F482014

General Info

Members Datasets Scaffolds Average Seq Length
815 469 1630 184

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10609324|Ga0163163_106093242
Length 228
Sequence MSDSKKKAGGKSPANKKQEAPKKVEGGGEGRVQSTPAKAGKAAASPAEKPRLAVVYAETIRPKLVEEFGYKNPMEVPKLTKIVINMGVGEAAGDQKKLDAAVADLTAIAGQRPVRTKAKKAIAGFKIREGQLIGCKVTLRKARMYEFLDRLVTVAMPRVRDFRGLPANKGFDGRGNFAMGMKEQIVFPEINYDRVDTVRGMDIQFVTTAKTDKEAKALLKAFQLPFQP

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
122 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
138 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
139 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
158 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
159 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
160 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
161 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
162 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
163 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
167 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
238 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
249 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
250 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
251 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
252 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
253 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
254 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
255 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
258 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
276 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
277 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
281 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
286 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
287 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
288 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
289 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
290 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
291 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
292 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
293 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
294 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
295 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
296 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
297 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
301 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
302 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
303 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
304 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
305 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
306 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
307 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
308 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
309 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
310 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
311 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
312 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
313 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
314 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
315 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
316 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
317 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
330 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
333 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
336 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
348 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
373 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
395 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
400 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
419 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
420 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
421 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
422 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
423 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
424 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
425 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
469 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.15
Metatranscriptomes 14.72
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.55
Nodule 0.37
Rhizoplane 2.33
Rhizosphere 81.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10609324 3300014325 Bacteria 1155
2 JGI24741J21665_1004572 3300001915 Bacteria 3039
3 JGI24740J21852_10000716 3300001979 Bacteria 14401
4 JGI24739J22299_10005573 3300001989 Bacteria 4774
5 JGI24739J22299_10006228 3300001989 Bacteria 4506
6 JGI25158J39367_1009791 3300002739 Bacteria 1307
7 JGI25150J39212_1011090 3300002774 Bacteria 1647
8 JGI25159J45721_1009651 3300002987 Bacteria 2528
9 Ga0006778J45830_1029808 3300003162 Bacteria 1371
10 Ga0006759J45824_1026758 3300003163 Bacteria 1084
11 Ga0006759J45824_1041332 3300003163 Bacteria 1066
12 JGI25151J46595_10048619 3300003187 Bacteria 1464
13 JGI25406J46586_10001890 3300003203 Bacteria 9855
14 JGI25153J46596_10009183 3300003215 Bacteria 4629
15 Ga0006770J48903_1021777 3300003305 Bacteria 1893
16 Ga0006777J48905_1014711 3300003308 Bacteria 1590
17 Ga0006777J48905_1024445 3300003308 Bacteria 1644
18 JGI25160J50197_1015271 3300003354 Bacteria 2529
19 Ga0007417J51691_1019108 3300003544 Bacteria 1714
20 Ga0007417J51691_1023048 3300003544 Bacteria 1686
21 Ga0007417J51691_1026934 3300003544 Bacteria 1235
22 Ga0007417J51691_1031652 3300003544 Bacteria 937
23 Ga0007417J51691_1036075 3300003544 Bacteria 1161
24 Ga0007427J51700_102207 3300003559 Bacteria 2986
25 Ga0007409J51694_1016865 3300003575 Bacteria 2002
26 Ga0007409J51694_1025783 3300003575 Bacteria 985
27 Ga0007416J51690_1015113 3300003577 Bacteria 8106
28 Ga0007416J51690_1015868 3300003577 Bacteria 1207
29 Ga0007416J51690_1018729 3300003577 Bacteria 1658
30 Ga0006562J51391_1006937 3300003578 Bacteria 6699
31 Ga0007429J51699_1025377 3300003579 Bacteria 1553
32 Ga0007429J51699_1030503 3300003579 Bacteria 1589
33 Ga0007429J51699_1031188 3300003579 Bacteria 2782
34 Ga0032354_1016955 3300003693 Bacteria 2250
35 Ga0032354_1032192 3300003693 Bacteria 2612
36 Ga0006780_1015081 3300003735 Bacteria 2212
37 Ga0055526_1017252 3300003771 Bacteria 2770
38 Ga0055537_1004203 3300003773 Bacteria 4177
39 Ga0055537_1014729 3300003773 Bacteria 1405
40 Ga0055524_1035313 3300003775 Bacteria 1365
41 Ga0055536_1047962 3300003781 Bacteria 959
42 Ga0055536_1051831 3300003781 Bacteria 897
43 Ga0055536_1075462 3300003781 Bacteria 652
44 Ga0055534_1006266 3300003784 Bacteria 3024
45 Ga0055534_1015354 3300003784 Bacteria 1405
46 Ga0055528_1016289 3300003790 Bacteria 2636
47 Ga0055528_1034371 3300003790 Bacteria 1251
48 Ga0055530_10008834 3300003791 Bacteria 3969
49 Ga0055530_10012175 3300003791 Bacteria 3019
50 Ga0055540_1042642 3300003792 Bacteria 971
51 Ga0055540_1044664 3300003792 Bacteria 939
52 Ga0055531_10033423 3300003794 Bacteria 1657
53 Ga0055531_10039854 3300003794 Bacteria 1387
54 Ga0058859_10052933 3300004798 Bacteria 1647
55 Ga0058859_11829956 3300004798 Bacteria 1734
56 Ga0058860_10009064 3300004801 Bacteria 1942
57 Ga0058860_10186761 3300004801 Bacteria 1353
58 Ga0058860_10214308 3300004801 Bacteria 1904
59 Ga0065714_10027962 3300005288 Bacteria 963
60 Ga0065714_10158514 3300005288 Bacteria 1062
61 Ga0065712_10074499 3300005290 Bacteria 4079
62 Ga0065715_10106550 3300005293 Bacteria 2822
63 Ga0065707_10215781 3300005295 Bacteria 1245
64 Ga0070658_10356979 3300005327 Bacteria 1251
65 Ga0070676_10185933 3300005328 Bacteria 1353
66 Ga0070690_100006708 3300005330 Bacteria 6539
67 Ga0070670_100378176 3300005331 Bacteria 1247
68 Ga0070677_10072891 3300005333 Bacteria 1449
69 Ga0068869_100056142 3300005334 Bacteria 2871
70 Ga0068869_100215849 3300005334 Bacteria 1518
71 Ga0068869_100941076 3300005334 Bacteria 749
72 Ga0070666_10092651 3300005335 Bacteria 2077
73 Ga0070666_10103470 3300005335 Bacteria 1965
74 Ga0070680_100019977 3300005336 Bacteria 5310
75 Ga0070680_100069044 3300005336 Bacteria 2901
76 Ga0070680_100350879 3300005336 Bacteria 1254
77 Ga0070680_100374628 3300005336 Bacteria 1212
78 Ga0070680_100610128 3300005336 Bacteria 937
79 Ga0070680_100636696 3300005336 Bacteria 916
80 Ga0070682_100052281 3300005337 Bacteria 2556
81 Ga0068868_100136307 3300005338 Bacteria 2012
82 Ga0070660_100053777 3300005339 Bacteria 3106
83 Ga0070689_100211438 3300005340 Bacteria 1588
84 Ga0070689_100301171 3300005340 Bacteria 1334
85 Ga0070687_100029641 3300005343 Bacteria 2666
86 Ga0070687_100209667 3300005343 Bacteria 1186
87 Ga0070661_100029789 3300005344 Bacteria 3941
88 Ga0070661_100229732 3300005344 Bacteria 1425
89 Ga0070661_100962396 3300005344 Bacteria 707
90 Ga0070692_10258417 3300005345 Bacteria 1046
91 Ga0070668_100765517 3300005347 Bacteria 855
92 Ga0070669_100141295 3300005353 Bacteria 1856
93 Ga0070675_100007285 3300005354 Bacteria 8534
94 Ga0070675_100433384 3300005354 Bacteria 1177
95 Ga0070671_100010269 3300005355 Bacteria 7516
96 Ga0070671_100016693 3300005355 Bacteria 5936
97 Ga0070674_100039655 3300005356 Bacteria 3181
98 Ga0070673_100001460 3300005364 Bacteria 13822
99 Ga0070673_100002927 3300005364 Bacteria 10519
100 Ga0070673_100041732 3300005364 Bacteria 3532
101 Ga0070673_100280745 3300005364 Bacteria 1461
102 Ga0070673_100549002 3300005364 Bacteria 1049
103 Ga0070673_100584186 3300005364 Bacteria 1018
104 Ga0070688_100320755 3300005365 Bacteria 1126
105 Ga0070659_100034931 3300005366 Bacteria 3913
106 Ga0070659_100120047 3300005366 Bacteria 2128
107 Ga0070659_100368845 3300005366 Bacteria 1207
108 Ga0070667_100332219 3300005367 Bacteria 1373
109 Ga0070703_10000400 3300005406 Bacteria 18096
110 Ga0070703_10145160 3300005406 Bacteria 886
111 Ga0070714_100064265 3300005435 Bacteria 3158
112 Ga0070714_100277699 3300005435 Bacteria 1555
113 Ga0070701_10041215 3300005438 Bacteria 2352
114 Ga0070705_100003035 3300005440 Bacteria 8283
115 Ga0070705_100022459 3300005440 Bacteria 3371
116 Ga0070705_100106797 3300005440 Bacteria 1780
117 Ga0070705_100124626 3300005440 Bacteria 1670
118 Ga0070705_100214267 3300005440 Bacteria 1330
119 Ga0070700_100049407 3300005441 Bacteria 2611
120 Ga0070700_100139715 3300005441 Bacteria 1645
121 Ga0070694_100022048 3300005444 Bacteria 4079
122 Ga0070694_100063548 3300005444 Bacteria 2525
123 Ga0070694_100100652 3300005444 Bacteria 2044
124 Ga0070694_100154448 3300005444 Bacteria 1679
125 Ga0070708_100013626 3300005445 Bacteria 6665
126 Ga0070708_100028181 3300005445 Bacteria 4830
127 Ga0070708_100082508 3300005445 Bacteria 2912
128 Ga0070663_100067972 3300005455 Bacteria 2586
129 Ga0070663_100532554 3300005455 Bacteria 979
130 Ga0070678_100244663 3300005456 Bacteria 1501
131 Ga0070662_100004028 3300005457 Bacteria 9221
132 Ga0070662_100067224 3300005457 Bacteria 2631
133 Ga0070662_100305039 3300005457 Bacteria 1294
134 Ga0070681_10086876 3300005458 Bacteria 3081
135 Ga0070681_10288080 3300005458 Bacteria 1553
136 Ga0070681_10369382 3300005458 Bacteria 1345
137 Ga0068867_100069210 3300005459 Bacteria 2636
138 Ga0068867_100134329 3300005459 Bacteria 1927
139 Ga0068867_100176567 3300005459 Bacteria 1695
140 Ga0068867_100527146 3300005459 Bacteria 1019
141 Ga0070685_10017229 3300005466 Bacteria 3864
142 Ga0070707_100062884 3300005468 Bacteria 3561
143 Ga0070698_100068456 3300005471 Bacteria 3567
144 Ga0070698_100133819 3300005471 Bacteria 2434
145 Ga0070699_100056651 3300005518 Bacteria 3394
146 Ga0070699_100114998 3300005518 Bacteria 2364
147 Ga0070699_100292093 3300005518 Bacteria 1462
148 Ga0070699_100350041 3300005518 Bacteria 1331
149 Ga0070699_100425763 3300005518 Bacteria 1202
150 Ga0070679_100014497 3300005530 Bacteria 7571
151 Ga0070679_100080125 3300005530 Bacteria 3254
152 Ga0070679_100308477 3300005530 Bacteria 1532
153 Ga0070679_100990665 3300005530 Bacteria 784
154 Ga0070684_100002468 3300005535 Bacteria 13611
155 Ga0070697_100020637 3300005536 Bacteria 5214
156 Ga0068853_100016308 3300005539 Bacteria 6112
157 Ga0068853_100095738 3300005539 Bacteria 2618
158 Ga0070672_100271918 3300005543 Bacteria 1431
159 Ga0070672_100673087 3300005543 Bacteria 905
160 Ga0070695_100001266 3300005545 Bacteria 13913
161 Ga0070695_100052468 3300005545 Bacteria 2620
162 Ga0070696_100004428 3300005546 Bacteria 9371
163 Ga0070696_100012543 3300005546 Bacteria 5689
164 Ga0070696_100130165 3300005546 Bacteria 1830
165 Ga0070693_100418945 3300005547 Bacteria 933
166 Ga0070704_100017182 3300005549 Bacteria 4593
167 Ga0070704_100029374 3300005549 Bacteria 3670
168 Ga0070704_100044791 3300005549 Bacteria 3076
169 Ga0070704_100061575 3300005549 Bacteria 2686
170 Ga0070704_100317803 3300005549 Bacteria 1303
171 Ga0068855_100014830 3300005563 Bacteria 9384
172 Ga0068855_100166634 3300005563 Bacteria 2497
173 Ga0068855_100437729 3300005563 Bacteria 1428
174 Ga0070664_100006687 3300005564 Bacteria 9298
175 Ga0070664_100008228 3300005564 Bacteria 8434
176 Ga0070664_100013860 3300005564 Bacteria 6571
177 Ga0070664_100450397 3300005564 Bacteria 1182
178 Ga0068857_100045215 3300005577 Bacteria 3905
179 Ga0068854_100289027 3300005578 Bacteria 1322
180 Ga0068854_100625679 3300005578 Bacteria 922
181 Ga0068856_100010722 3300005614 Bacteria 8903
182 Ga0068852_100028512 3300005616 Bacteria 4571
183 Ga0068852_100095276 3300005616 Bacteria 2672
184 Ga0068852_100110169 3300005616 Bacteria 2501
185 Ga0068859_100021700 3300005617 Bacteria 6443
186 Ga0068859_100044541 3300005617 Bacteria 4458
187 Ga0068864_100008073 3300005618 Bacteria 8681
188 Ga0068866_10067750 3300005718 Bacteria 1875
189 Ga0068861_100101114 3300005719 Bacteria 2293
190 Ga0068870_10015340 3300005840 Bacteria 3632
191 Ga0068870_10350063 3300005840 Bacteria 948
192 Ga0068863_100014731 3300005841 Bacteria 7523
193 Ga0068858_100048082 3300005842 Bacteria 3954
194 Ga0068858_100893435 3300005842 Bacteria 869
195 Ga0068860_100027786 3300005843 Bacteria 5448
196 Ga0068860_100260632 3300005843 Bacteria 1690
197 Ga0068862_100310839 3300005844 Bacteria 1452
198 Ga0068862_100542173 3300005844 Bacteria 1110
199 Ga0081539_10000072 3300005985 Bacteria 232726
200 Ga0081539_10010390 3300005985 Bacteria 7569
201 Ga0075363_100159794 3300006048 Bacteria 1275
202 Ga0075432_10057024 3300006058 Bacteria 1385
203 Ga0075362_10011450 3300006177 Bacteria 3494
204 Ga0075369_10084690 3300006186 Bacteria 1409
205 Ga0075366_10296814 3300006195 Bacteria 988
206 Ga0075366_10311607 3300006195 Bacteria 963
207 Ga0075366_10680971 3300006195 Bacteria 638
208 Ga0097621_100327316 3300006237 Bacteria 1358
209 Ga0097621_100334685 3300006237 Bacteria 1343
210 Ga0075370_10034040 3300006353 Bacteria 2855
211 Ga0075370_10238221 3300006353 Bacteria 1077
212 Ga0075370_10393149 3300006353 Bacteria 831
213 Ga0068871_100242168 3300006358 Bacteria 1568
214 Ga0068871_100534208 3300006358 Bacteria 1060
215 Ga0075428_100015919 3300006844 Bacteria 8320
216 Ga0075428_100022001 3300006844 Bacteria 7058
217 Ga0075428_100382680 3300006844 Bacteria 1508
218 Ga0075428_100661623 3300006844 Bacteria 1114
219 Ga0075430_100000579 3300006846 Bacteria 27829
220 Ga0075430_100199474 3300006846 Bacteria 1662
221 Ga0075430_100287335 3300006846 Bacteria 1360
222 Ga0075430_100358361 3300006846 Bacteria 1204
223 Ga0075430_100652607 3300006846 Bacteria 868
224 Ga0075431_100001591 3300006847 Bacteria 21135
225 Ga0075431_100025866 3300006847 Bacteria 6015
226 Ga0075431_100140879 3300006847 Bacteria 2486
227 Ga0075431_100147666 3300006847 Bacteria 2422
228 Ga0075433_10079601 3300006852 Bacteria 2887
229 Ga0075433_10202721 3300006852 Bacteria 1764
230 Ga0075434_100000895 3300006871 Bacteria 23884
231 Ga0075434_100208963 3300006871 Bacteria 1972
232 Ga0075429_100000220 3300006880 Bacteria 38587
233 Ga0075429_100159107 3300006880 Bacteria 1978
234 Ga0068865_100046149 3300006881 Bacteria 2988
235 Ga0068865_100101448 3300006881 Bacteria 2107
236 Ga0068865_100187829 3300006881 Bacteria 1596
237 Ga0075436_100000458 3300006914 Bacteria 26344
238 Ga0075436_100002331 3300006914 Bacteria 13096
239 Ga0075436_100015864 3300006914 Bacteria 5157
240 Ga0075436_100069889 3300006914 Bacteria 2426
241 Ga0075436_100099710 3300006914 Bacteria 2022
242 Ga0097620_100021700 3300006931 Bacteria 6443
243 Ga0097620_100044539 3300006931 Bacteria 4458
244 Ga0097620_100323614 3300006931 Bacteria 1636
245 Ga0079104_1014245 3300006946 Bacteria 2406
246 Ga0099826_10069594 3300006948 Bacteria 2242
247 Ga0075435_100019527 3300007076 Bacteria 5180
248 Ga0075435_100136570 3300007076 Bacteria 2055
249 Ga0105244_10026727 3300009036 Bacteria 3120
250 Ga0105240_10005705 3300009093 Bacteria 18471
251 Ga0111539_10002099 3300009094 Bacteria 26631
252 Ga0111539_10030319 3300009094 Bacteria 6575
253 Ga0111539_10069166 3300009094 Bacteria 4169
254 Ga0111539_10362918 3300009094 Bacteria 1686
255 Ga0111539_10701290 3300009094 Bacteria 1178
256 Ga0111539_11069052 3300009094 Bacteria 938
257 Ga0114129_10011902 3300009147 Bacteria 12373
258 Ga0114129_10208912 3300009147 Bacteria 2640
259 Ga0114129_10220005 3300009147 Bacteria 2562
260 Ga0114129_11188854 3300009147 Bacteria 950
261 Ga0105243_10630506 3300009148 Bacteria 1036
262 Ga0105243_12051075 3300009148 Bacteria 607
263 Ga0105243_12085833 3300009148 Bacteria 602
264 Ga0105241_10323095 3300009174 Bacteria 1331
265 Ga0105242_10326915 3300009176 Bacteria 1408
266 Ga0105242_10469341 3300009176 Bacteria 1190
267 Ga0105248_10023039 3300009177 Bacteria 6915
268 Ga0105248_10717995 3300009177 Bacteria 1128
269 Ga0105237_10421778 3300009545 Bacteria 1340
270 Ga0105238_10522421 3300009551 Bacteria 1190
271 Ga0105238_10658582 3300009551 Bacteria 1057
272 Ga0105238_10751449 3300009551 Bacteria 989
273 Ga0105238_10766444 3300009551 Bacteria 979
274 Ga0105249_10177663 3300009553 Bacteria 2069
275 Ga0105239_10706655 3300010375 Bacteria 1153
276 Ga0105246_10042758 3300011119 Bacteria 3070
277 Ga0105246_10364201 3300011119 Bacteria 1189
278 Ga0157346_1003591 3300012480 Bacteria 874
279 Ga0157323_1008725 3300012495 Bacteria 761
280 Ga0157347_1012960 3300012502 Bacteria 906
281 Ga0157373_10012089 3300013100 Bacteria 6345
282 Ga0157371_10006761 3300013102 Bacteria 9375
283 Ga0157370_10090529 3300013104 Bacteria 2872
284 Ga0157370_10739382 3300013104 Bacteria 897
285 Ga0157369_10071959 3300013105 Bacteria 3711
286 Ga0157374_10123485 3300013296 Bacteria 2501
287 Ga0157374_10461078 3300013296 Bacteria 1273
288 Ga0157374_10727480 3300013296 Bacteria 1006
289 Ga0157374_10798823 3300013296 Bacteria 959
290 Ga0163162_10024660 3300013306 Bacteria 5940
291 Ga0163162_10103155 3300013306 Bacteria 2946
292 Ga0163162_10644326 3300013306 Bacteria 1183
293 Ga0157372_10016866 3300013307 Bacteria 7840
294 Ga0157375_10116678 3300013308 Bacteria 2774
295 Ga0157375_11895917 3300013308 Bacteria 707
296 Ga0163163_10001656 3300014325 Bacteria 18767
297 Ga0157380_10582114 3300014326 Bacteria 1104
298 Ga0182008_10113002 3300014497 Bacteria 1346
299 Ga0182008_10157003 3300014497 Bacteria 1143
300 Ga0182008_10271223 3300014497 Bacteria 880
301 Ga0157379_10120127 3300014968 Bacteria 2364
302 Ga0182006_1075350 3300015261 Bacteria 1242
303 Ga0182006_1102517 3300015261 Bacteria 1014
304 Ga0182007_10051104 3300015262 Bacteria 1364
305 Ga0182007_10052106 3300015262 Bacteria 1349
306 Ga0182005_1068779 3300015265 Bacteria 971
307 Ga0183362_10007 3300015683 Bacteria 240101
308 Ga0163161_10615837 3300017792 Bacteria 896
309 Ga0163161_11029929 3300017792 Bacteria 704
310 Ga0206356_11893467 3300020070 Bacteria 2004
311 Ga0206355_1552327 3300020076 Bacteria 794
312 Ga0213873_10005735 3300021358 Bacteria 2402
313 Ga0213874_10005081 3300021377 Bacteria 3046
314 Ga0213876_10026215 3300021384 Bacteria 3074
315 Ga0213876_10207718 3300021384 Bacteria 1041
316 Ga0213875_10007338 3300021388 Bacteria 5700
317 Ga0213875_10042663 3300021388 Bacteria 2130
318 Ga0213871_10003980 3300021441 Bacteria 2912
319 Ga0224712_10221828 3300022467 Bacteria 866
320 Ga0209436_104800 3300025208 Bacteria 3252
321 Ga0207425_1000229 3300025245 Bacteria 43700
322 Ga0209129_1000049 3300025258 Bacteria 268086
323 Ga0209129_1024502 3300025258 Bacteria 1061
324 Ga0209565_1000259 3300025263 Bacteria 56285
325 Ga0209565_1004429 3300025263 Bacteria 4271
326 Ga0209673_1000193 3300025273 Bacteria 123134
327 Ga0209673_1052955 3300025273 Bacteria 1061
328 Ga0209130_1000974 3300025284 Bacteria 22515
329 Ga0209130_1008050 3300025284 Bacteria 3160
330 Ga0209675_1000220 3300025291 Bacteria 59335
331 Ga0209675_1038691 3300025291 Bacteria 1061
332 Ga0209676_1000074 3300025292 Bacteria 305770
333 Ga0209676_1030737 3300025292 Bacteria 1637
334 Ga0209676_1054478 3300025292 Bacteria 1030
335 Ga0209676_1054927 3300025292 Bacteria 1023
336 Ga0209025_1000283 3300025294 Bacteria 114855
337 Ga0209025_1001101 3300025294 Bacteria 38908
338 Ga0209025_1003538 3300025294 Bacteria 14652
339 Ga0209025_1084676 3300025294 Bacteria 1061
340 Ga0209564_1048460 3300025295 Bacteria 1061
341 Ga0209758_1006862 3300025297 Bacteria 7957
342 Ga0209050_1000015 3300025298 Bacteria 759102
343 Ga0209050_1000884 3300025298 Bacteria 40094
344 Ga0209050_1089446 3300025298 Bacteria 634
345 Ga0209256_1000264 3300025299 Bacteria 92750
346 Ga0209256_1000304 3300025299 Bacteria 85971
347 Ga0207426_1000108 3300025302 Bacteria 242257
348 Ga0207426_1003089 3300025302 Bacteria 9528
349 Ga0209051_1000010 3300025303 Bacteria 641298
350 Ga0209051_1007601 3300025303 Bacteria 5900
351 Ga0209051_1076516 3300025303 Bacteria 983
352 Ga0209051_1099766 3300025303 Bacteria 784
353 Ga0209257_1000026 3300025304 Bacteria 723225
354 Ga0209257_1012374 3300025304 Bacteria 3956
355 Ga0209257_1053358 3300025304 Bacteria 1131
356 Ga0207655_1008322 3300025728 Bacteria 6600
357 Ga0207653_10000147 3300025885 Bacteria 49999
358 Ga0207682_10076447 3300025893 Bacteria 1427
359 Ga0207692_10395007 3300025898 Bacteria 861
360 Ga0207688_10094893 3300025901 Bacteria 1717
361 Ga0207688_10137772 3300025901 Bacteria 1434
362 Ga0207680_10059785 3300025903 Bacteria 2317
363 Ga0207643_10017736 3300025908 Bacteria 3896
364 Ga0207705_10053354 3300025909 Bacteria 2912
365 Ga0207684_10013749 3300025910 Bacteria 6991
366 Ga0207654_10292608 3300025911 Bacteria 1105
367 Ga0207707_10007445 3300025912 Bacteria 9539
368 Ga0207707_10059928 3300025912 Bacteria 3311
369 Ga0207707_10264771 3300025912 Bacteria 1491
370 Ga0207695_10190389 3300025913 Bacteria 1969
371 Ga0207695_10507656 3300025913 Bacteria 1088
372 Ga0207671_10059266 3300025914 Bacteria 2839
373 Ga0207693_10422652 3300025915 Bacteria 1042
374 Ga0207660_10098020 3300025917 Bacteria 2186
375 Ga0207660_10113538 3300025917 Bacteria 2042
376 Ga0207660_10158887 3300025917 Bacteria 1742
377 Ga0207660_10469812 3300025917 Bacteria 1018
378 Ga0207662_10011340 3300025918 Bacteria 4939
379 Ga0207662_10117611 3300025918 Bacteria 1664
380 Ga0207662_10151084 3300025918 Bacteria 1477
381 Ga0207657_10152752 3300025919 Bacteria 1879
382 Ga0207657_10155405 3300025919 Bacteria 1860
383 Ga0207649_10011951 3300025920 Bacteria 4803
384 Ga0207649_10305554 3300025920 Bacteria 1164
385 Ga0207652_10037810 3300025921 Bacteria 4087
386 Ga0207652_10224142 3300025921 Bacteria 1694
387 Ga0207652_10403528 3300025921 Bacteria 1233
388 Ga0207681_10155862 3300025923 Bacteria 1716
389 Ga0207694_10415352 3300025924 Bacteria 1120
390 Ga0207694_10473300 3300025924 Bacteria 1047
391 Ga0207659_10088367 3300025926 Bacteria 2308
392 Ga0207687_10406029 3300025927 Bacteria 1121
393 Ga0207644_10047301 3300025931 Bacteria 3069
394 Ga0207690_10039856 3300025932 Bacteria 3067
395 Ga0207690_10271619 3300025932 Bacteria 1317
396 Ga0207706_10054467 3300025933 Bacteria 3530
397 Ga0207706_10091051 3300025933 Bacteria 2682
398 Ga0207686_10355329 3300025934 Bacteria 1104
399 Ga0207709_10045083 3300025935 Bacteria 2669
400 Ga0207709_10297069 3300025935 Bacteria 1200
401 Ga0207670_10020451 3300025936 Bacteria 4067
402 Ga0207670_10038917 3300025936 Bacteria 3110
403 Ga0207670_10177861 3300025936 Bacteria 1600
404 Ga0207669_10203759 3300025937 Bacteria 1438
405 Ga0207669_10334633 3300025937 Bacteria 1163
406 Ga0207669_10439485 3300025937 Bacteria 1031
407 Ga0207704_10036321 3300025938 Bacteria 2834
408 Ga0207665_10125879 3300025939 Bacteria 1814
409 Ga0207665_10171621 3300025939 Bacteria 1566
410 Ga0207691_10049054 3300025940 Bacteria 3869
411 Ga0207711_10112524 3300025941 Bacteria 2422
412 Ga0207689_10049975 3300025942 Bacteria 3449
413 Ga0207689_10085566 3300025942 Bacteria 2591
414 Ga0207689_10231021 3300025942 Bacteria 1529
415 Ga0207689_10930067 3300025942 Bacteria 734
416 Ga0207679_10025616 3300025945 Bacteria 4059
417 Ga0207667_10019371 3300025949 Bacteria 7599
418 Ga0207667_10100133 3300025949 Bacteria 2989
419 Ga0207651_10077458 3300025960 Bacteria 2380
420 Ga0207651_10159533 3300025960 Bacteria 1766
421 Ga0207640_10365277 3300025981 Bacteria 1164
422 Ga0207658_10046716 3300025986 Bacteria 3164
423 Ga0207677_10068962 3300026023 Bacteria 2485
424 Ga0207677_10226453 3300026023 Bacteria 1503
425 Ga0207639_10042136 3300026041 Bacteria 3420
426 Ga0207708_10055258 3300026075 Bacteria 3027
427 Ga0207708_10398295 3300026075 Bacteria 1138
428 Ga0207641_10041536 3300026088 Bacteria 3854
429 Ga0207648_10011251 3300026089 Bacteria 8437
430 Ga0207648_10082194 3300026089 Bacteria 2809
431 Ga0207648_10086281 3300026089 Bacteria 2738
432 Ga0207648_10160477 3300026089 Bacteria 1985
433 Ga0207648_11246015 3300026089 Bacteria 699
434 Ga0207674_10042433 3300026116 Bacteria 4698
435 Ga0207674_10053786 3300026116 Bacteria 4102
436 Ga0207675_100008162 3300026118 Bacteria 9870
437 Ga0207683_10015833 3300026121 Bacteria 6420
438 Ga0207683_10071406 3300026121 Bacteria 3069
439 Ga0207683_10281226 3300026121 Bacteria 1520
440 Ga0207683_10519516 3300026121 Bacteria 1100
441 Ga0207698_10575450 3300026142 Bacteria 1107
442 Ga0209973_1000069 3300027252 Bacteria 5507
443 Ga0209969_1000547 3300027360 Bacteria 5071
444 Ga0209969_1004709 3300027360 Bacteria 1906
445 Ga0209996_1025717 3300027395 Bacteria 842
446 Ga0209984_1001298 3300027424 Bacteria 2697
447 Ga0209995_1003999 3300027471 Bacteria 2354
448 Ga0209982_1008959 3300027552 Bacteria 1474
449 Ga0209970_1015084 3300027614 Bacteria 1285
450 Ga0210002_1022344 3300027617 Bacteria 1026
451 Ga0209282_1003491 3300027666 Bacteria 9346
452 Ga0209588_1007867 3300027671 Bacteria 3151
453 Ga0209971_1000807 3300027682 Bacteria 8071
454 Ga0209971_1006804 3300027682 Bacteria 2709
455 Ga0209998_10022649 3300027717 Bacteria 1356
456 Ga0209974_10000163 3300027876 Bacteria 20307
457 Ga0209974_10003782 3300027876 Bacteria 5422
458 Ga0209974_10267143 3300027876 Bacteria 647
459 Ga0207428_10002412 3300027907 Bacteria 18661
460 Ga0207428_10030776 3300027907 Bacteria 4435
461 Ga0207428_10071241 3300027907 Bacteria 2731
462 Ga0207428_10303746 3300027907 Bacteria 1181
463 Ga0268266_10218724 3300028379 Bacteria 1750
464 Ga0268265_10047074 3300028380 Bacteria 3229
465 Ga0268265_10237018 3300028380 Bacteria 1607
466 Ga0268265_10785551 3300028380 Bacteria 927
467 Ga0268264_10152605 3300028381 Bacteria 2073
468 Ga0268264_10358307 3300028381 Bacteria 1390
469 Ga0265336_10000028 3300028666 Bacteria 179201
470 Ga0307515_10000063 3300028794 Bacteria 245504
471 Ga0265324_10000286 3300029957 Bacteria 37420
472 Ga0316176_1026337 3300030732 Bacteria 6875
473 Ga0314311_1100006 3300030733 Bacteria 3970
474 Ga0316179_1028317 3300030734 Bacteria 3022
475 Ga0316178_1042489 3300030735 Bacteria 6641
476 Ga0316181_1030196 3300030744 Bacteria 976
477 Ga0265327_10000530 3300031251 Bacteria 65606
478 Ga0265327_10025070 3300031251 Bacteria 3485
479 Ga0307513_10034953 3300031456 Bacteria 5631
480 Ga0307513_10140898 3300031456 Bacteria 2338
481 Ga0307408_100108217 3300031548 Bacteria 2130
482 Ga0307514_10012779 3300031649 Bacteria 6978
483 Ga0316575_10289858 3300031665 Bacteria 691
484 Ga0307516_10040356 3300031730 Bacteria 4647
485 Ga0307405_10128992 3300031731 Bacteria 1744
486 Ga0307405_10180379 3300031731 Bacteria 1515
487 Ga0307410_10129185 3300031852 Bacteria 1854
488 Ga0307410_10501716 3300031852 Bacteria 998
489 Ga0307406_10160574 3300031901 Bacteria 1615
490 Ga0307406_10840550 3300031901 Bacteria 777
491 Ga0307406_11309278 3300031901 Bacteria 632
492 Ga0307412_10060492 3300031911 Bacteria 2542
493 Ga0307412_10151103 3300031911 Bacteria 1713
494 Ga0307412_10648449 3300031911 Bacteria 900
495 Ga0307416_100008391 3300032002 Bacteria 6662
496 Ga0307416_100349609 3300032002 Bacteria 1495
497 Ga0307416_100423956 3300032002 Bacteria 1375
498 Ga0307416_101550545 3300032002 Bacteria 768
499 Ga0307416_101984146 3300032002 Bacteria 685
500 Ga0307414_10176548 3300032004 Bacteria 1713
501 Ga0307414_10363118 3300032004 Bacteria 1247
502 Ga0307411_10057799 3300032005 Bacteria 2564
503 Ga0307411_10215887 3300032005 Bacteria 1484
504 Ga0316593_10002246 3300032168 Bacteria 4524
505 Ga0316592_1004459 3300033524 Bacteria 2604
506 Ga0316586_1003618 3300033527 Bacteria 2048
507 Ga0373960_0028386 3300035121 Bacteria 1544
508 Ga0373960_0108029 3300035121 Bacteria 910
509 Ga0373942_0002486 3300035207 Bacteria 4471
510 Ga0373961_0010397 3300035241 Bacteria 2292
511 Ga0373962_0039397 3300035242 Bacteria 1326
512 Ga0373931_0013113 3300035691 Bacteria 4030
513 Ga0373931_0041836 3300035691 Bacteria 2408
514 Ga0373931_0078947 3300035691 Bacteria 1812
515 Ga0310112_036327 3300036458 Bacteria 672
516 Ga0310110_007052 3300036535 Bacteria 1643
517 Ga0316582_0519370 3300036647 Bacteria 821
518 Ga0436364_0268578 3300037853 Bacteria 6831
519 Ga0436364_0367144 3300037853 Bacteria 983
520 Ga0436364_0586291 3300037853 Bacteria 97560
521 Ga0436364_0999134 3300037853 Bacteria 803
522 Ga0436364_1269112 3300037853 Bacteria 1955
523 Ga0395901_0093407 3300038443 Bacteria 3150
524 Ga0395901_0996361 3300038443 Bacteria 814
525 Ga0400488_36468 3300038741 Bacteria 1152
526 Ga0400483_046311 3300039062 Bacteria 7891
527 Ga0400483_217885 3300039062 Bacteria 12374
528 Ga0436365_0582907 3300039437 Bacteria 2602
529 Ga0436365_1050783 3300039437 Bacteria 5796
530 Ga0436360_0521510 3300039438 Bacteria 2768
531 Ga0436360_1229176 3300039438 Bacteria 14016
532 Ga0436363_0315020 3300039450 Bacteria 4092
533 Ga0436362_0967331 3300039453 Bacteria 6970
534 Ga0439436_0003093 3300041404 Bacteria 5043
535 Ga0439436_0032700 3300041404 Bacteria 1507
536 Ga0439447_043915 3300041407 Bacteria 1082
537 Ga0439466_0011037 3300041411 Bacteria 3349
538 Ga0439466_0113912 3300041411 Bacteria 837
539 Ga0439466_0144042 3300041411 Bacteria 730
540 Ga0451790_09628 3300041444 Bacteria 718
541 Ga0451807_2673306 3300041486 Bacteria 1011
542 Ga0451837_1413189 3300041494 Bacteria 680
543 Ga0451843_1564654 3300041509 Bacteria 728
544 Ga0439431_0095624 3300041997 Bacteria 813
545 Ga0439433_0000255 3300041999 Bacteria 8970
546 Ga0439441_002636 3300042001 Bacteria 2548
547 Ga0439441_004832 3300042001 Bacteria 2062
548 Ga0439442_109674 3300042002 Bacteria 601
549 Ga0439445_0009991 3300042004 Bacteria 2240
550 Ga0439445_0076461 3300042004 Bacteria 932
551 Ga0439448_0046748 3300042005 Bacteria 1411
552 Ga0439432_055254 3300042006 Bacteria 1232
553 Ga0439449_0001595 3300042007 Bacteria 8892
554 Ga0439450_006570 3300042008 Bacteria 2099
555 Ga0439452_013342 3300042010 Bacteria 2309
556 Ga0439454_018792 3300042011 Bacteria 999
557 Ga0439456_019918 3300042013 Bacteria 1413
558 Ga0439463_052505 3300042016 Bacteria 1040
559 Ga0439463_108396 3300042016 Bacteria 717
560 Ga0450914_032829 3300042118 Bacteria 632
561 Ga0450919_004876 3300042121 Bacteria 1626
562 Ga0450923_034358 3300042125 Bacteria 1045
563 Ga0450889_007261 3300042144 Bacteria 1118
564 Ga0450889_015102 3300042144 Bacteria 827
565 Ga0450906_005991 3300042145 Bacteria 2474
566 Ga0450906_051648 3300042145 Bacteria 727
567 Ga0439446_0023464 3300042156 Bacteria 1755
568 Ga0450908_002334 3300042184 Bacteria 3716
569 Ga0439434_0032682 3300042435 Bacteria 1584
570 Ga0439434_0182856 3300042435 Bacteria 702
571 Ga0439435_0000603 3300042436 Bacteria 5845
572 Ga0439444_0004900 3300042437 Bacteria 1964
573 Ga0439459_0066512 3300042438 Bacteria 825
574 Ga0450918_002211 3300042531 Bacteria 3700
575 Ga0451577_0053817 3300042876 Bacteria 3593
576 Ga0453683_0067276 3300044673 Bacteria 2239
577 Ga0466964_0020860 3300044706 Bacteria 2527
578 Ga0466957_0356958 3300044842 Bacteria 993
579 Ga0451576_0013761 3300045051 Bacteria 9038
580 Ga0451576_0033871 3300045051 Bacteria 5427
581 Ga0451576_0121787 3300045051 Bacteria 2716
582 Ga0451576_0179640 3300045051 Bacteria 2209
583 Ga0451576_0566765 3300045051 Bacteria 1193
584 Ga0451576_0683828 3300045051 Bacteria 1078
585 Ga0466967_0016890 3300045976 Bacteria 5771
586 Ga0495651_0074163 3300046462 Bacteria 2582
587 Ga0495639_0004974 3300046475 Bacteria 5702
588 Ga0495639_0020558 3300046475 Bacteria 2885
589 Ga0495620_0000768 3300046515 Bacteria 19677
590 Ga0495630_0640577 3300046517 Bacteria 814
591 Ga0495631_0000382 3300046518 Bacteria 30522
592 Ga0495637_0001023 3300046520 Bacteria 17604
593 Ga0495643_0417802 3300046522 Bacteria 589
594 Ga0495663_0022131 3300046525 Bacteria 1835
595 Ga0495663_0035009 3300046525 Bacteria 1506
596 Ga0495663_0075447 3300046525 Bacteria 1079
597 Ga0495642_0004003 3300046528 Bacteria 5759
598 Ga0495642_0043098 3300046528 Bacteria 1840
599 Ga0495642_0045618 3300046528 Bacteria 1791
600 Ga0495654_0009083 3300046530 Bacteria 5455
601 Ga0495587_0298808 3300046536 Bacteria 901
602 Ga0495621_0008009 3300046539 Bacteria 3150
603 Ga0495621_0039015 3300046539 Bacteria 1659
604 Ga0495656_0004795 3300046615 Bacteria 4654
605 Ga0495634_0234977 3300046642 Bacteria 1127
606 Ga0495659_0075806 3300046664 Bacteria 1268
607 Ga0495661_0188499 3300046665 Bacteria 1088
608 Ga0495588_0011885 3300046674 Bacteria 4099
609 Ga0495588_0120113 3300046674 Bacteria 1385
610 Ga0495599_0120540 3300046678 Bacteria 1631
611 Ga0495669_0060172 3300046684 Bacteria 1717
612 Ga0495671_0026835 3300046692 Bacteria 2981
613 Ga0495681_0075653 3300047470 Bacteria 1515
614 Ga0495686_0067186 3300047472 Bacteria 2213
615 Ga0495602_0185169 3300048088 Bacteria 1602
616 Ga0495614_0001793 3300048089 Bacteria 9393
617 Ga0495615_0004514 3300048090 Bacteria 2436
618 Ga0496100_0157178 3300048903 Bacteria 1627
619 Ga0496102_0007579 3300048905 Bacteria 9273
620 Ga0496103_0009380 3300048906 Bacteria 5797
621 Ga0496104_0008378 3300048907 Bacteria 9189
622 Ga0496105_0028921 3300048908 Bacteria 4534
623 Ga0496106_0079001 3300048909 Bacteria 2526
624 Ga0496106_0113183 3300048909 Bacteria 2115
625 Ga0496106_0133222 3300048909 Bacteria 1950
626 Ga0496109_0054951 3300048912 Bacteria 3632
627 Ga0496110_0026383 3300048913 Bacteria 4971
628 Ga0496110_0037852 3300048913 Bacteria 4195
629 Ga0496111_0004330 3300048914 Bacteria 8955
630 Ga0496113_0036282 3300048916 Bacteria 3611
631 Ga0496114_0014567 3300048917 Bacteria 6317
632 Ga0496114_0151283 3300048917 Bacteria 2013
633 Ga0496114_0371021 3300048917 Bacteria 1267
634 Ga0496114_0870224 3300048917 Bacteria 782
635 Ga0496117_0016815 3300048920 Bacteria 6146
636 Ga0496117_0039927 3300048920 Bacteria 3458
637 Ga0496118_0032494 3300048921 Bacteria 4297
638 Ga0496118_0157974 3300048921 Bacteria 1407
639 Ga0496121_0087873 3300048924 Bacteria 2438
640 Ga0496123_0093895 3300048926 Bacteria 1770
641 Ga0496124_0043393 3300048927 Bacteria 3866
642 Ga0496124_0370611 3300048927 Bacteria 1005
643 Ga0496125_0046394 3300048928 Bacteria 3645
644 Ga0501306_004022 3300049127 Bacteria 1623
645 Ga0501308_020699 3300049128 Bacteria 821
646 Ga0501310_002191 3300049130 Bacteria 1838
647 Ga0501304_002322 3300049160 Bacteria 1311
648 Ga0501305_047242 3300049161 Bacteria 715
649 Ga0501307_007146 3300049162 Bacteria 1224
650 Ga0501299_019439 3300049522 Bacteria 1229
651 Ga0501311_009392 3300049527 Bacteria 1167
652 Ga0501315_000369 3300049531 Bacteria 3002
653 Ga0501317_000342 3300049533 Bacteria 3103
654 Ga0501318_003986 3300049534 Bacteria 1391
655 Ga0501318_024398 3300049534 Bacteria 787
656 Ga0501320_000194 3300049536 Bacteria 3114
657 Ga0501320_029813 3300049536 Bacteria 674
658 Ga0501323_002136 3300049539 Bacteria 1878
659 Ga0501326_00563 3300049542 Bacteria 1504
660 Ga0501337_000344 3300049553 Bacteria 2182
661 Ga0501031_0018650 3300049568 Bacteria 4518
662 Ga0501031_0385029 3300049568 Bacteria 907
663 Ga0501034_0017280 3300049571 Bacteria 7400
664 Ga0501034_0245099 3300049571 Bacteria 1737
665 Ga0501036_0207451 3300049572 Bacteria 1647
666 Ga0501040_0205759 3300049576 Bacteria 1398
667 Ga0501041_0000437 3300049577 Bacteria 21135
668 Ga0501041_0140688 3300049577 Bacteria 1505
669 Ga0501042_0056634 3300049578 Bacteria 2797
670 Ga0501047_0034449 3300049581 Bacteria 4889
671 Ga0501068_0049147 3300049584 Bacteria 2547
672 Ga0501071_0148530 3300049587 Bacteria 1747
673 Ga0501072_0061311 3300049588 Bacteria 2966
674 Ga0501072_0266946 3300049588 Bacteria 1362
675 Ga0501073_0275168 3300049589 Bacteria 1162
676 Ga0501075_0001690 3300049591 Bacteria 14492
677 Ga0501075_0156299 3300049591 Bacteria 1739
678 Ga0501076_0160766 3300049592 Bacteria 1830
679 Ga0501076_0183238 3300049592 Bacteria 1707
680 Ga0501077_0052597 3300049593 Bacteria 2586
681 Ga0501077_0059400 3300049593 Bacteria 2427
682 Ga0501227_024312 3300049665 Bacteria 1413
683 Ga0501079_0011454 3300049741 Bacteria 6770
684 Ga0501080_0020230 3300049742 Bacteria 6161
685 Ga0501081_0002862 3300049743 Bacteria 10959
686 Ga0501266_019081 3300049763 Bacteria 926
687 Ga0501275_021399 3300049772 Bacteria 797
688 Ga0501044_0321425 3300049823 Bacteria 1472
689 Ga0501045_0050583 3300049824 Bacteria 3032
690 nmdc:mga03683_232502_c1 3300050489 Bacteria 853
691 nmdc:mga03n38_276738_c1 3300050490 Bacteria 895
692 nmdc:mga00v17_318955_c1 3300050491 Bacteria 1010
693 nmdc:mga0k408_262742_c1 3300050493 Bacteria 1031
694 nmdc:mga07m45_32442_c1 3300050496 Bacteria 2897
695 nmdc:mga07m45_362120_c1 3300050496 Bacteria 843
696 nmdc:mga07m45_422106_c1 3300050496 Bacteria 774
697 nmdc:mga05p37_21387_c1 3300050507 Bacteria 7835
698 nmdc:mga05p37_431_c1 3300050507 Bacteria 45404
699 nmdc:mga05p37_8872_c1 3300050507 Bacteria 11877
700 nmdc:mga05p37_95049_c2 3300050507 Bacteria 3020
701 nmdc:mga05p37_96645_c1 3300050507 Bacteria 3639
702 nmdc:mga09592_12683_c1 3300050508 Bacteria 6870
703 nmdc:mga09592_16325_c1 3300050508 Bacteria 6073
704 nmdc:mga09592_229_c1 3300050508 Bacteria 40458
705 nmdc:mga0qj67_1458_c1 3300050509 Bacteria 16584
706 nmdc:mga0qj67_237097_c1 3300050509 Bacteria 1480
707 nmdc:mga0qj67_244007_c1 3300050509 Bacteria 1457
708 nmdc:mga0qj67_45551_c1 3300050509 Bacteria 3462
709 nmdc:mga0qj67_80795_c1 3300050509 Bacteria 2605
710 nmdc:mga0qj67_88658_c1 3300050509 Bacteria 2484
711 nmdc:mga06r32_14275_c1 3300050510 Bacteria 7205
712 nmdc:mga06r32_14300_c1 3300050510 Bacteria 7199
713 nmdc:mga06r32_15454_c1 3300050510 Bacteria 6930
714 nmdc:mga06r32_163193_c1 3300050510 Bacteria 2211
715 nmdc:mga06r32_18350_c1 3300050510 Bacteria 6405
716 nmdc:mga06r32_295656_c1 3300050510 Bacteria 1606
717 nmdc:mga08y16_21701_c1 3300050511 Bacteria 6778
718 nmdc:mga08y16_236540_c1 3300050511 Bacteria 1889
719 nmdc:mga08y16_2559_c1 3300050511 Bacteria 18707
720 nmdc:mga08y16_26203_c1 3300050511 Bacteria 6148
721 nmdc:mga08y16_32031_c1 3300050511 Bacteria 2677
722 nmdc:mga08y16_663948_c1 3300050511 Bacteria 1045
723 nmdc:mga08y16_72548_c1 3300050511 Bacteria 3587
724 nmdc:mga08y16_760951_c1 3300050511 Bacteria 964
725 nmdc:mga0n895_129139_c1 3300050512 Bacteria 2552
726 nmdc:mga0n895_570_c1 3300050512 Bacteria 25297
727 nmdc:mga0n895_884166_c1 3300050512 Bacteria 880
728 nmdc:mga0rr50_41258_c1 3300050513 Bacteria 3361
729 nmdc:mga0rr50_48290_c1 3300050513 Bacteria 3146
730 nmdc:mga0rr50_84504_c1 3300050513 Bacteria 2458
731 nmdc:mga08x19_36877_c1 3300050514 Bacteria 3099
732 nmdc:mga08x19_60071_c1 3300050514 Bacteria 2462
733 nmdc:mga08x19_945_c1 3300050514 Bacteria 18277
734 nmdc:mga0a205_104296_c1 3300050515 Bacteria 2734
735 Ga0495612_0213198 3300053078 Bacteria 854
736 Ga0500643_118205 3300053087 Bacteria 714
737 Ga0500651_0000298 3300053093 Bacteria 28626
738 Ga0500571_006617 3300053110 Bacteria 6277
739 Ga0500594_0000901 3300053118 Bacteria 6372
740 Ga0500608_001875 3300053122 Bacteria 7489
741 Ga0500658_0005673 3300053134 Bacteria 4646
742 Ga0500568_0002630 3300053139 Bacteria 10437
743 Ga0500574_000173 3300053141 Bacteria 7537
744 Ga0500616_0022445 3300053153 Bacteria 3522
745 Ga0500634_0211105 3300053161 Bacteria 843
746 Ga0500645_030754 3300053730 Bacteria 1615
747 Ga0501084_0219012 3300054114 Bacteria 1606
748 Ga0587084_000180 3300059477 Bacteria 4030
749 Ga0587084_007162 3300059477 Bacteria 1376
750 Ga0587084_007363 3300059477 Bacteria 1364
751 Ga0587093_000167 3300059478 Bacteria 3666
752 Ga0587066_002638 3300059490 Bacteria 2004
753 Ga0587066_004366 3300059490 Bacteria 1735
754 Ga0587070_002983 3300059491 Bacteria 1986
755 Ga0587070_007508 3300059491 Bacteria 1514
756 Ga0587070_044518 3300059491 Bacteria 863
757 Ga0587073_0003829 3300059492 Bacteria 2105
758 Ga0587073_0010063 3300059492 Bacteria 1578
759 Ga0587077_005673 3300059493 Bacteria 1723
760 Ga0587080_000720 3300059503 Bacteria 3104
761 Ga0587080_006577 3300059503 Bacteria 1607
762 Ga0587082_002720 3300059504 Bacteria 2037
763 Ga0587083_0000314 3300059505 Bacteria 3935
764 Ga0587083_0008988 3300059505 Bacteria 1581
765 Ga0587085_001947 3300059506 Bacteria 2030
766 Ga0587085_030805 3300059506 Bacteria 881
767 Ga0587086_001748 3300059507 Bacteria 1940
768 Ga0587088_000197 3300059508 Bacteria 4081
769 Ga0587088_002368 3300059508 Bacteria 2132
770 Ga0587088_051234 3300059508 Bacteria 809
771 Ga0587090_000103 3300059510 Bacteria 5190
772 Ga0587090_017172 3300059510 Bacteria 1090
773 Ga0587090_039636 3300059510 Bacteria 824
774 Ga0587091_000602 3300059511 Bacteria 3266
775 Ga0587091_024930 3300059511 Bacteria 1077
776 Ga0587092_002802 3300059512 Bacteria 1908
777 Ga0587094_000321 3300059513 Bacteria 3424
778 Ga0587094_002189 3300059513 Bacteria 1994
779 Ga0587094_043731 3300059513 Bacteria 738
780 Ga0587098_003483 3300059604 Bacteria 1419
781 Ga0587106_001586 3300059605 Bacteria 2051
782 Ga0587106_018932 3300059605 Bacteria 999
783 Ga0587101_000304 3300059623 Bacteria 3203
784 Ga0587101_001275 3300059623 Bacteria 2125
785 Ga0587109_005775 3300059624 Bacteria 1793
786 Ga0587109_008034 3300059624 Bacteria 1616
787 Ga0587117_006963 3300059627 Bacteria 1281
788 Ga0587128_000155 3300059630 Bacteria 3915
789 Ga0587130_001421 3300059631 Bacteria 1796
790 Ga0587062_000345 3300059639 Bacteria 3091
791 Ga0587062_004842 3300059639 Bacteria 1455
792 Ga0587067_017835 3300059640 Bacteria 1183
793 Ga0587067_037096 3300059640 Bacteria 930
794 Ga0587068_001888 3300059641 Bacteria 2453
795 Ga0587068_003523 3300059641 Bacteria 2008
796 Ga0587068_011530 3300059641 Bacteria 1336
797 Ga0587069_003378 3300059642 Bacteria 1718
798 Ga0587072_000465 3300059643 Bacteria 4091
799 Ga0587072_001652 3300059643 Bacteria 2829
800 Ga0587075_002011 3300059644 Bacteria 2084
801 Ga0587076_000240 3300059645 Bacteria 3937
802 Ga0587076_017531 3300059645 Bacteria 1142
803 Ga0587078_010264 3300059646 Bacteria 1074
804 Ga0587079_000801 3300059647 Bacteria 3135
805 Ga0587079_030358 3300059647 Bacteria 1035
806 Ga0587105_000871 3300059651 Bacteria 1421
807 Ga0587118_01084 3300059657 Bacteria 1576
808 Ga0587124_000584 3300059660 Bacteria 2065
809 Ga0587060_004618 3300060243 Bacteria 1051
810 Ga0587071_003799 3300060344 Bacteria 2202
811 Ga0587111_0000908 3300060346 Bacteria 3234
812 Ga0587111_0006703 3300060346 Bacteria 1840
813 Ga0587111_0118641 3300060346 Bacteria 679
814 Ga0501082_0023114 3300060353 Bacteria 5361
815 2916183177 2916178963 Bacteria 5265078
816 Ga0163163_10609324
817 JGI24741J21665_1004572
818 JGI24740J21852_10000716
819 JGI24739J22299_10005573
820 JGI24739J22299_10006228
821 JGI25158J39367_1009791
822 JGI25150J39212_1011090
823 JGI25159J45721_1009651
824 Ga0006778J45830_1029808
825 Ga0006759J45824_1026758
826 Ga0006759J45824_1041332
827 JGI25151J46595_10048619
828 JGI25406J46586_10001890
829 JGI25153J46596_10009183
830 Ga0006770J48903_1021777
831 Ga0006777J48905_1014711
832 Ga0006777J48905_1024445
833 JGI25160J50197_1015271
834 Ga0007417J51691_1019108
835 Ga0007417J51691_1023048
836 Ga0007417J51691_1026934
837 Ga0007417J51691_1031652
838 Ga0007417J51691_1036075
839 Ga0007427J51700_102207
840 Ga0007409J51694_1016865
841 Ga0007409J51694_1025783
842 Ga0007416J51690_1015113
843 Ga0007416J51690_1015868
844 Ga0007416J51690_1018729
845 Ga0006562J51391_1006937
846 Ga0007429J51699_1025377
847 Ga0007429J51699_1030503
848 Ga0007429J51699_1031188
849 Ga0032354_1016955
850 Ga0032354_1032192
851 Ga0006780_1015081
852 Ga0055526_1017252
853 Ga0055537_1004203
854 Ga0055537_1014729
855 Ga0055524_1035313
856 Ga0055536_1047962
857 Ga0055536_1051831
858 Ga0055536_1075462
859 Ga0055534_1006266
860 Ga0055534_1015354
861 Ga0055528_1016289
862 Ga0055528_1034371
863 Ga0055530_10008834
864 Ga0055530_10012175
865 Ga0055540_1042642
866 Ga0055540_1044664
867 Ga0055531_10033423
868 Ga0055531_10039854
869 Ga0058859_10052933
870 Ga0058859_11829956
871 Ga0058860_10009064
872 Ga0058860_10186761
873 Ga0058860_10214308
874 Ga0065714_10027962
875 Ga0065714_10158514
876 Ga0065712_10074499
877 Ga0065715_10106550
878 Ga0065707_10215781
879 Ga0070658_10356979
880 Ga0070676_10185933
881 Ga0070690_100006708
882 Ga0070670_100378176
883 Ga0070677_10072891
884 Ga0068869_100056142
885 Ga0068869_100215849
886 Ga0068869_100941076
887 Ga0070666_10092651
888 Ga0070666_10103470
889 Ga0070680_100019977
890 Ga0070680_100069044
891 Ga0070680_100350879
892 Ga0070680_100374628
893 Ga0070680_100610128
894 Ga0070680_100636696
895 Ga0070682_100052281
896 Ga0068868_100136307
897 Ga0070660_100053777
898 Ga0070689_100211438
899 Ga0070689_100301171
900 Ga0070687_100029641
901 Ga0070687_100209667
902 Ga0070661_100029789
903 Ga0070661_100229732
904 Ga0070661_100962396
905 Ga0070692_10258417
906 Ga0070668_100765517
907 Ga0070669_100141295
908 Ga0070675_100007285
909 Ga0070675_100433384
910 Ga0070671_100010269
911 Ga0070671_100016693
912 Ga0070674_100039655
913 Ga0070673_100001460
914 Ga0070673_100002927
915 Ga0070673_100041732
916 Ga0070673_100280745
917 Ga0070673_100549002
918 Ga0070673_100584186
919 Ga0070688_100320755
920 Ga0070659_100034931
921 Ga0070659_100120047
922 Ga0070659_100368845
923 Ga0070667_100332219
924 Ga0070703_10000400
925 Ga0070703_10145160
926 Ga0070714_100064265
927 Ga0070714_100277699
928 Ga0070701_10041215
929 Ga0070705_100003035
930 Ga0070705_100022459
931 Ga0070705_100106797
932 Ga0070705_100124626
933 Ga0070705_100214267
934 Ga0070700_100049407
935 Ga0070700_100139715
936 Ga0070694_100022048
937 Ga0070694_100063548
938 Ga0070694_100100652
939 Ga0070694_100154448
940 Ga0070708_100013626
941 Ga0070708_100028181
942 Ga0070708_100082508
943 Ga0070663_100067972
944 Ga0070663_100532554
945 Ga0070678_100244663
946 Ga0070662_100004028
947 Ga0070662_100067224
948 Ga0070662_100305039
949 Ga0070681_10086876
950 Ga0070681_10288080
951 Ga0070681_10369382
952 Ga0068867_100069210
953 Ga0068867_100134329
954 Ga0068867_100176567
955 Ga0068867_100527146
956 Ga0070685_10017229
957 Ga0070707_100062884
958 Ga0070698_100068456
959 Ga0070698_100133819
960 Ga0070699_100056651
961 Ga0070699_100114998
962 Ga0070699_100292093
963 Ga0070699_100350041
964 Ga0070699_100425763
965 Ga0070679_100014497
966 Ga0070679_100080125
967 Ga0070679_100308477
968 Ga0070679_100990665
969 Ga0070684_100002468
970 Ga0070697_100020637
971 Ga0068853_100016308
972 Ga0068853_100095738
973 Ga0070672_100271918
974 Ga0070672_100673087
975 Ga0070695_100001266
976 Ga0070695_100052468
977 Ga0070696_100004428
978 Ga0070696_100012543
979 Ga0070696_100130165
980 Ga0070693_100418945
981 Ga0070704_100017182
982 Ga0070704_100029374
983 Ga0070704_100044791
984 Ga0070704_100061575
985 Ga0070704_100317803
986 Ga0068855_100014830
987 Ga0068855_100166634
988 Ga0068855_100437729
989 Ga0070664_100006687
990 Ga0070664_100008228
991 Ga0070664_100013860
992 Ga0070664_100450397
993 Ga0068857_100045215
994 Ga0068854_100289027
995 Ga0068854_100625679
996 Ga0068856_100010722
997 Ga0068852_100028512
998 Ga0068852_100095276
999 Ga0068852_100110169
1000 Ga0068859_100021700
1001 Ga0068859_100044541
1002 Ga0068864_100008073
1003 Ga0068866_10067750
1004 Ga0068861_100101114
1005 Ga0068870_10015340
1006 Ga0068870_10350063
1007 Ga0068863_100014731
1008 Ga0068858_100048082
1009 Ga0068858_100893435
1010 Ga0068860_100027786
1011 Ga0068860_100260632
1012 Ga0068862_100310839
1013 Ga0068862_100542173
1014 Ga0081539_10000072
1015 Ga0081539_10010390
1016 Ga0075363_100159794
1017 Ga0075432_10057024
1018 Ga0075362_10011450
1019 Ga0075369_10084690
1020 Ga0075366_10296814
1021 Ga0075366_10311607
1022 Ga0075366_10680971
1023 Ga0097621_100327316
1024 Ga0097621_100334685
1025 Ga0075370_10034040
1026 Ga0075370_10238221
1027 Ga0075370_10393149
1028 Ga0068871_100242168
1029 Ga0068871_100534208
1030 Ga0075428_100015919
1031 Ga0075428_100022001
1032 Ga0075428_100382680
1033 Ga0075428_100661623
1034 Ga0075430_100000579
1035 Ga0075430_100199474
1036 Ga0075430_100287335
1037 Ga0075430_100358361
1038 Ga0075430_100652607
1039 Ga0075431_100001591
1040 Ga0075431_100025866
1041 Ga0075431_100140879
1042 Ga0075431_100147666
1043 Ga0075433_10079601
1044 Ga0075433_10202721
1045 Ga0075434_100000895
1046 Ga0075434_100208963
1047 Ga0075429_100000220
1048 Ga0075429_100159107
1049 Ga0068865_100046149
1050 Ga0068865_100101448
1051 Ga0068865_100187829
1052 Ga0075436_100000458
1053 Ga0075436_100002331
1054 Ga0075436_100015864
1055 Ga0075436_100069889
1056 Ga0075436_100099710
1057 Ga0097620_100021700
1058 Ga0097620_100044539
1059 Ga0097620_100323614
1060 Ga0079104_1014245
1061 Ga0099826_10069594
1062 Ga0075435_100019527
1063 Ga0075435_100136570
1064 Ga0105244_10026727
1065 Ga0105240_10005705
1066 Ga0111539_10002099
1067 Ga0111539_10030319
1068 Ga0111539_10069166
1069 Ga0111539_10362918
1070 Ga0111539_10701290
1071 Ga0111539_11069052
1072 Ga0114129_10011902
1073 Ga0114129_10208912
1074 Ga0114129_10220005
1075 Ga0114129_11188854
1076 Ga0105243_10630506
1077 Ga0105243_12051075
1078 Ga0105243_12085833
1079 Ga0105241_10323095
1080 Ga0105242_10326915
1081 Ga0105242_10469341
1082 Ga0105248_10023039
1083 Ga0105248_10717995
1084 Ga0105237_10421778
1085 Ga0105238_10522421
1086 Ga0105238_10658582
1087 Ga0105238_10751449
1088 Ga0105238_10766444
1089 Ga0105249_10177663
1090 Ga0105239_10706655
1091 Ga0105246_10042758
1092 Ga0105246_10364201
1093 Ga0157346_1003591
1094 Ga0157323_1008725
1095 Ga0157347_1012960
1096 Ga0157373_10012089
1097 Ga0157371_10006761
1098 Ga0157370_10090529
1099 Ga0157370_10739382
1100 Ga0157369_10071959
1101 Ga0157374_10123485
1102 Ga0157374_10461078
1103 Ga0157374_10727480
1104 Ga0157374_10798823
1105 Ga0163162_10024660
1106 Ga0163162_10103155
1107 Ga0163162_10644326
1108 Ga0157372_10016866
1109 Ga0157375_10116678
1110 Ga0157375_11895917
1111 Ga0163163_10001656
1112 Ga0157380_10582114
1113 Ga0182008_10113002
1114 Ga0182008_10157003
1115 Ga0182008_10271223
1116 Ga0157379_10120127
1117 Ga0182006_1075350
1118 Ga0182006_1102517
1119 Ga0182007_10051104
1120 Ga0182007_10052106
1121 Ga0182005_1068779
1122 Ga0183362_10007
1123 Ga0163161_10615837
1124 Ga0163161_11029929
1125 Ga0206356_11893467
1126 Ga0206355_1552327
1127 Ga0213873_10005735
1128 Ga0213874_10005081
1129 Ga0213876_10026215
1130 Ga0213876_10207718
1131 Ga0213875_10007338
1132 Ga0213875_10042663
1133 Ga0213871_10003980
1134 Ga0224712_10221828
1135 Ga0209436_104800
1136 Ga0207425_1000229
1137 Ga0209129_1000049
1138 Ga0209129_1024502
1139 Ga0209565_1000259
1140 Ga0209565_1004429
1141 Ga0209673_1000193
1142 Ga0209673_1052955
1143 Ga0209130_1000974
1144 Ga0209130_1008050
1145 Ga0209675_1000220
1146 Ga0209675_1038691
1147 Ga0209676_1000074
1148 Ga0209676_1030737
1149 Ga0209676_1054478
1150 Ga0209676_1054927
1151 Ga0209025_1000283
1152 Ga0209025_1001101
1153 Ga0209025_1003538
1154 Ga0209025_1084676
1155 Ga0209564_1048460
1156 Ga0209758_1006862
1157 Ga0209050_1000015
1158 Ga0209050_1000884
1159 Ga0209050_1089446
1160 Ga0209256_1000264
1161 Ga0209256_1000304
1162 Ga0207426_1000108
1163 Ga0207426_1003089
1164 Ga0209051_1000010
1165 Ga0209051_1007601
1166 Ga0209051_1076516
1167 Ga0209051_1099766
1168 Ga0209257_1000026
1169 Ga0209257_1012374
1170 Ga0209257_1053358
1171 Ga0207655_1008322
1172 Ga0207653_10000147
1173 Ga0207682_10076447
1174 Ga0207692_10395007
1175 Ga0207688_10094893
1176 Ga0207688_10137772
1177 Ga0207680_10059785
1178 Ga0207643_10017736
1179 Ga0207705_10053354
1180 Ga0207684_10013749
1181 Ga0207654_10292608
1182 Ga0207707_10007445
1183 Ga0207707_10059928
1184 Ga0207707_10264771
1185 Ga0207695_10190389
1186 Ga0207695_10507656
1187 Ga0207671_10059266
1188 Ga0207693_10422652
1189 Ga0207660_10098020
1190 Ga0207660_10113538
1191 Ga0207660_10158887
1192 Ga0207660_10469812
1193 Ga0207662_10011340
1194 Ga0207662_10117611
1195 Ga0207662_10151084
1196 Ga0207657_10152752
1197 Ga0207657_10155405
1198 Ga0207649_10011951
1199 Ga0207649_10305554
1200 Ga0207652_10037810
1201 Ga0207652_10224142
1202 Ga0207652_10403528
1203 Ga0207681_10155862
1204 Ga0207694_10415352
1205 Ga0207694_10473300
1206 Ga0207659_10088367
1207 Ga0207687_10406029
1208 Ga0207644_10047301
1209 Ga0207690_10039856
1210 Ga0207690_10271619
1211 Ga0207706_10054467
1212 Ga0207706_10091051
1213 Ga0207686_10355329
1214 Ga0207709_10045083
1215 Ga0207709_10297069
1216 Ga0207670_10020451
1217 Ga0207670_10038917
1218 Ga0207670_10177861
1219 Ga0207669_10203759
1220 Ga0207669_10334633
1221 Ga0207669_10439485
1222 Ga0207704_10036321
1223 Ga0207665_10125879
1224 Ga0207665_10171621
1225 Ga0207691_10049054
1226 Ga0207711_10112524
1227 Ga0207689_10049975
1228 Ga0207689_10085566
1229 Ga0207689_10231021
1230 Ga0207689_10930067
1231 Ga0207679_10025616
1232 Ga0207667_10019371
1233 Ga0207667_10100133
1234 Ga0207651_10077458
1235 Ga0207651_10159533
1236 Ga0207640_10365277
1237 Ga0207658_10046716
1238 Ga0207677_10068962
1239 Ga0207677_10226453
1240 Ga0207639_10042136
1241 Ga0207708_10055258
1242 Ga0207708_10398295
1243 Ga0207641_10041536
1244 Ga0207648_10011251
1245 Ga0207648_10082194
1246 Ga0207648_10086281
1247 Ga0207648_10160477
1248 Ga0207648_11246015
1249 Ga0207674_10042433
1250 Ga0207674_10053786
1251 Ga0207675_100008162
1252 Ga0207683_10015833
1253 Ga0207683_10071406
1254 Ga0207683_10281226
1255 Ga0207683_10519516
1256 Ga0207698_10575450
1257 Ga0209973_1000069
1258 Ga0209969_1000547
1259 Ga0209969_1004709
1260 Ga0209996_1025717
1261 Ga0209984_1001298
1262 Ga0209995_1003999
1263 Ga0209982_1008959
1264 Ga0209970_1015084
1265 Ga0210002_1022344
1266 Ga0209282_1003491
1267 Ga0209588_1007867
1268 Ga0209971_1000807
1269 Ga0209971_1006804
1270 Ga0209998_10022649
1271 Ga0209974_10000163
1272 Ga0209974_10003782
1273 Ga0209974_10267143
1274 Ga0207428_10002412
1275 Ga0207428_10030776
1276 Ga0207428_10071241
1277 Ga0207428_10303746
1278 Ga0268266_10218724
1279 Ga0268265_10047074
1280 Ga0268265_10237018
1281 Ga0268265_10785551
1282 Ga0268264_10152605
1283 Ga0268264_10358307
1284 Ga0265336_10000028
1285 Ga0307515_10000063
1286 Ga0265324_10000286
1287 Ga0316176_1026337
1288 Ga0314311_1100006
1289 Ga0316179_1028317
1290 Ga0316178_1042489
1291 Ga0316181_1030196
1292 Ga0265327_10000530
1293 Ga0265327_10025070
1294 Ga0307513_10034953
1295 Ga0307513_10140898
1296 Ga0307408_100108217
1297 Ga0307514_10012779
1298 Ga0316575_10289858
1299 Ga0307516_10040356
1300 Ga0307405_10128992
1301 Ga0307405_10180379
1302 Ga0307410_10129185
1303 Ga0307410_10501716
1304 Ga0307406_10160574
1305 Ga0307406_10840550
1306 Ga0307406_11309278
1307 Ga0307412_10060492
1308 Ga0307412_10151103
1309 Ga0307412_10648449
1310 Ga0307416_100008391
1311 Ga0307416_100349609
1312 Ga0307416_100423956
1313 Ga0307416_101550545
1314 Ga0307416_101984146
1315 Ga0307414_10176548
1316 Ga0307414_10363118
1317 Ga0307411_10057799
1318 Ga0307411_10215887
1319 Ga0316593_10002246
1320 Ga0316592_1004459
1321 Ga0316586_1003618
1322 Ga0373960_0028386
1323 Ga0373960_0108029
1324 Ga0373942_0002486
1325 Ga0373961_0010397
1326 Ga0373962_0039397
1327 Ga0373931_0013113
1328 Ga0373931_0041836
1329 Ga0373931_0078947
1330 Ga0310112_036327
1331 Ga0310110_007052
1332 Ga0316582_0519370
1333 Ga0436364_0268578
1334 Ga0436364_0367144
1335 Ga0436364_0586291
1336 Ga0436364_0999134
1337 Ga0436364_1269112
1338 Ga0395901_0093407
1339 Ga0395901_0996361
1340 Ga0400488_36468
1341 Ga0400483_046311
1342 Ga0400483_217885
1343 Ga0436365_0582907
1344 Ga0436365_1050783
1345 Ga0436360_0521510
1346 Ga0436360_1229176
1347 Ga0436363_0315020
1348 Ga0436362_0967331
1349 Ga0439436_0003093
1350 Ga0439436_0032700
1351 Ga0439447_043915
1352 Ga0439466_0011037
1353 Ga0439466_0113912
1354 Ga0439466_0144042
1355 Ga0451790_09628
1356 Ga0451807_2673306
1357 Ga0451837_1413189
1358 Ga0451843_1564654
1359 Ga0439431_0095624
1360 Ga0439433_0000255
1361 Ga0439441_002636
1362 Ga0439441_004832
1363 Ga0439442_109674
1364 Ga0439445_0009991
1365 Ga0439445_0076461
1366 Ga0439448_0046748
1367 Ga0439432_055254
1368 Ga0439449_0001595
1369 Ga0439450_006570
1370 Ga0439452_013342
1371 Ga0439454_018792
1372 Ga0439456_019918
1373 Ga0439463_052505
1374 Ga0439463_108396
1375 Ga0450914_032829
1376 Ga0450919_004876
1377 Ga0450923_034358
1378 Ga0450889_007261
1379 Ga0450889_015102
1380 Ga0450906_005991
1381 Ga0450906_051648
1382 Ga0439446_0023464
1383 Ga0450908_002334
1384 Ga0439434_0032682
1385 Ga0439434_0182856
1386 Ga0439435_0000603
1387 Ga0439444_0004900
1388 Ga0439459_0066512
1389 Ga0450918_002211
1390 Ga0451577_0053817
1391 Ga0453683_0067276
1392 Ga0466964_0020860
1393 Ga0466957_0356958
1394 Ga0451576_0013761
1395 Ga0451576_0033871
1396 Ga0451576_0121787
1397 Ga0451576_0179640
1398 Ga0451576_0566765
1399 Ga0451576_0683828
1400 Ga0466967_0016890
1401 Ga0495651_0074163
1402 Ga0495639_0004974
1403 Ga0495639_0020558
1404 Ga0495620_0000768
1405 Ga0495630_0640577
1406 Ga0495631_0000382
1407 Ga0495637_0001023
1408 Ga0495643_0417802
1409 Ga0495663_0022131
1410 Ga0495663_0035009
1411 Ga0495663_0075447
1412 Ga0495642_0004003
1413 Ga0495642_0043098
1414 Ga0495642_0045618
1415 Ga0495654_0009083
1416 Ga0495587_0298808
1417 Ga0495621_0008009
1418 Ga0495621_0039015
1419 Ga0495656_0004795
1420 Ga0495634_0234977
1421 Ga0495659_0075806
1422 Ga0495661_0188499
1423 Ga0495588_0011885
1424 Ga0495588_0120113
1425 Ga0495599_0120540
1426 Ga0495669_0060172
1427 Ga0495671_0026835
1428 Ga0495681_0075653
1429 Ga0495686_0067186
1430 Ga0495602_0185169
1431 Ga0495614_0001793
1432 Ga0495615_0004514
1433 Ga0496100_0157178
1434 Ga0496102_0007579
1435 Ga0496103_0009380
1436 Ga0496104_0008378
1437 Ga0496105_0028921
1438 Ga0496106_0079001
1439 Ga0496106_0113183
1440 Ga0496106_0133222
1441 Ga0496109_0054951
1442 Ga0496110_0026383
1443 Ga0496110_0037852
1444 Ga0496111_0004330
1445 Ga0496113_0036282
1446 Ga0496114_0014567
1447 Ga0496114_0151283
1448 Ga0496114_0371021
1449 Ga0496114_0870224
1450 Ga0496117_0016815
1451 Ga0496117_0039927
1452 Ga0496118_0032494
1453 Ga0496118_0157974
1454 Ga0496121_0087873
1455 Ga0496123_0093895
1456 Ga0496124_0043393
1457 Ga0496124_0370611
1458 Ga0496125_0046394
1459 Ga0501306_004022
1460 Ga0501308_020699
1461 Ga0501310_002191
1462 Ga0501304_002322
1463 Ga0501305_047242
1464 Ga0501307_007146
1465 Ga0501299_019439
1466 Ga0501311_009392
1467 Ga0501315_000369
1468 Ga0501317_000342
1469 Ga0501318_003986
1470 Ga0501318_024398
1471 Ga0501320_000194
1472 Ga0501320_029813
1473 Ga0501323_002136
1474 Ga0501326_00563
1475 Ga0501337_000344
1476 Ga0501031_0018650
1477 Ga0501031_0385029
1478 Ga0501034_0017280
1479 Ga0501034_0245099
1480 Ga0501036_0207451
1481 Ga0501040_0205759
1482 Ga0501041_0000437
1483 Ga0501041_0140688
1484 Ga0501042_0056634
1485 Ga0501047_0034449
1486 Ga0501068_0049147
1487 Ga0501071_0148530
1488 Ga0501072_0061311
1489 Ga0501072_0266946
1490 Ga0501073_0275168
1491 Ga0501075_0001690
1492 Ga0501075_0156299
1493 Ga0501076_0160766
1494 Ga0501076_0183238
1495 Ga0501077_0052597
1496 Ga0501077_0059400
1497 Ga0501227_024312
1498 Ga0501079_0011454
1499 Ga0501080_0020230
1500 Ga0501081_0002862
1501 Ga0501266_019081
1502 Ga0501275_021399
1503 Ga0501044_0321425
1504 Ga0501045_0050583
1505 nmdc:mga03683_232502_c1
1506 nmdc:mga03n38_276738_c1
1507 nmdc:mga00v17_318955_c1
1508 nmdc:mga0k408_262742_c1
1509 nmdc:mga07m45_32442_c1
1510 nmdc:mga07m45_362120_c1
1511 nmdc:mga07m45_422106_c1
1512 nmdc:mga05p37_21387_c1
1513 nmdc:mga05p37_431_c1
1514 nmdc:mga05p37_8872_c1
1515 nmdc:mga05p37_95049_c2
1516 nmdc:mga05p37_96645_c1
1517 nmdc:mga09592_12683_c1
1518 nmdc:mga09592_16325_c1
1519 nmdc:mga09592_229_c1
1520 nmdc:mga0qj67_1458_c1
1521 nmdc:mga0qj67_237097_c1
1522 nmdc:mga0qj67_244007_c1
1523 nmdc:mga0qj67_45551_c1
1524 nmdc:mga0qj67_80795_c1
1525 nmdc:mga0qj67_88658_c1
1526 nmdc:mga06r32_14275_c1
1527 nmdc:mga06r32_14300_c1
1528 nmdc:mga06r32_15454_c1
1529 nmdc:mga06r32_163193_c1
1530 nmdc:mga06r32_18350_c1
1531 nmdc:mga06r32_295656_c1
1532 nmdc:mga08y16_21701_c1
1533 nmdc:mga08y16_236540_c1
1534 nmdc:mga08y16_2559_c1
1535 nmdc:mga08y16_26203_c1
1536 nmdc:mga08y16_32031_c1
1537 nmdc:mga08y16_663948_c1
1538 nmdc:mga08y16_72548_c1
1539 nmdc:mga08y16_760951_c1
1540 nmdc:mga0n895_129139_c1
1541 nmdc:mga0n895_570_c1
1542 nmdc:mga0n895_884166_c1
1543 nmdc:mga0rr50_41258_c1
1544 nmdc:mga0rr50_48290_c1
1545 nmdc:mga0rr50_84504_c1
1546 nmdc:mga08x19_36877_c1
1547 nmdc:mga08x19_60071_c1
1548 nmdc:mga08x19_945_c1
1549 nmdc:mga0a205_104296_c1
1550 Ga0495612_0213198
1551 Ga0500643_118205
1552 Ga0500651_0000298
1553 Ga0500571_006617
1554 Ga0500594_0000901
1555 Ga0500608_001875
1556 Ga0500658_0005673
1557 Ga0500568_0002630
1558 Ga0500574_000173
1559 Ga0500616_0022445
1560 Ga0500634_0211105
1561 Ga0500645_030754
1562 Ga0501084_0219012
1563 Ga0587084_000180
1564 Ga0587084_007162
1565 Ga0587084_007363
1566 Ga0587093_000167
1567 Ga0587066_002638
1568 Ga0587066_004366
1569 Ga0587070_002983
1570 Ga0587070_007508
1571 Ga0587070_044518
1572 Ga0587073_0003829
1573 Ga0587073_0010063
1574 Ga0587077_005673
1575 Ga0587080_000720
1576 Ga0587080_006577
1577 Ga0587082_002720
1578 Ga0587083_0000314
1579 Ga0587083_0008988
1580 Ga0587085_001947
1581 Ga0587085_030805
1582 Ga0587086_001748
1583 Ga0587088_000197
1584 Ga0587088_002368
1585 Ga0587088_051234
1586 Ga0587090_000103
1587 Ga0587090_017172
1588 Ga0587090_039636
1589 Ga0587091_000602
1590 Ga0587091_024930
1591 Ga0587092_002802
1592 Ga0587094_000321
1593 Ga0587094_002189
1594 Ga0587094_043731
1595 Ga0587098_003483
1596 Ga0587106_001586
1597 Ga0587106_018932
1598 Ga0587101_000304
1599 Ga0587101_001275
1600 Ga0587109_005775
1601 Ga0587109_008034
1602 Ga0587117_006963
1603 Ga0587128_000155
1604 Ga0587130_001421
1605 Ga0587062_000345
1606 Ga0587062_004842
1607 Ga0587067_017835
1608 Ga0587067_037096
1609 Ga0587068_001888
1610 Ga0587068_003523
1611 Ga0587068_011530
1612 Ga0587069_003378
1613 Ga0587072_000465
1614 Ga0587072_001652
1615 Ga0587075_002011
1616 Ga0587076_000240
1617 Ga0587076_017531
1618 Ga0587078_010264
1619 Ga0587079_000801
1620 Ga0587079_030358
1621 Ga0587105_000871
1622 Ga0587118_01084
1623 Ga0587124_000584
1624 Ga0587060_004618
1625 Ga0587071_003799
1626 Ga0587111_0000908
1627 Ga0587111_0006703
1628 Ga0587111_0118641
1629 Ga0501082_0023114
1630 2916183177

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

72

128

1

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

132

226

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9769 4 177
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9732 4 177
5mmm-assembly1.cif.gz_F structure of the 70s chloroplast ribosome 0.973 2 177
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9691 4 179
8crx-assembly1.cif.gz_f cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.9677 1 178
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9671 2 177 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9565 2 177 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9216 22 177 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9166 22 179 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9119 22 171 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A7V8D9M7-F1-model_v4 50S ribosomal protein L5 0.9938 2 123 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3N5JZE8-F1-model_v4 50S ribosomal protein L5 0.993 2 128 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C7UBM4-F1-model_v4 50S ribosomal protein L5 0.9922 1 124 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A6B0WZ30-F1-model_v4 50S ribosomal protein L5 0.9915 1 130 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3C1DEH0-F1-model_v4 50S ribosomal protein L5 0.9904 2 116 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map