| 1085 | Ga0157376_12784382 | |||
| 1086 | Ga0163161_11787587 | |||
| 1087 | Ga0206356_11283718 | |||
| 1088 | Ga0206353_10613002 | |||
| 1089 | Ga0207656_10502415 | |||
| 1090 | Ga0207692_10030925 | |||
| 1091 | Ga0207688_10203079 | |||
| 1092 | Ga0207699_10012821 | |||
| 1093 | Ga0207645_10680784 | |||
| 1094 | Ga0207705_10560376 | |||
| 1095 | Ga0207684_10838610 | |||
| 1096 | Ga0207654_10370300 | |||
| 1097 | Ga0207707_10163771 | |||
| 1098 | Ga0207695_10001486 | |||
| 1099 | Ga0207695_10039795 | |||
| 1100 | Ga0207695_10115378 | |||
| 1101 | Ga0207695_10191605 | |||
| 1102 | Ga0207695_10229821 | |||
| 1103 | Ga0207695_10265970 | |||
| 1104 | Ga0207695_11265214 | |||
| 1105 | Ga0207671_10325858 | |||
| 1106 | Ga0207671_11391612 | |||
| 1107 | Ga0207693_10153434 | |||
| 1108 | Ga0207693_10916670 | |||
| 1109 | Ga0207663_10014922 | |||
| 1110 | Ga0207663_10090826 | |||
| 1111 | Ga0207663_11289515 | |||
| 1112 | Ga0207660_10431121 | |||
| 1113 | Ga0207660_10841745 | |||
| 1114 | Ga0207662_10103009 | |||
| 1115 | Ga0207662_10361414 | |||
| 1116 | Ga0207662_10854118 | |||
| 1117 | Ga0207657_10050715 | |||
| 1118 | Ga0207649_10276577 | |||
| 1119 | Ga0207649_10599038 | |||
| 1120 | Ga0207652_10032134 | |||
| 1121 | Ga0207652_10187267 | |||
| 1122 | Ga0207652_11282099 | |||
| 1123 | Ga0207646_10171037 | |||
| 1124 | Ga0207646_10983970 | |||
| 1125 | Ga0207646_11172765 | |||
| 1126 | Ga0207694_10020783 | |||
| 1127 | Ga0207694_10025236 | |||
| 1128 | Ga0207694_10215584 | |||
| 1129 | Ga0207694_10421574 | |||
| 1130 | Ga0207694_10792113 | |||
| 1131 | Ga0207659_10603627 | |||
| 1132 | Ga0207687_10367058 | |||
| 1133 | Ga0207687_11593944 | |||
| 1134 | Ga0207700_10019165 | |||
| 1135 | Ga0207700_10528860 | |||
| 1136 | Ga0207700_11405544 | |||
| 1137 | Ga0207664_10002691 | |||
| 1138 | Ga0207664_10006289 | |||
| 1139 | Ga0207644_10315241 | |||
| 1140 | Ga0207690_10065204 | |||
| 1141 | Ga0207690_10273171 | |||
| 1142 | Ga0207706_10050263 | |||
| 1143 | Ga0207686_10053853 | |||
| 1144 | Ga0207686_10156519 | |||
| 1145 | Ga0207686_10793290 | |||
| 1146 | Ga0207670_10010394 | |||
| 1147 | Ga0207670_10038951 | |||
| 1148 | Ga0207670_10081443 | |||
| 1149 | Ga0207670_10150737 | |||
| 1150 | Ga0207670_10441721 | |||
| 1151 | Ga0207670_10491130 | |||
| 1152 | Ga0207669_10614490 | |||
| 1153 | Ga0207669_10994970 | |||
| 1154 | Ga0207665_10305913 | |||
| 1155 | Ga0207665_11025648 | |||
| 1156 | Ga0207665_11503111 | |||
| 1157 | Ga0207691_10486771 | |||
| 1158 | Ga0207691_11377780 | |||
| 1159 | Ga0207711_10011291 | |||
| 1160 | Ga0207689_10738908 | |||
| 1161 | Ga0207689_11218347 | |||
| 1162 | Ga0207661_10304455 | |||
| 1163 | Ga0207661_10606791 | |||
| 1164 | Ga0207679_11651340 | |||
| 1165 | Ga0207667_10023109 | |||
| 1166 | Ga0207667_10203627 | |||
| 1167 | Ga0207667_10245694 | |||
| 1168 | Ga0207667_10349173 | |||
| 1169 | Ga0207667_10988737 | |||
| 1170 | Ga0207651_11938690 | |||
| 1171 | Ga0207712_12113299 | |||
| 1172 | Ga0207668_11306736 | |||
| 1173 | Ga0207658_11076035 | |||
| 1174 | Ga0207658_11473376 | |||
| 1175 | Ga0207677_10270475 | |||
| 1176 | Ga0207677_12024613 | |||
| 1177 | Ga0207703_11444908 | |||
| 1178 | Ga0207639_12076209 | |||
| 1179 | Ga0207678_11201319 | |||
| 1180 | Ga0207678_11768408 | |||
| 1181 | Ga0207708_10274832 | |||
| 1182 | Ga0207708_10795981 | |||
| 1183 | Ga0207702_10000259 | |||
| 1184 | Ga0207702_10042210 | |||
| 1185 | Ga0207702_10130463 | |||
| 1186 | Ga0207702_10788911 | |||
| 1187 | Ga0207702_10991150 | |||
| 1188 | Ga0207702_11268878 | |||
| 1189 | Ga0207702_12232551 | |||
| 1190 | Ga0207702_12493069 | |||
| 1191 | Ga0207641_10482099 | |||
| 1192 | Ga0207641_11025422 | |||
| 1193 | Ga0207641_11935646 | |||
| 1194 | Ga0207641_12053081 | |||
| 1195 | Ga0207648_10253690 | |||
| 1196 | Ga0207648_10405020 | |||
| 1197 | Ga0207648_10408174 | |||
| 1198 | Ga0207648_11808391 | |||
| 1199 | Ga0207676_10138522 | |||
| 1200 | Ga0207676_11174478 | |||
| 1201 | Ga0207674_10648540 | |||
| 1202 | Ga0207674_10749364 | |||
| 1203 | Ga0207674_11269318 | |||
| 1204 | Ga0207674_11280648 | |||
| 1205 | Ga0207675_100190917 | |||
| 1206 | Ga0207675_100612160 | |||
| 1207 | Ga0207675_101428885 | |||
| 1208 | Ga0207698_10292264 | |||
| 1209 | Ga0207698_11076212 | |||
| 1210 | Ga0209981_1006505 | |||
| 1211 | Ga0209984_1033594 | |||
| 1212 | Ga0210000_1002922 | |||
| 1213 | Ga0209999_1012191 | |||
| 1214 | Ga0209982_1010399 | |||
| 1215 | Ga0209983_1001526 | |||
| 1216 | Ga0209971_1006080 | |||
| 1217 | Ga0209974_10002416 | |||
| 1218 | Ga0207428_10113363 | |||
| 1219 | Ga0207428_10448079 | |||
| 1220 | Ga0207428_10747964 | |||
| 1221 | Ga0268264_10809127 | |||
| 1222 | Ga0268264_11702785 | |||
| 1223 | Ga0265337_1000269 | |||
| 1224 | Ga0265337_1006463 | |||
| 1225 | Ga0265337_1009750 | |||
| 1226 | Ga0265337_1014485 | |||
| 1227 | Ga0265337_1047643 | |||
| 1228 | Ga0265326_10002061 | |||
| 1229 | Ga0265326_10026223 | |||
| 1230 | Ga0265326_10029103 | |||
| 1231 | Ga0265326_10046844 | |||
| 1232 | Ga0265319_1000001 | |||
| 1233 | Ga0265319_1015923 | |||
| 1234 | Ga0265319_1085928 | |||
| 1235 | Ga0265334_10017859 | |||
| 1236 | Ga0265334_10031370 | |||
| 1237 | Ga0265334_10191869 | |||
| 1238 | Ga0265318_10122269 | |||
| 1239 | Ga0265318_10140535 | |||
| 1240 | Ga0265318_10147194 | |||
| 1241 | Ga0265323_10001379 | |||
| 1242 | Ga0265323_10016104 | |||
| 1243 | Ga0265322_10015098 | |||
| 1244 | Ga0265322_10042408 | |||
| 1245 | Ga0265322_10254084 | |||
| 1246 | Ga0265336_10000586 | |||
| 1247 | Ga0265336_10037892 | |||
| 1248 | Ga0265336_10075819 | |||
| 1249 | Ga0265336_10101511 | |||
| 1250 | Ga0265336_10162811 | |||
| 1251 | Ga0265336_10210789 | |||
| 1252 | Ga0265338_10000030 | |||
| 1253 | Ga0265338_10000032 | |||
| 1254 | Ga0265338_10000041 | |||
| 1255 | Ga0265338_10001233 | |||
| 1256 | Ga0265338_10002413 | |||
| 1257 | Ga0265338_10002424 | |||
| 1258 | Ga0265338_10005324 | |||
| 1259 | Ga0265338_10007470 | |||
| 1260 | Ga0265338_10010884 | |||
| 1261 | Ga0265338_10011620 | |||
| 1262 | Ga0265338_10012697 | |||
| 1263 | Ga0265338_10026423 | |||
| 1264 | Ga0265338_10035706 | |||
| 1265 | Ga0265338_10039538 | |||
| 1266 | Ga0265338_10061058 | |||
| 1267 | Ga0265338_10096938 | |||
| 1268 | Ga0265338_10097818 | |||
| 1269 | Ga0265338_10116705 | |||
| 1270 | Ga0265338_10167914 | |||
| 1271 | Ga0265338_10175173 | |||
| 1272 | Ga0265338_10183037 | |||
| 1273 | Ga0265338_10584372 | |||
| 1274 | Ga0265338_10648725 | |||
| 1275 | Ga0265338_10850002 | |||
| 1276 | Ga0265338_11142333 | |||
| 1277 | Ga0265324_10012004 | |||
| 1278 | Ga0265324_10022204 | |||
| 1279 | Ga0265324_10026322 | |||
| 1280 | Ga0265324_10033066 | |||
| 1281 | Ga0265324_10033947 | |||
| 1282 | Ga0265324_10043437 | |||
| 1283 | Ga0265324_10068622 | |||
| 1284 | Ga0265324_10087808 | |||
| 1285 | Ga0265324_10113975 | |||
| 1286 | Ga0265324_10268554 | |||
| 1287 | Ga0265760_10209941 | |||
| 1288 | Ga0265332_10045477 | |||
| 1289 | Ga0265332_10184899 | |||
| 1290 | Ga0265328_10016270 | |||
| 1291 | Ga0265320_10000939 | |||
| 1292 | Ga0265320_10007536 | |||
| 1293 | Ga0265320_10027370 | |||
| 1294 | Ga0265320_10037960 | |||
| 1295 | Ga0265320_10169710 | |||
| 1296 | Ga0265320_10281760 | |||
| 1297 | Ga0265320_10290504 | |||
| 1298 | Ga0265320_10546532 | |||
| 1299 | Ga0265325_10041915 | |||
| 1300 | Ga0265325_10089147 | |||
| 1301 | Ga0265329_10002621 | |||
| 1302 | Ga0265329_10056518 | |||
| 1303 | Ga0265340_10000417 | |||
| 1304 | Ga0265340_10015340 | |||
| 1305 | Ga0265340_10341831 | |||
| 1306 | Ga0265340_10434803 | |||
| 1307 | Ga0265339_10118633 | |||
| 1308 | Ga0265339_10496491 | |||
| 1309 | Ga0265339_10538592 | |||
| 1310 | Ga0265331_10088866 | |||
| 1311 | Ga0265331_10422242 | |||
| 1312 | Ga0265331_10427167 | |||
| 1313 | Ga0265327_10000379 | |||
| 1314 | Ga0265327_10003825 | |||
| 1315 | Ga0265327_10055436 | |||
| 1316 | Ga0265327_10276771 | |||
| 1317 | Ga0265316_10002569 | |||
| 1318 | Ga0265316_10009532 | |||
| 1319 | Ga0265316_10179213 | |||
| 1320 | Ga0265316_10205380 | |||
| 1321 | Ga0265316_10292055 | |||
| 1322 | Ga0265316_10339335 | |||
| 1323 | Ga0265316_10362513 | |||
| 1324 | Ga0265316_10881245 | |||
| 1325 | Ga0265316_10912864 | |||
| 1326 | Ga0265316_11080034 | |||
| 1327 | Ga0307513_10768336 | |||
| 1328 | Ga0265313_10000837 | |||
| 1329 | Ga0316575_10141479 | |||
| 1330 | Ga0265314_10000070 | |||
| 1331 | Ga0265314_10075416 | |||
| 1332 | Ga0265314_10272126 | |||
| 1333 | Ga0265342_10113918 | |||
| 1334 | Ga0265342_10226607 | |||
| 1335 | Ga0265342_10370617 | |||
| 1336 | Ga0265342_10595381 | |||
| 1337 | Ga0265342_10641493 | |||
| 1338 | Ga0316576_10024532 | |||
| 1339 | Ga0316578_10216970 | |||
| 1340 | Ga0316578_10599944 | |||
| 1341 | Ga0307406_11319145 | |||
| 1342 | Ga0316583_10059453 | |||
| 1343 | Ga0307510_10255979 | |||
| 1344 | Ga0316596_1146570 | |||
| 1345 | Ga0373950_0160536 | |||
| 1346 | Ga0373959_0133970 | |||
| 1347 | Ga0373926_0044445 | |||
| 1348 | Ga0373926_0144594 | |||
| 1349 | Ga0373928_0001832 | |||
| 1350 | Ga0373929_0002598 | |||
| 1351 | Ga0373944_0000243 | |||
| 1352 | Ga0373944_0004703 | |||
| 1353 | Ga0373944_0156133 | |||
| 1354 | Ga0373949_0008104 | |||
| 1355 | Ga0373951_0006156 | |||
| 1356 | Ga0373952_0176663 | |||
| 1357 | Ga0373923_0129710 | |||
| 1358 | Ga0373923_0263914 | |||
| 1359 | Ga0373932_0000003 | |||
| 1360 | Ga0373945_0030507 | |||
| 1361 | Ga0373954_0019308 | |||
| 1362 | Ga0373954_0033939 | |||
| 1363 | Ga0373954_0313055 | |||
| 1364 | Ga0373956_0052640 | |||
| 1365 | Ga0373956_0058343 | |||
| 1366 | Ga0373957_0100716 | |||
| 1367 | Ga0373943_0040802 | |||
| 1368 | Ga0373943_0156505 | |||
| 1369 | Ga0373946_0087031 | |||
| 1370 | Ga0373946_0478896 | |||
| 1371 | Ga0373955_0491452 | |||
| 1372 | Ga0373962_0000059 | |||
| 1373 | Ga0373931_0000054 | |||
| 1374 | Ga0373931_0214402 | |||
| 1375 | Ga0373931_0809671 | |||
| 1376 | Ga0373935_0049025 | |||
| 1377 | Ga0373935_0283923 | |||
| 1378 | Ga0373935_0381767 | |||
| 1379 | Ga0373927_0003514 | |||
| 1380 | Ga0373927_0065858 | |||
| 1381 | Ga0373927_0148529 | |||
| 1382 | Ga0373927_0408599 | |||
| 1383 | Ga0373927_0817518 | |||
| 1384 | Ga0373933_0079446 | |||
| 1385 | Ga0373933_0494709 | |||
| 1386 | Ga0373933_0798320 | |||
| 1387 | Ga0373947_0011605 | |||
| 1388 | Ga0373947_0098809 | |||
| 1389 | Ga0373937_0003348 | |||
| 1390 | Ga0373937_0123186 | |||
| 1391 | Ga0373937_0441780 | |||
| 1392 | Ga0373937_0447919 | |||
| 1393 | Ga0373937_0515944 | |||
| 1394 | Ga0373937_1005377 | |||
| 1395 | Ga0373937_1589040 | |||
| 1396 | Ga0316582_0822322 | |||
| 1397 | Ga0373925_0000299 | |||
| 1398 | Ga0373925_0005364 | |||
| 1399 | Ga0373925_0030220 | |||
| 1400 | Ga0373925_0938501 | |||
| 1401 | Ga0373925_1313777 | |||
| 1402 | Ga0373925_1449351 | |||
| 1403 | Ga0395905_0045482 | |||
| 1404 | Ga0395905_0184390 | |||
| 1405 | Ga0395905_0260350 | |||
| 1406 | Ga0395901_0197395 | |||
| 1407 | Ga0451804_0485622 | |||
| 1408 | Ga0451839_0481867 | |||
| 1409 | Ga0451851_0491892 | |||
| 1410 | Ga0450912_037526 | |||
| 1411 | Ga0451577_0000302 | |||
| 1412 | Ga0451577_0002102 | |||
| 1413 | Ga0451577_0047000 | |||
| 1414 | Ga0453683_0815480 | |||
| 1415 | Ga0453684_0000255 | |||
| 1416 | Ga0453684_0014376 | |||
| 1417 | Ga0453684_0295425 | |||
| 1418 | Ga0453684_2419263 | |||
| 1419 | Ga0451576_0028073 | |||
| 1420 | Ga0451576_0078450 | |||
| 1421 | Ga0451576_0098411 | |||
| 1422 | Ga0451576_0278083 | |||
| 1423 | Ga0451576_0289356 | |||
| 1424 | Ga0451576_0573757 | |||
| 1425 | Ga0451576_0618468 | |||
| 1426 | Ga0451576_0707622 | |||
| 1427 | Ga0451576_0741022 | |||
| 1428 | Ga0451576_0796110 | |||
| 1429 | Ga0451576_0813245 | |||
| 1430 | Ga0451576_0818669 | |||
| 1431 | Ga0451576_0887473 | |||
| 1432 | Ga0451576_0982660 | |||
| 1433 | Ga0451576_1077264 | |||
| 1434 | Ga0451576_1150472 | |||
| 1435 | Ga0451576_1171125 | |||
| 1436 | Ga0451576_1224609 | |||
| 1437 | Ga0451576_1687171 | |||
| 1438 | Ga0451576_2237689 | |||
| 1439 | Ga0451576_2541012 | |||
| 1440 | Ga0466958_1145143 | |||
| 1441 | Ga0495592_0104304 | |||
| 1442 | Ga0495592_0142410 | |||
| 1443 | Ga0495592_0347930 | |||
| 1444 | Ga0495629_0374433 | |||
| 1445 | Ga0495641_0013934 | |||
| 1446 | Ga0495651_0249801 | |||
| 1447 | Ga0495651_0304323 | |||
| 1448 | Ga0495653_0350351 | |||
| 1449 | Ga0495653_0857388 | |||
| 1450 | Ga0495580_0289484 | |||
| 1451 | Ga0495582_0127734 | |||
| 1452 | Ga0495582_0178275 | |||
| 1453 | Ga0495639_0236036 | |||
| 1454 | Ga0495639_0247886 | |||
| 1455 | Ga0495662_0057157 | |||
| 1456 | Ga0495662_0353147 | |||
| 1457 | Ga0495594_0511638 | |||
| 1458 | Ga0495608_0562719 | |||
| 1459 | Ga0495618_0012160 | |||
| 1460 | Ga0495618_0409083 | |||
| 1461 | Ga0495628_0216330 | |||
| 1462 | Ga0495628_0511221 | |||
| 1463 | Ga0495628_0577689 | |||
| 1464 | Ga0495628_1114512 | |||
| 1465 | Ga0495630_0000171 | |||
| 1466 | Ga0495630_0008736 | |||
| 1467 | Ga0495630_0021595 | |||
| 1468 | Ga0495630_0136328 | |||
| 1469 | Ga0495630_0159722 | |||
| 1470 | Ga0495630_0164956 | |||
| 1471 | Ga0495630_0224930 | |||
| 1472 | Ga0495630_0269163 | |||
| 1473 | Ga0495630_0348341 | |||
| 1474 | Ga0495666_0063757 | |||
| 1475 | Ga0495666_0113782 | |||
| 1476 | Ga0495666_0235280 | |||
| 1477 | Ga0495666_0352922 | |||
| 1478 | Ga0495652_0211409 | |||
| 1479 | Ga0495665_0060321 | |||
| 1480 | Ga0495665_0647992 | |||
| 1481 | Ga0495640_0024065 | |||
| 1482 | Ga0495640_0024615 | |||
| 1483 | Ga0495640_0116537 | |||
| 1484 | Ga0495640_0720718 | |||
| 1485 | Ga0495586_0000676 | |||
| 1486 | Ga0495586_0002025 | |||
| 1487 | Ga0495586_0017220 | |||
| 1488 | Ga0495586_0408683 | |||
| 1489 | Ga0495586_0515198 | |||
| 1490 | Ga0495586_0589816 | |||
| 1491 | Ga0495587_0143157 | |||
| 1492 | Ga0495587_0241645 | |||
| 1493 | Ga0495645_0104520 | |||
| 1494 | Ga0495645_0141154 | |||
| 1495 | Ga0495645_0177021 | |||
| 1496 | Ga0495645_0272826 | |||
| 1497 | Ga0495645_0476296 | |||
| 1498 | Ga0495645_0952291 | |||
| 1499 | Ga0495622_0018207 | |||
| 1500 | Ga0495667_0028304 | |||
| 1501 | Ga0495667_0079216 | |||
| 1502 | Ga0495667_0088801 | |||
| 1503 | Ga0495667_0520563 | |||
| 1504 | Ga0495656_0687249 | |||
| 1505 | Ga0495634_0001834 | |||
| 1506 | Ga0495634_0013425 | |||
| 1507 | Ga0495634_0029829 | |||
| 1508 | Ga0495634_0144530 | |||
| 1509 | Ga0495635_0537201 | |||
| 1510 | Ga0495659_0498297 | |||
| 1511 | Ga0495588_0419959 | |||
| 1512 | Ga0495657_0397304 | |||
| 1513 | Ga0495599_0076338 | |||
| 1514 | Ga0495599_0558560 | |||
| 1515 | Ga0495599_0881717 | |||
| 1516 | Ga0495646_0083348 | |||
| 1517 | Ga0495646_0127542 | |||
| 1518 | Ga0495647_0026574 | |||
| 1519 | Ga0495647_0329743 | |||
| 1520 | Ga0495658_0004832 | |||
| 1521 | Ga0495658_0111329 | |||
| 1522 | Ga0495658_0646287 | |||
| 1523 | Ga0495658_0779168 | |||
| 1524 | Ga0495658_1070374 | |||
| 1525 | Ga0495669_0510759 | |||
| 1526 | Ga0495613_0001229 | |||
| 1527 | Ga0495613_0022793 | |||
| 1528 | Ga0495613_0075353 | |||
| 1529 | Ga0495613_0413463 | |||
| 1530 | Ga0495613_0825739 | |||
| 1531 | Ga0495624_0076883 | |||
| 1532 | Ga0495624_0915279 | |||
| 1533 | Ga0495600_0196028 | |||
| 1534 | Ga0495581_0134909 | |||
| 1535 | Ga0495581_0206184 | |||
| 1536 | Ga0495581_0277114 | |||
| 1537 | Ga0495581_0279667 | |||
| 1538 | Ga0495581_0897648 | |||
| 1539 | Ga0495604_0414836 | |||
| 1540 | Ga0495604_0494594 | |||
| 1541 | Ga0495604_0727532 | |||
| 1542 | Ga0495604_0755529 | |||
| 1543 | Ga0495674_0000893 | |||
| 1544 | Ga0495674_0380454 | |||
| 1545 | Ga0495674_1132499 | |||
| 1546 | Ga0495676_0098712 | |||
| 1547 | Ga0495676_0199887 | |||
| 1548 | Ga0495680_0005511 | |||
| 1549 | Ga0495680_0288908 | |||
| 1550 | Ga0495680_0592973 | |||
| 1551 | Ga0495683_0197224 | |||
| 1552 | Ga0495675_0016595 | |||
| 1553 | Ga0495675_0291933 | |||
| 1554 | Ga0495675_0570108 | |||
| 1555 | Ga0495675_0765763 | |||
| 1556 | Ga0495684_0224674 | |||
| 1557 | Ga0495684_0264697 | |||
| 1558 | Ga0495684_0512520 | |||
| 1559 | Ga0495602_0760648 | |||
| 1560 | Ga0495614_0094310 | |||
| 1561 | Ga0496101_0417748 | |||
| 1562 | Ga0496102_1503299 | |||
| 1563 | Ga0496107_0079500 | |||
| 1564 | Ga0496111_0264976 | |||
| 1565 | Ga0496115_0008782 | |||
| 1566 | Ga0501310_048925 | |||
| 1567 | Ga0501312_039381 | |||
| 1568 | Ga0501323_044494 | |||
| 1569 | Ga0501031_0000004 | |||
| 1570 | Ga0501032_0003532 | |||
| 1571 | Ga0501033_0000212 | |||
| 1572 | Ga0501033_0059670 | |||
| 1573 | Ga0501033_0415284 | |||
| 1574 | Ga0501034_0273207 | |||
| 1575 | Ga0501034_0328613 | |||
| 1576 | Ga0501034_0615071 | |||
| 1577 | Ga0501036_0207560 | |||
| 1578 | Ga0501036_0216650 | |||
| 1579 | Ga0501036_0225793 | |||
| 1580 | Ga0501037_1067374 | |||
| 1581 | Ga0501038_0294757 | |||
| 1582 | Ga0501039_0190015 | |||
| 1583 | Ga0501039_0733260 | |||
| 1584 | Ga0501043_0108786 | |||
| 1585 | Ga0501043_0849653 | |||
| 1586 | Ga0501046_0190002 | |||
| 1587 | Ga0501046_0690433 | |||
| 1588 | Ga0501047_0673740 | |||
| 1589 | Ga0501047_0822310 | |||
| 1590 | Ga0501047_1047185 | |||
| 1591 | Ga0501239_028619 | |||
| 1592 | Ga0501080_0495742 | |||
| 1593 | Ga0501080_1346085 | |||
| 1594 | Ga0501083_0559525 | |||
| 1595 | Ga0501035_0002904 | |||
| 1596 | Ga0501035_0032128 | |||
| 1597 | Ga0501035_0987901 | |||
| 1598 | Ga0501044_0000024 | |||
| 1599 | Ga0501044_0030760 | |||
| 1600 | Ga0501044_0811392 | |||
| 1601 | nmdc:mga05p37_408903_c1 | |||
| 1602 | nmdc:mga05p37_864718_c1 | |||
| 1603 | nmdc:mga09592_1090926_c1 | |||
| 1604 | nmdc:mga09592_861884_c1 | |||
| 1605 | nmdc:mga0qj67_1232995_c1 | |||
| 1606 | nmdc:mga06r32_126147_c1 | |||
| 1607 | nmdc:mga06r32_413116_c1 | |||
| 1608 | nmdc:mga08y16_471682_c1 | |||
| 1609 | nmdc:mga08y16_48884_c1 | |||
| 1610 | nmdc:mga08y16_5086_c1 | |||
| 1611 | nmdc:mga08y16_510012_c1 | |||
| 1612 | nmdc:mga08y16_98604_c1 | |||
| 1613 | nmdc:mga0n895_1480916_c1 | |||
| 1614 | nmdc:mga0n895_1541018_c1 | |||
| 1615 | nmdc:mga0n895_2114719_c1 | |||
| 1616 | nmdc:mga0n895_865149_c1 | |||
| 1617 | nmdc:mga0rr50_1626617_c1 | |||
| 1618 | nmdc:mga0rr50_1678816_c1 | |||
| 1619 | nmdc:mga0rr50_542674_c1 | |||
| 1620 | nmdc:mga08x19_479653_c1 | |||
| 1621 | nmdc:mga0a205_636554_c1 | |||
| 1622 | nmdc:mga0a205_997176_c1 | |||
| 1623 | Ga0495601_0156116 | |||
| 1624 | Ga0500636_0019369 | |||
| 1625 | Ga0587066_050738 | |||
| 1626 | Ga0587092_058943 | |||
| 1627 | Ga0587109_113762 | |||
| 1628 | Ga0587075_062277 | |||
| 1629 | Ga0587079_252238 | |||
| 1630 | Ga0466962_0220335 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8882 | 61 | 117 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8736 | 51 | 116 |
| 2ghj-assembly1.cif.gz_A | crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 | 0.8474 | 21 | 117 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8401 | 51 | 116 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8361 | 61 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9723 | 53 | 118 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9174 | 53 | 118 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9122 | 58 | 117 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8882 | 61 | 117 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8361 | 61 | 117 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357L7L9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.006 | 61 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2D8YKH1-F1-model_v4 | deleted | 1.005 | 58 | 117 |
|
| AF-A0A7Y7CN64-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.003 | 64 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A659UR08-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.002 | 56 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A354QTS7-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.001 | 53 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |