F482015

General Info

Members Datasets Scaffolds Average Seq Length
815 594 1630 329

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1002792|Ga0209025_100279212
Length 320
Sequence MRLKSLALALAGVALSAMTAVAQTAIKPAVVYDKGGKFDKSFNEGVFVGAEKFKTETGVEFRDFEPTNDAQIEQALRRFARDGHSPIIAVGFSQATALQKVAAEFPNLKFTIIDMVVELPNVQSVVFKEHEGSYLVGLLAGMDIPLIRKFACGYVQGVKAGKKDAEIFQNMTGSTPAAWNDPVKGGELAKSQIDRGADVIYHAAGGTGIGVLRAAADAGKLGIGVDSNQNMLHPGKILTSMLKRVDVAAYNSFKAARDGNWKPGVSVLGLKEDGIGWALDDNNKALITPEMKAAADKAKADIIAGTVKVHDYMSDSKCSM

Samples

Sample ID Description Type Environment
1 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
214 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
219 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
222 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
223 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
227 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
228 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
287 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
305 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
306 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
307 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
308 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
312 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
315 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
316 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
317 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
320 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
321 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
326 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
327 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
330 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
333 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
334 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
335 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
336 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
337 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
338 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
339 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
340 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
341 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
342 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
343 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
344 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
345 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
346 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
347 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
348 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
349 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
350 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
351 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
352 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
353 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
354 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
355 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
356 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
357 2519899620 Rhizobium sp. Pop5 Isolate Nodule
358 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
359 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
360 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
361 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
362 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
363 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
364 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
365 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
366 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
367 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
368 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
369 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
370 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
371 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
372 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
373 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
374 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
375 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
376 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
377 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
378 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
379 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
380 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
381 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
382 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
383 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
384 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
385 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
386 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
387 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
388 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
389 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
390 2643221599 Rhizobium sp. Root708 Isolate Unclassified
391 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
392 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
393 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
394 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
395 2643221719 Rhizobium sp. Root274 Isolate Unclassified
396 2643221734 Bosea sp. Root670 Isolate Unclassified
397 2643221736 Bosea sp. Root483D1 Isolate Unclassified
398 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
399 2718217882 Rhizobium sp. N741 Isolate Nodule
400 2718217927 Rhizobium sp. N324 Isolate Nodule
401 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
402 2718218009 Rhizobium sp. N561 Isolate Nodule
403 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
404 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
405 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
406 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
407 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
408 2718218363 Rhizobium sp. N113 Isolate Nodule
409 2718218365 Rhizobium sp. N731 Isolate Nodule
410 2718218366 Rhizobium sp. N621 Isolate Nodule
411 2718218423 Rhizobium sp. N941 Isolate Nodule
412 2721755514 Rhizobium sp. N6212 Isolate Nodule
413 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
414 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
415 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
416 2721755809 Rhizobium sp. N541 Isolate Nodule
417 2721755810 Rhizobium sp. N871 Isolate Nodule
418 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
419 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
420 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
421 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
422 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
423 2728369365 Rhizobium sp. N1341 Isolate Nodule
424 2728369397 Rhizobium sp. N1314 Isolate Nodule
425 2738541293 Rhizobium sp. GV031 Isolate Unclassified
426 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
427 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
428 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
429 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
430 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
431 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
432 2791355256 Rhizobium sp. M10 Isolate Nodule
433 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
434 2791355260 Rhizobium sp. L9 Isolate Nodule
435 2791355261 Rhizobium sp. J15 Isolate Nodule
436 2791355262 Rhizobium sp. M1 Isolate Nodule
437 2791355263 Rhizobium chutanense C5 Isolate Nodule
438 2791355264 Rhizobium sp. S9 Isolate Nodule
439 2791355265 Rhizobium sp. H4 Isolate Nodule
440 2791355266 Rhizobium sp. L43 Isolate Nodule
441 2791355267 Rhizobium sp. L18 Isolate Nodule
442 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
443 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
444 2802429633 Rhizobium anhuiense J3 Isolate Nodule
445 2802429634 Rhizobium anhuiense S10 Isolate Nodule
446 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
447 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
448 2802429637 Rhizobium anhuiense C15 Isolate Nodule
449 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
450 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
451 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
452 2818991467 Bosea vestrisii 3192 Isolate Unclassified
453 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
454 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
455 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
456 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
457 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
458 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
459 2838048938 Rhizobium pisi 27/80 Isolate Nodule
460 2838061910 Rhizobium phaseoli L15 Isolate Nodule
461 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
462 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
463 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
464 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
465 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
466 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
467 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
468 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
469 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
470 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
471 2841760612 Bosea sp. Tri-49 Isolate Nodule
472 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
473 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
474 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
475 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
476 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
477 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
478 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
479 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
480 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
481 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
482 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
483 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
484 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
485 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
486 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
487 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
488 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
489 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
490 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
491 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
492 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
493 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
494 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
495 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
496 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
497 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
498 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
499 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
500 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
501 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
502 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
503 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
504 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
505 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
506 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
507 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
508 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
509 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
510 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
511 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
512 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
513 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
514 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
515 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
516 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
517 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
518 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
519 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
520 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
521 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
522 2844104063 Bosea sp. Tri-39 Isolate Nodule
523 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
524 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
525 2851182111 Bosea sp. Tri-44 Isolate Nodule
526 2851246043 Bosea sp. Tri-54 Isolate Nodule
527 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
528 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
529 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
530 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
531 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
532 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
533 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
534 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
535 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
536 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
537 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
538 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
539 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
540 2933599457 Rhizobium phaseoli M3 Isolate Nodule
541 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
542 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
543 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
544 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
545 2936381700 Rhizobium chutanense C16 Isolate Unclassified
546 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
547 2996887358 Rhizobium sp. R711 Isolate Nodule
548 2996893221 Rhizobium sp. R635 Isolate Nodule
549 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
550 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
551 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
552 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
553 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
554 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
555 8005258706 Rhizobium sp. R693 Isolate Nodule
556 8005275841 Rhizobium sp. N4311 Isolate Nodule
557 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
558 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
559 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
560 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
561 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
562 8005321885 Rhizobium sp. R72 Isolate Nodule
563 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
564 8005382845 Rhizobium sp. R634 Isolate Nodule
565 8005395548 Rhizobium sp. R339 Isolate Nodule
566 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
567 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
568 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
569 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
570 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
571 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
572 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
573 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
574 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
575 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
576 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
577 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
578 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
579 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
580 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
581 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
582 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
583 8018176218 Rhizobium sp. N122 Isolate Nodule
584 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
585 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
586 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
587 8024501048 Rhizobium sp. H4 Isolate Nodule
588 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
589 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
590 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
591 8056382006 Rhizobium croatiense 13T Isolate Nodule
592 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
593 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
594 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.12
Metatranscriptomes 0.61
Isolates 32.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.09
Nodule 22.82
Rhizoplane 0.49
Rhizosphere 41.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209025_1002792 3300025294 Bacteria 17614
2 JGI25155J39150_1000110 3300002704 Bacteria 43893
3 JGI25156J39149_1000192 3300002705 Bacteria 44040
4 JGI25162J39368_1000302 3300002737 Bacteria 45304
5 JGI25162J39368_1001704 3300002737 Bacteria 10701
6 JGI25154J39366_1000196 3300002738 Bacteria 44040
7 JGI25157J39369_1000228 3300002741 Bacteria 44040
8 JGI25152J39213_1001971 3300002773 Bacteria 8129
9 JGI25152J39213_1003728 3300002773 Bacteria 5096
10 JGI25152J39213_1006980 3300002773 Bacteria 2979
11 JGI25152J39213_1007954 3300002773 Bacteria 2684
12 JGI25150J39212_1000261 3300002774 Bacteria 28057
13 JGI25150J39212_1012436 3300002774 Bacteria 1508
14 JGI25159J45721_1000790 3300002987 Bacteria 13778
15 JGI25159J45721_1001258 3300002987 Bacteria 10693
16 JGI25151J46595_10000359 3300003187 Bacteria 48264
17 JGI25151J46595_10002653 3300003187 Bacteria 10514
18 JGI25151J46595_10002809 3300003187 Bacteria 10061
19 JGI25151J46595_10022409 3300003187 Bacteria 2623
20 JGI25165J46597_1000390 3300003214 Bacteria 46779
21 JGI25165J46597_1001069 3300003214 Bacteria 17583
22 JGI25165J46597_1005760 3300003214 Bacteria 2318
23 JGI25153J46596_10005292 3300003215 Bacteria 6784
24 JGI25153J46596_10006944 3300003215 Bacteria 5642
25 JGI25153J46596_10013626 3300003215 Bacteria 3425
26 JGI25153J46596_10041150 3300003215 Bacteria 1424
27 rootL2_10029991 3300003322 Bacteria 4845
28 JGI25160J50197_1000044 3300003354 Bacteria 145379
29 JGI25160J50197_1005892 3300003354 Bacteria 5036
30 JGI25160J50197_1007642 3300003354 Bacteria 4212
31 JGI25160J50197_1010225 3300003354 Bacteria 3406
32 JGI25161J50226_1000028 3300003374 Bacteria 145379
33 JGI25161J50226_1000078 3300003374 Bacteria 83416
34 Ga0006562J51391_1014638 3300003578 Bacteria 3212
35 Ga0055526_1000242 3300003771 Bacteria 46203
36 Ga0055526_1002943 3300003771 Bacteria 11164
37 Ga0055526_1008596 3300003771 Bacteria 5060
38 Ga0055526_1011220 3300003771 Bacteria 4066
39 Ga0055526_1024393 3300003771 Bacteria 1979
40 Ga0055526_1027275 3300003771 Bacteria 1770
41 Ga0055524_1007816 3300003775 Bacteria 4508
42 Ga0055524_1010378 3300003775 Bacteria 3712
43 Ga0055524_1014128 3300003775 Bacteria 2975
44 Ga0055524_1026395 3300003775 Bacteria 1796
45 Ga0055524_1031439 3300003775 Bacteria 1526
46 Ga0055528_1000113 3300003790 Bacteria 65323
47 Ga0055528_1009089 3300003790 Bacteria 4189
48 Ga0055528_1016207 3300003790 Bacteria 2649
49 Ga0055528_1025007 3300003790 Bacteria 1770
50 Ga0055528_1025022 3300003790 Bacteria 1769
51 Ga0055530_10009535 3300003791 Bacteria 3714
52 Ga0055540_1009829 3300003792 Bacteria 3247
53 Ga0055540_1013267 3300003792 Bacteria 2529
54 Ga0055540_1018007 3300003792 Bacteria 1951
55 Ga0055531_10041958 3300003794 Bacteria 1316
56 JGI25405J52794_10023527 3300003911 Bacteria 1254
57 Ga0055543_1000054 3300004625 Bacteria 104176
58 Ga0055543_1000069 3300004625 Bacteria 94040
59 Ga0055543_1008099 3300004625 Bacteria 2357
60 Ga0065165_1000318 3300005262 Bacteria 78352
61 Ga0065165_1001841 3300005262 Bacteria 20687
62 Ga0065165_1009690 3300005262 Bacteria 4273
63 Ga0065707_10097784 3300005295 Bacteria 3142
64 Ga0065707_10106344 3300005295 Bacteria 2600
65 Ga0070658_10002626 3300005327 Bacteria 14968
66 Ga0070683_100044725 3300005329 Bacteria 4084
67 Ga0070670_100000105 3300005331 Bacteria 77938
68 Ga0070666_10131717 3300005335 Bacteria 1738
69 Ga0070680_100003898 3300005336 Bacteria 11155
70 Ga0070689_100118840 3300005340 Bacteria 2110
71 Ga0070691_10103671 3300005341 Bacteria 1415
72 Ga0070661_100056787 3300005344 Bacteria 2868
73 Ga0070668_100008388 3300005347 Bacteria 7674
74 Ga0070668_100367952 3300005347 Bacteria 1220
75 Ga0070669_100009624 3300005353 Bacteria 6883
76 Ga0070675_100061463 3300005354 Bacteria 3101
77 Ga0070671_100037812 3300005355 Bacteria 4005
78 Ga0070674_100007923 3300005356 Bacteria 6288
79 Ga0070674_100062032 3300005356 Bacteria 2611
80 Ga0070688_100220092 3300005365 Bacteria 1337
81 Ga0070667_100001050 3300005367 Bacteria 25206
82 Ga0070713_100019350 3300005436 Bacteria 5195
83 Ga0070708_100444427 3300005445 Bacteria 1223
84 Ga0070678_100107072 3300005456 Bacteria 2180
85 Ga0070662_100302187 3300005457 Bacteria 1300
86 Ga0070681_10039594 3300005458 Bacteria 4724
87 Ga0068867_100002992 3300005459 Bacteria 11912
88 Ga0070706_100000708 3300005467 Bacteria 37511
89 Ga0070706_100282245 3300005467 Bacteria 1550
90 Ga0070707_100057697 3300005468 Bacteria 3724
91 Ga0070698_100000987 3300005471 Bacteria 31315
92 Ga0070699_100025390 3300005518 Bacteria 5109
93 Ga0070699_100040866 3300005518 Bacteria 4014
94 Ga0070699_100450560 3300005518 Bacteria 1167
95 Ga0070679_100030405 3300005530 Bacteria 5332
96 Ga0070697_100010490 3300005536 Bacteria 7231
97 Ga0070697_100195872 3300005536 Bacteria 1716
98 Ga0068853_100290516 3300005539 Bacteria 1509
99 Ga0068853_100298914 3300005539 Bacteria 1487
100 Ga0070672_100024302 3300005543 Bacteria 4476
101 Ga0070696_100036846 3300005546 Bacteria 3374
102 Ga0070665_100025181 3300005548 Bacteria 5996
103 Ga0070665_100032009 3300005548 Bacteria 5293
104 Ga0068855_100088510 3300005563 Bacteria 3576
105 Ga0068855_100088724 3300005563 Bacteria 3572
106 Ga0068857_100122150 3300005577 Bacteria 2346
107 Ga0068857_100124930 3300005577 Bacteria 2318
108 Ga0068856_100063949 3300005614 Bacteria 3635
109 Ga0068852_100146981 3300005616 Bacteria 2187
110 Ga0068859_100089126 3300005617 Bacteria 3135
111 Ga0068859_100181250 3300005617 Bacteria 2189
112 Ga0068866_10017754 3300005718 Bacteria 3205
113 Ga0068866_10078466 3300005718 Bacteria 1767
114 Ga0068861_100000849 3300005719 Bacteria 18527
115 Ga0068861_100033362 3300005719 Bacteria 3797
116 Ga0068870_10139131 3300005840 Bacteria 1419
117 Ga0068858_100043489 3300005842 Bacteria 4165
118 Ga0068860_100004285 3300005843 Bacteria 14582
119 Ga0068860_100122017 3300005843 Bacteria 2496
120 Ga0068862_100005672 3300005844 Bacteria 10422
121 Ga0068862_100023621 3300005844 Bacteria 5153
122 Ga0081455_10001748 3300005937 Bacteria 26273
123 Ga0081455_10026351 3300005937 Bacteria 5349
124 Ga0081455_10259731 3300005937 Bacteria 1265
125 Ga0081538_10010243 3300005981 Bacteria 7701
126 Ga0081538_10129361 3300005981 Bacteria 1191
127 Ga0081540_1009139 3300005983 Bacteria 6841
128 Ga0081540_1050186 3300005983 Bacteria 2074
129 Ga0081539_10002734 3300005985 Bacteria 23839
130 Ga0081539_10044159 3300005985 Bacteria 2575
131 Ga0075365_10002194 3300006038 Bacteria 9413
132 Ga0075365_10009158 3300006038 Bacteria 5672
133 Ga0075365_10132854 3300006038 Bacteria 1723
134 Ga0075364_10165295 3300006051 Bacteria 1495
135 Ga0070712_100168158 3300006175 Bacteria 1699
136 Ga0075362_10114791 3300006177 Bacteria 1271
137 Ga0075367_10056918 3300006178 Bacteria 2324
138 Ga0075367_10119885 3300006178 Bacteria 1620
139 Ga0075367_10134136 3300006178 Bacteria 1531
140 Ga0075369_10021432 3300006186 Bacteria 2656
141 Ga0075366_10007808 3300006195 Bacteria 5921
142 Ga0075366_10065212 3300006195 Bacteria 2166
143 Ga0075366_10175270 3300006195 Bacteria 1302
144 Ga0075370_10005472 3300006353 Bacteria 6318
145 Ga0075370_10036990 3300006353 Bacteria 2744
146 Ga0075431_100001768 3300006847 Bacteria 20366
147 Ga0075429_100058767 3300006880 Bacteria 3349
148 Ga0068865_100002258 3300006881 Bacteria 11344
149 Ga0068865_100051171 3300006881 Bacteria 2858
150 Ga0097620_100089125 3300006931 Bacteria 3135
151 Ga0097620_100181249 3300006931 Bacteria 2189
152 Ga0099794_10042247 3300007265 Bacteria 2173
153 Ga0105240_10001468 3300009093 Bacteria 40305
154 Ga0105240_10009499 3300009093 Bacteria 13770
155 Ga0111539_10000042 3300009094 Bacteria 129513
156 Ga0111539_10179738 3300009094 Bacteria 2471
157 Ga0111539_10481012 3300009094 Bacteria 1446
158 Ga0105245_10301045 3300009098 Bacteria 1573
159 Ga0105245_10319723 3300009098 Bacteria 1528
160 Ga0114129_10002929 3300009147 Bacteria 23872
161 Ga0105248_10019677 3300009177 Bacteria 7471
162 Ga0105248_10214978 3300009177 Bacteria 2166
163 Ga0105237_10004445 3300009545 Bacteria 16237
164 Ga0105238_10027122 3300009551 Bacteria 5839
165 Ga0105249_10365488 3300009553 Bacteria 1465
166 Ga0105249_10488272 3300009553 Bacteria 1275
167 Ga0105249_10559291 3300009553 Bacteria 1195
168 Ga0123341_1000017 3300009765 Bacteria 82963
169 Ga0099796_10014736 3300010159 Bacteria 2267
170 Ga0105239_10012629 3300010375 Bacteria 9398
171 Ga0157322_1000006 3300012490 Bacteria 3670
172 Ga0157373_10017731 3300013100 Bacteria 5183
173 Ga0157373_10212350 3300013100 Bacteria 1365
174 Ga0157370_10001796 3300013104 Bacteria 26445
175 Ga0157370_10241175 3300013104 Bacteria 1672
176 Ga0157370_10269875 3300013104 Bacteria 1572
177 Ga0171462_1013 3300013250 Bacteria 202864
178 Ga0157378_10004470 3300013297 Bacteria 12280
179 Ga0163162_10056123 3300013306 Bacteria 3967
180 Ga0163162_10122458 3300013306 Bacteria 2706
181 Ga0163162_10452500 3300013306 Bacteria 1416
182 Ga0157372_10048084 3300013307 Bacteria 4742
183 Ga0157375_10138727 3300013308 Bacteria 2557
184 Ga0157375_10656686 3300013308 Bacteria 1205
185 Ga0157380_10006304 3300014326 Bacteria 8334
186 Ga0157379_10027342 3300014968 Bacteria 5079
187 Ga0163161_10169229 3300017792 Bacteria 1670
188 Ga0213874_10031175 3300021377 Bacteria 1541
189 Ga0213876_10001403 3300021384 Bacteria 15016
190 Ga0213876_10008021 3300021384 Bacteria 5724
191 Ga0213876_10033662 3300021384 Bacteria 2701
192 Ga0213875_10003372 3300021388 Bacteria 9106
193 Ga0209435_100087 3300025206 Bacteria 44093
194 Ga0209436_100268 3300025208 Bacteria 23804
195 Ga0209437_100050 3300025233 Bacteria 394010
196 Ga0209437_100205 3300025233 Bacteria 115669
197 Ga0209437_103334 3300025233 Bacteria 2921
198 Ga0207425_1000052 3300025245 Bacteria 162123
199 Ga0207425_1000527 3300025245 Bacteria 23314
200 Ga0207425_1000665 3300025245 Bacteria 18864
201 Ga0207425_1005861 3300025245 Bacteria 3439
202 Ga0209646_1000285 3300025246 Bacteria 44093
203 Ga0209026_1000347 3300025250 Bacteria 44093
204 Ga0209148_1002865 3300025254 Bacteria 5294
205 Ga0209759_1000482 3300025256 Bacteria 44093
206 Ga0209129_1000041 3300025258 Bacteria 307590
207 Ga0209129_1000066 3300025258 Bacteria 226820
208 Ga0209129_1000141 3300025258 Bacteria 119150
209 Ga0209129_1001099 3300025258 Bacteria 15766
210 Ga0209129_1003016 3300025258 Bacteria 7660
211 Ga0209129_1011192 3300025258 Bacteria 2163
212 Ga0209129_1017206 3300025258 Bacteria 1426
213 Ga0209233_1000037 3300025261 Bacteria 554620
214 Ga0209233_1000187 3300025261 Bacteria 133091
215 Ga0209233_1000232 3300025261 Bacteria 96361
216 Ga0209455_1001248 3300025272 Bacteria 11977
217 Ga0209673_1000024 3300025273 Bacteria 409632
218 Ga0209673_1000911 3300025273 Bacteria 37766
219 Ga0209673_1012356 3300025273 Bacteria 3445
220 Ga0209673_1013782 3300025273 Bacteria 3171
221 Ga0209673_1043372 3300025273 Bacteria 1256
222 Ga0209130_1000002 3300025284 Bacteria 722648
223 Ga0209130_1000093 3300025284 Bacteria 145707
224 Ga0209130_1000422 3300025284 Bacteria 45627
225 Ga0209676_1019999 3300025292 Bacteria 2287
226 Ga0209025_1000053 3300025294 Bacteria 317600
227 Ga0209025_1000144 3300025294 Bacteria 181446
228 Ga0209025_1000274 3300025294 Bacteria 119322
229 Ga0209025_1000275 3300025294 Bacteria 119220
230 Ga0209025_1003887 3300025294 Bacteria 13492
231 Ga0209025_1013651 3300025294 Bacteria 5082
232 Ga0209025_1022384 3300025294 Bacteria 3354
233 Ga0209564_1000029 3300025295 Bacteria 505995
234 Ga0209564_1000043 3300025295 Bacteria 388153
235 Ga0209564_1000262 3300025295 Bacteria 112256
236 Ga0209564_1000474 3300025295 Bacteria 67143
237 Ga0209564_1000486 3300025295 Bacteria 66011
238 Ga0209758_1000043 3300025297 Bacteria 402310
239 Ga0209758_1000057 3300025297 Bacteria 333111
240 Ga0209758_1000229 3300025297 Bacteria 119657
241 Ga0209758_1000466 3300025297 Bacteria 66920
242 Ga0209758_1002556 3300025297 Bacteria 18318
243 Ga0209758_1017231 3300025297 Bacteria 3612
244 Ga0209050_1000149 3300025298 Bacteria 163252
245 Ga0209050_1010764 3300025298 Bacteria 4454
246 Ga0209256_1000868 3300025299 Bacteria 37527
247 Ga0209256_1001436 3300025299 Bacteria 24668
248 Ga0209256_1003327 3300025299 Bacteria 11402
249 Ga0209256_1011918 3300025299 Bacteria 3407
250 Ga0209256_1013244 3300025299 Bacteria 3074
251 Ga0207426_1000012 3300025302 Bacteria 730942
252 Ga0207426_1000013 3300025302 Bacteria 721897
253 Ga0207426_1000142 3300025302 Bacteria 194023
254 Ga0207426_1000198 3300025302 Bacteria 146241
255 Ga0207426_1002097 3300025302 Bacteria 13739
256 Ga0207426_1021381 3300025302 Bacteria 2237
257 Ga0209051_1000170 3300025303 Bacteria 119026
258 Ga0209051_1010621 3300025303 Bacteria 4624
259 Ga0209051_1014264 3300025303 Bacteria 3718
260 Ga0209051_1027331 3300025303 Bacteria 2276
261 Ga0209257_1027182 3300025304 Bacteria 1909
262 Ga0207656_10075949 3300025321 Bacteria 1502
263 Ga0207642_10038830 3300025899 Bacteria 2064
264 Ga0207688_10102761 3300025901 Bacteria 1652
265 Ga0207688_10211085 3300025901 Bacteria 1166
266 Ga0207680_10049806 3300025903 Bacteria 2496
267 Ga0207645_10052145 3300025907 Bacteria 2614
268 Ga0207645_10076364 3300025907 Bacteria 2145
269 Ga0207705_10280623 3300025909 Bacteria 1275
270 Ga0207684_10066252 3300025910 Bacteria 3067
271 Ga0207707_10019725 3300025912 Bacteria 5885
272 Ga0207707_10386837 3300025912 Bacteria 1202
273 Ga0207695_10000427 3300025913 Bacteria 93089
274 Ga0207695_10126172 3300025913 Bacteria 2521
275 Ga0207671_10002841 3300025914 Bacteria 18002
276 Ga0207693_10033704 3300025915 Bacteria 4040
277 Ga0207652_10048257 3300025921 Bacteria 3639
278 Ga0207646_10190607 3300025922 Bacteria 1852
279 Ga0207681_10012222 3300025923 Bacteria 5294
280 Ga0207681_10013114 3300025923 Bacteria 5124
281 Ga0207681_10070454 3300025923 Bacteria 2435
282 Ga0207694_10078016 3300025924 Bacteria 2596
283 Ga0207650_10000302 3300025925 Bacteria 48702
284 Ga0207687_10036195 3300025927 Bacteria 3361
285 Ga0207700_10084832 3300025928 Bacteria 2484
286 Ga0207644_10022013 3300025931 Bacteria 4349
287 Ga0207706_10209385 3300025933 Bacteria 1709
288 Ga0207670_10071609 3300025936 Bacteria 2398
289 Ga0207669_10202397 3300025937 Bacteria 1442
290 Ga0207704_10006660 3300025938 Bacteria 5408
291 Ga0207704_10032588 3300025938 Bacteria 2951
292 Ga0207704_10037628 3300025938 Bacteria 2797
293 Ga0207691_10009293 3300025940 Bacteria 9434
294 Ga0207711_10078855 3300025941 Bacteria 2874
295 Ga0207661_10031766 3300025944 Bacteria 4083
296 Ga0207667_10022968 3300025949 Bacteria 6877
297 Ga0207668_10038371 3300025972 Bacteria 3214
298 Ga0207658_10000576 3300025986 Bacteria 33039
299 Ga0207658_10028202 3300025986 Bacteria 3952
300 Ga0207677_10369710 3300026023 Bacteria 1207
301 Ga0207703_10021969 3300026035 Bacteria 4997
302 Ga0207639_10252353 3300026041 Bacteria 1539
303 Ga0207678_10041986 3300026067 Bacteria 3964
304 Ga0207708_10047648 3300026075 Bacteria 3262
305 Ga0207702_10038579 3300026078 Bacteria 4000
306 Ga0207702_10052722 3300026078 Bacteria 3443
307 Ga0207702_10081555 3300026078 Bacteria 2809
308 Ga0207648_10009516 3300026089 Bacteria 9298
309 Ga0207674_10048582 3300026116 Bacteria 4342
310 Ga0207674_10145686 3300026116 Bacteria 2327
311 Ga0207675_100002512 3300026118 Bacteria 18156
312 Ga0207675_100020788 3300026118 Bacteria 6119
313 Ga0207675_100144260 3300026118 Bacteria 2263
314 Ga0207683_10005865 3300026121 Bacteria 10533
315 Ga0207683_10095318 3300026121 Bacteria 2653
316 Ga0207683_10248498 3300026121 Bacteria 1623
317 Ga0209371_1002100 3300027312 Bacteria 11818
318 Ga0207428_10000092 3300027907 Bacteria 123897
319 Ga0207428_10055437 3300027907 Bacteria 3152
320 Ga0268266_10004190 3300028379 Bacteria 13898
321 Ga0268266_10099248 3300028379 Bacteria 2563
322 Ga0268265_10013241 3300028380 Bacteria 5605
323 Ga0268265_10026643 3300028380 Bacteria 4115
324 Ga0268264_10001072 3300028381 Bacteria 27190
325 Ga0268264_10479516 3300028381 Bacteria 1210
326 Ga0265334_10005584 3300028573 Bacteria 5495
327 Ga0307517_10000922 3300028786 Bacteria 49832
328 Ga0307517_10101384 3300028786 Bacteria 2266
329 Ga0307515_10000306 3300028794 Bacteria 121448
330 Ga0307515_10008185 3300028794 Bacteria 20462
331 Ga0307515_10301336 3300028794 Bacteria 1287
332 Ga0268256_1005033 3300030500 Bacteria 5299
333 Ga0307512_10034912 3300030522 Bacteria 4295
334 Ga0265331_10011765 3300031250 Bacteria 4777
335 Ga0265316_10073853 3300031344 Bacteria 2626
336 Ga0307513_10113027 3300031456 Bacteria 2704
337 Ga0307513_10166937 3300031456 Bacteria 2084
338 Ga0307513_10212882 3300031456 Bacteria 1762
339 Ga0307509_10000041 3300031507 Bacteria 182302
340 Ga0307509_10003895 3300031507 Bacteria 22089
341 Ga0265313_10053406 3300031595 Bacteria 1923
342 Ga0307508_10000113 3300031616 Bacteria 95378
343 Ga0307508_10036513 3300031616 Bacteria 4424
344 Ga0307514_10008015 3300031649 Bacteria 9040
345 Ga0307516_10041776 3300031730 Bacteria 4554
346 Ga0307405_10001044 3300031731 Bacteria 11205
347 Ga0307413_10040277 3300031824 Bacteria 2725
348 Ga0307413_10217504 3300031824 Bacteria 1393
349 Ga0307406_10006383 3300031901 Bacteria 6507
350 Ga0307406_10085735 3300031901 Bacteria 2107
351 Ga0307407_10100207 3300031903 Bacteria 1796
352 Ga0307407_10182785 3300031903 Bacteria 1391
353 Ga0307412_10002606 3300031911 Bacteria 10018
354 Ga0307409_100025293 3300031995 Bacteria 4160
355 Ga0307415_100134848 3300032126 Bacteria 1876
356 Ga0307510_10011906 3300033180 Bacteria 10314
357 Ga0307510_10027735 3300033180 Bacteria 6481
358 Ga0307510_10037985 3300033180 Bacteria 5330
359 Ga0307510_10045419 3300033180 Bacteria 4743
360 Ga0307510_10167569 3300033180 Bacteria 1781
361 Ga0373929_0009326 3300035085 Bacteria 1819
362 Ga0373939_0078319 3300035114 Bacteria 1092
363 Ga0373931_0146349 3300035691 Bacteria 1373
364 Ga0373935_0209583 3300035692 Bacteria 1350
365 Ga0373927_0098951 3300035695 Bacteria 1896
366 Ga0373947_0153017 3300035725 Bacteria 1486
367 Ga0373925_0003621 3300037068 Bacteria 11900
368 Ga0373925_0182507 3300037068 Bacteria 1662
369 Ga0395900_0011631 3300037418 Bacteria 9005
370 Ga0395900_0019809 3300037418 Bacteria 6856
371 Ga0395900_0061251 3300037418 Bacteria 3869
372 Ga0395898_0017238 3300037466 Bacteria 7375
373 Ga0395898_0252071 3300037466 Bacteria 1683
374 Ga0395905_0054137 3300037471 Bacteria 3755
375 Ga0436364_0677535 3300037853 Bacteria 1663
376 Ga0395901_0001404 3300038443 Bacteria 25152
377 Ga0395901_0006779 3300038443 Bacteria 11568
378 Ga0395901_0069622 3300038443 Bacteria 3664
379 Ga0436365_0021793 3300039437 Bacteria 95854
380 Ga0436365_0184712 3300039437 Bacteria 51527
381 Ga0436365_1374407 3300039437 Bacteria 13805
382 Ga0436360_1291673 3300039438 Bacteria 4533
383 Ga0436363_0337627 3300039450 Bacteria 26810
384 Ga0436363_1409112 3300039450 Bacteria 2275
385 Ga0436362_0108458 3300039453 Bacteria 1902
386 Ga0436362_1202906 3300039453 Bacteria 2577
387 Ga0451800_0415455 3300041459 Bacteria 2466
388 Ga0451804_0831358 3300041463 Bacteria 2263
389 Ga0451839_0183003 3300041496 Bacteria 2071
390 Ga0451851_0442598 3300041507 Bacteria 3682
391 Ga0451843_0766251 3300041509 Bacteria 1440
392 Ga0451854_34019 3300041510 Bacteria 2174
393 Ga0451855_0326464 3300041511 Bacteria 1109
394 Ga0451853_1746300 3300041512 Bacteria 1792
395 Ga0452268_37843 3300041907 Bacteria 1681
396 Ga0452271_05939 3300041916 Bacteria 2042
397 Ga0439431_0019793 3300041997 Bacteria 1603
398 Ga0439448_0038522 3300042005 Bacteria 1539
399 Ga0439449_0024843 3300042007 Bacteria 2240
400 Ga0450894_006327 3300042131 Bacteria 1528
401 Ga0439435_0001104 3300042436 Bacteria 4813
402 Ga0439460_0025686 3300042461 Bacteria 1642
403 Ga0466969_0031481 3300044656 Bacteria 2700
404 Ga0466961_0172707 3300044693 Bacteria 1344
405 Ga0466963_0080558 3300044694 Bacteria 2204
406 Ga0453684_0111102 3300044712 Bacteria 3330
407 Ga0466960_0063410 3300044901 Bacteria 1819
408 Ga0466959_0091715 3300045049 Bacteria 2181
409 Ga0451576_0006848 3300045051 Bacteria 13825
410 Ga0451576_0132046 3300045051 Bacteria 2603
411 Ga0466967_0014017 3300045976 Bacteria 6224
412 Ga0466967_0585001 3300045976 Bacteria 1101
413 Ga0495592_0000942 3300046454 Bacteria 20230
414 Ga0495638_0001022 3300046460 Bacteria 27790
415 Ga0495638_0154329 3300046460 Bacteria 1330
416 Ga0495585_0038200 3300046492 Bacteria 2702
417 Ga0495610_0007299 3300046512 Bacteria 7393
418 Ga0495610_0008615 3300046512 Bacteria 6579
419 Ga0495632_0004698 3300046519 Bacteria 9227
420 Ga0495632_0005440 3300046519 Bacteria 8421
421 Ga0495632_0039431 3300046519 Bacteria 2384
422 Ga0495643_0023147 3300046522 Bacteria 3534
423 Ga0495643_0030815 3300046522 Bacteria 2991
424 Ga0495642_0052531 3300046528 Bacteria 1678
425 Ga0495654_0022823 3300046530 Bacteria 3245
426 Ga0495597_0011802 3300046542 Bacteria 4230
427 Ga0495656_0020512 3300046615 Bacteria 2564
428 Ga0495668_0036483 3300046616 Bacteria 2754
429 Ga0495625_0088888 3300046660 Bacteria 2139
430 Ga0495646_0101016 3300046680 Bacteria 1654
431 Ga0495671_0053401 3300046692 Bacteria 2006
432 Ga0495600_0025245 3300046809 Bacteria 3829
433 Ga0495660_0015916 3300046810 Bacteria 4340
434 Ga0495683_0031177 3300047323 Bacteria 2717
435 Ga0495685_049203 3300047447 Bacteria 1432
436 Ga0495686_0033227 3300047472 Bacteria 3332
437 Ga0495686_0088798 3300047472 Bacteria 1879
438 Ga0496106_0005047 3300048909 Bacteria 9765
439 Ga0496116_0007488 3300048919 Bacteria 9665
440 Ga0496117_0035780 3300048920 Bacteria 3723
441 Ga0496117_0085263 3300048920 Bacteria 2057
442 Ga0496118_0017292 3300048921 Bacteria 6574
443 Ga0496121_0005879 3300048924 Bacteria 15533
444 Ga0496121_0091173 3300048924 Bacteria 2380
445 Ga0496122_0072947 3300048925 Bacteria 2437
446 Ga0496122_0110837 3300048925 Bacteria 1801
447 Ga0496123_0036381 3300048926 Bacteria 3493
448 Ga0496123_0038564 3300048926 Bacteria 3355
449 Ga0496124_0005332 3300048927 Bacteria 14517
450 Ga0496124_0009932 3300048927 Bacteria 9726
451 Ga0496124_0100512 3300048927 Bacteria 2344
452 Ga0496124_0121213 3300048927 Bacteria 2089
453 Ga0496125_0120455 3300048928 Bacteria 1873
454 Ga0496126_0038443 3300048929 Bacteria 4453
455 Ga0496126_0261458 3300048929 Bacteria 1439
456 Ga0496126_0298649 3300048929 Bacteria 1330
457 Ga0495678_009804 3300049459 Bacteria 4704
458 Ga0495682_0034235 3300049460 Bacteria 1874
459 Ga0501032_0010551 3300049569 Bacteria 6659
460 Ga0501032_0094432 3300049569 Bacteria 1983
461 Ga0501033_0003346 3300049570 Bacteria 13239
462 Ga0501034_0001155 3300049571 Bacteria 36610
463 Ga0501034_0001184 3300049571 Bacteria 36033
464 Ga0501034_0050984 3300049571 Bacteria 4173
465 Ga0501034_0082348 3300049571 Bacteria 3220
466 Ga0501036_0003819 3300049572 Bacteria 12086
467 Ga0501037_0032773 3300049573 Bacteria 3838
468 Ga0501038_0027793 3300049574 Bacteria 5028
469 Ga0501039_0173614 3300049575 Bacteria 1695
470 Ga0501043_0005235 3300049579 Bacteria 10487
471 Ga0501043_0094246 3300049579 Bacteria 2354
472 Ga0501046_0006691 3300049580 Bacteria 10178
473 Ga0501046_0280718 3300049580 Bacteria 1220
474 Ga0501047_0008841 3300049581 Bacteria 9500
475 Ga0501047_0153097 3300049581 Bacteria 2181
476 Ga0501048_0311097 3300049582 Bacteria 1121
477 Ga0501067_0016526 3300049583 Bacteria 4077
478 Ga0501068_0003406 3300049584 Bacteria 8553
479 Ga0501068_0013434 3300049584 Bacteria 4659
480 Ga0501069_0001256 3300049585 Bacteria 12419
481 Ga0501070_0007366 3300049586 Bacteria 9343
482 Ga0501072_0071160 3300049588 Bacteria 2748
483 Ga0501072_0138969 3300049588 Bacteria 1937
484 Ga0501073_0007895 3300049589 Bacteria 7895
485 Ga0501074_0022480 3300049590 Bacteria 4582
486 Ga0501074_0032660 3300049590 Bacteria 3770
487 Ga0501206_011512 3300049653 Bacteria 1195
488 Ga0501257_011803 3300049686 Bacteria 1997
489 Ga0501080_0002543 3300049742 Bacteria 15958
490 Ga0501083_0079471 3300049744 Bacteria 2174
491 Ga0501044_0008176 3300049823 Bacteria 11483
492 Ga0501044_0038523 3300049823 Bacteria 4992
493 nmdc:mga03683_100597_c1 3300050489 Bacteria 1270
494 nmdc:mga03n38_47757_c1 3300050490 Bacteria 1896
495 nmdc:mga00v17_103364_c1 3300050491 Bacteria 1800
496 nmdc:mga0yw44_266293_c1 3300050492 Bacteria 1143
497 nmdc:mga0yw44_56616_c1 3300050492 Bacteria 2390
498 nmdc:mga0k408_102585_c1 3300050493 Bacteria 1687
499 nmdc:mga0k408_121234_c1 3300050493 Bacteria 1549
500 nmdc:mga0k408_42625_c1 3300050493 Bacteria 2614
501 nmdc:mga0k408_97866_c1 3300050493 Bacteria 1728
502 nmdc:mga06z11_11845_c1 3300050494 Bacteria 3773
503 nmdc:mga06z11_134282_c1 3300050494 Bacteria 1393
504 nmdc:mga07m45_11762_c1 3300050496 Bacteria 2014
505 nmdc:mga07m45_30780_c1 3300050496 Bacteria 2974
506 nmdc:mga05p37_31046_c1 3300050507 Bacteria 6524
507 nmdc:mga05p37_320098_c1 3300050507 Bacteria 1836
508 nmdc:mga09592_61927_c1 3300050508 Bacteria 3165
509 nmdc:mga06r32_21551_c1 3300050510 Bacteria 5949
510 nmdc:mga08y16_428007_c1 3300050511 Bacteria 1352
511 nmdc:mga08y16_46_c1 3300050511 Bacteria 112050
512 nmdc:mga08y16_51467_c1 3300050511 Bacteria 4309
513 nmdc:mga0sz30_3471_c1 3300050516 Bacteria 5681
514 nmdc:mga0sz30_47533_c1 3300050516 Bacteria 1813
515 Ga0495612_0077768 3300053078 Bacteria 1391
516 Ga0500578_0000011 3300053086 Bacteria 217243
517 Ga0500578_0238126 3300053086 Bacteria 1100
518 Ga0500644_0006020 3300053088 Bacteria 3089
519 Ga0500646_0009446 3300053090 Bacteria 2496
520 Ga0500647_0080266 3300053091 Bacteria 1565
521 Ga0500651_0009464 3300053093 Bacteria 5793
522 Ga0500651_0030780 3300053093 Bacteria 3377
523 Ga0500641_0000382 3300053096 Bacteria 16395
524 Ga0500594_0014610 3300053118 Bacteria 1882
525 Ga0500623_083455 3300053127 Bacteria 1513
526 Ga0500628_001535 3300053129 Bacteria 3931
527 Ga0500642_0013263 3300053130 Bacteria 3022
528 Ga0500642_0058475 3300053130 Bacteria 1724
529 Ga0500652_000495 3300053131 Bacteria 13817
530 Ga0500655_004188 3300053133 Bacteria 2597
531 Ga0500658_0001766 3300053134 Bacteria 8525
532 Ga0500559_0000175 3300053136 Bacteria 50886
533 Ga0500568_0067092 3300053139 Bacteria 1379
534 Ga0500577_0023036 3300053142 Bacteria 2075
535 Ga0500590_058104 3300053148 Bacteria 1950
536 Ga0500604_0072238 3300053151 Bacteria 1102
537 Ga0500616_0002146 3300053153 Bacteria 17079
538 Ga0500616_0007056 3300053153 Bacteria 7207
539 Ga0500616_0046348 3300053153 Bacteria 2311
540 Ga0500622_0000689 3300053156 Bacteria 29849
541 Ga0500622_0001214 3300053156 Bacteria 21209
542 Ga0500622_0003093 3300053156 Bacteria 11464
543 Ga0500627_0141133 3300053158 Bacteria 1088
544 Ga0500636_0097121 3300053177 Bacteria 1680
545 Ga0500552_006428 3300053733 Bacteria 1318
546 Ga0500587_001344 3300053739 Bacteria 3457
547 Ga0501084_0006097 3300054114 Bacteria 9911
548 Ga0590077_016072 3300059426 Bacteria 1568
549 Ga0587073_0020941 3300059492 Bacteria 1252
550 Ga0501082_0003890 3300060353 Bacteria 13040
551 Ga0501082_0159757 3300060353 Bacteria 1958
552 Ga0501082_0484692 3300060353 Bacteria 1081
553 2509388999 2509276021 Bacteria 7634384
554 2509444589 2509276033 Bacteria 7180565
555 2510135664 2510065019 Bacteria 6903379
556 2510897137 2510461076 Bacteria 8618824
557 2511137157 2510917022 Bacteria 6504556
558 2511185331 2510917028 Bacteria 6185411
559 2511200527 2510917030 Bacteria 7460662
560 2513570825 2513237084 Bacteria 7231967
561 2513574960 2513237085 Bacteria 7695351
562 2513595608 2513237088 Bacteria 6927906
563 2513633744 2513237093 Bacteria 7545552
564 2513707591 2513237103 Bacteria 7647401
565 2513865367 2513237138 Bacteria 7368160
566 2513910993 2513237144 Bacteria 7530820
567 2513924301 2513237146 Bacteria 7166346
568 2514023675 2513237162 Bacteria 7468464
569 2515114828 2515075009 Bacteria 7288508
570 2515635815 2515154113 Bacteria 7807172
571 2515641429 2515154114 Bacteria 7848616
572 2515659318 2515154116 Bacteria 7552979
573 2515741187 2515154134 Bacteria 7220242
574 2517038446 2516653077 Bacteria 7555578
575 2517078722 2516653085 Bacteria 7346596
576 2517097464 2517093000 Bacteria 7412387
577 2517408920 2517287029 Bacteria 6905599
578 2520379186 2519899620 Bacteria 6499161
579 2524461876 2524023209 Bacteria 6679728
580 2530648349 2529292951 Bacteria 6916614
581 2535514579 2534681796 Bacteria 7146037
582 2585201276 2582581294 Bacteria 6626667
583 2585223254 2582581298 Bacteria 7315509
584 2585256419 2582581304 Bacteria 5831370
585 2585273453 2582581307 Bacteria 6597605
586 2585283165 2582581308 Bacteria 7413247
587 2585328206 2582581315 Bacteria 7318924
588 2585330618 2582581316 Bacteria 7774528
589 2585399095 2582581867 Bacteria 7184437
590 2585523963 2585427526 Bacteria 7258840
591 2585536013 2585427527 Bacteria 7273426
592 2585542107 2585427528 Bacteria 6842387
593 2585546150 2585427529 Bacteria 7395659
594 2585556659 2585427530 Bacteria 7383882
595 2585564019 2585427531 Bacteria 6992870
596 2585818755 2585427590 Bacteria 6824633
597 2585840683 2585427593 Bacteria 7141551
598 2585843699 2585427594 Bacteria 6180594
599 2585900311 2585427608 Bacteria 6544331
600 2585909273 2585427609 Bacteria 6667127
601 2587730362 2585428057 Bacteria 6737412
602 2587736867 2585428058 Bacteria 6853932
603 2587984625 2585428125 Bacteria 6662905
604 2588291771 2588253510 Bacteria 6901809
605 2599419741 2599185170 Bacteria 7295545
606 2616293966 2615840624 Bacteria 6557588
607 2616311192 2615840626 Bacteria 7921970
608 2616556074 2615840698 Bacteria 7319877
609 2617380727 2617270742 Bacteria 6808054
610 2643972405 2643221592 Bacteria 6608788
611 2644004422 2643221599 Bacteria 6292121
612 2644138587 2643221625 Bacteria 6512927
613 2644272913 2643221648 Bacteria 6521465
614 2644298206 2643221653 Bacteria 4569637
615 2644305782 2643221654 Bacteria 5273570
616 2644656458 2643221719 Bacteria 4568197
617 2644737562 2643221734 Bacteria 5365412
618 2644743829 2643221736 Bacteria 6608466
619 2671115841 2667528174 Bacteria 6435400
620 2719183327 2718217882 Bacteria 6556348
621 2719388087 2718217927 Bacteria 6972593
622 2719667710 2718217997 Bacteria 6740740
623 2719734044 2718218009 Bacteria 6478651
624 2720494130 2718218199 Bacteria 6740745
625 2720615593 2718218232 Bacteria 6720332
626 2720622376 2718218233 Bacteria 6662049
627 2720633730 2718218235 Bacteria 6630699
628 2720777430 2718218269 Bacteria 6906114
629 2721149439 2718218363 Bacteria 6524337
630 2721160842 2718218365 Bacteria 6274507
631 2721166276 2718218366 Bacteria 6425255
632 2721401720 2718218423 Bacteria 6438183
633 2722842446 2721755514 Bacteria 6424414
634 2723029027 2721755556 Bacteria 6745503
635 2723562644 2721755684 Bacteria 6859907
636 2723569337 2721755685 Bacteria 6704835
637 2724040534 2721755809 Bacteria 6438790
638 2724046800 2721755810 Bacteria 6479005
639 2724092037 2721755819 Bacteria 6906405
640 2724106602 2721755822 Bacteria 6726041
641 2724112410 2721755823 Bacteria 6752556
642 2725949672 2724679232 Bacteria 7646494
643 2730109963 2728369352 Bacteria 6745171
644 2730166562 2728369365 Bacteria 6555560
645 2730300474 2728369397 Bacteria 6274511
646 2738800774 2738541293 Bacteria 7065685
647 2738946696 2738541317 Bacteria 5340176
648 2739037356 2738541333 Bacteria 7106503
649 2766067166 2765235942 Bacteria 7445910
650 2776915985 2775507049 Bacteria 6284736
651 2778179502 2775507266 Bacteria 7392367
652 2793283108 2791355253 Bacteria 5171699
653 2793298455 2791355256 Bacteria 6798008
654 2793315705 2791355259 Bacteria 7254731
655 2793323488 2791355260 Bacteria 6598818
656 2793327566 2791355261 Bacteria 6661293
657 2793335637 2791355262 Bacteria 6774204
658 2793341031 2791355263 Bacteria 6872478
659 2793350292 2791355264 Bacteria 6429314
660 2793354767 2791355265 Bacteria 6539969
661 2793358536 2791355266 Bacteria 7116587
662 2793368988 2791355267 Bacteria 7222458
663 2805928912 2802429605 Bacteria 6875453
664 2805934533 2802429606 Bacteria 6346811
665 2806047083 2802429633 Bacteria 7341974
666 2806054918 2802429634 Bacteria 7083200
667 2806061854 2802429635 Bacteria 7650140
668 2806069623 2802429636 Bacteria 7597525
669 2806076006 2802429637 Bacteria 7067217
670 2819244213 2818991272 Bacteria 4622173
671 2819608885 2818991448 Bacteria 6772224
672 2819643310 2818991453 Bacteria 7181617
673 2819720523 2818991467 Bacteria 5893227
674 2821444385 2821443989 Bacteria 7658172
675 2838020937 2838016132 Bacteria 6577831
676 2838026840 2838022645 Bacteria 6494267
677 2838033950 2838029111 Bacteria 6603031
678 2838039726 2838035591 Bacteria 7166484
679 2838044861 2838042994 Bacteria 6046894
680 2838052914 2838048938 Bacteria 6044578
681 2838064707 2838061910 Bacteria 6794874
682 2838070516 2838068647 Bacteria 6208656
683 2838664004 2838661181 Bacteria 7385261
684 2838672536 2838668709 Bacteria 6671819
685 2838685579 2838680041 Bacteria 6545511
686 2838689845 2838686498 Bacteria 7807632
687 2838695965 2838694306 Bacteria 6853137
688 2838705141 2838701080 Bacteria 6669771
689 2838713364 2838707686 Bacteria 6619912
690 2838731459 2838729681 Bacteria 7400765
691 2838744400 2838742623 Bacteria 7396178
692 2841764853 2841760612 Bacteria 6454112
693 2841852940 2841851746 Bacteria 7532261
694 2841870215 2841864319 Bacteria 6742987
695 2842082598 2842077413 Bacteria 6508645
696 2842112753 2842110456 Bacteria 7656360
697 2842123843 2842118031 Bacteria 7033875
698 2842150135 2842146304 Bacteria 5957337
699 2842160267 2842156927 Bacteria 6894975
700 2842165755 2842163707 Bacteria 6916235
701 2842184067 2842180545 Bacteria 6888678
702 2842196369 2842192696 Bacteria 6147454
703 2842202443 2842198810 Bacteria 6608673
704 2842208905 2842205361 Bacteria 6340321
705 2842219431 2842217011 Bacteria 7497767
706 2842231649 2842229732 Bacteria 7475766
707 2842242898 2842237096 Bacteria 6620661
708 2842245882 2842243621 Bacteria 7421798
709 2842254821 2842250916 Bacteria 6579627
710 2842260260 2842257432 Bacteria 7401195
711 2842267148 2842264693 Bacteria 6472963
712 2842273671 2842271015 Bacteria 7807131
713 2842282405 2842278818 Bacteria 6340002
714 2842290055 2842285085 Bacteria 6011953
715 2842296971 2842291075 Bacteria 7076806
716 2842299942 2842298080 Bacteria 6123127
717 2842308477 2842304105 Bacteria 7023636
718 2842312219 2842311132 Bacteria 6616990
719 2842321813 2842317721 Bacteria 6793725
720 2842344661 2842341865 Bacteria 7003929
721 2842359536 2842357229 Bacteria 6485165
722 2842367764 2842363717 Bacteria 6844742
723 2842376035 2842370503 Bacteria 7038661
724 2842383245 2842377471 Bacteria 7140707
725 2842390378 2842384541 Bacteria 7057858
726 2842397846 2842395702 Bacteria 6780583
727 2842407665 2842402390 Bacteria 6681310
728 2842414296 2842409023 Bacteria 6687331
729 2842420844 2842415677 Bacteria 6596907
730 2842424130 2842422224 Bacteria 6239196
731 2842431156 2842428310 Bacteria 6767288
732 2842437491 2842434925 Bacteria 6502746
733 2842444306 2842441272 Bacteria 6769273
734 2842451267 2842447887 Bacteria 6754142
735 2842465299 2842462802 Bacteria 6588055
736 2842472232 2842469257 Bacteria 6752936
737 2842480696 2842475841 Bacteria 6603183
738 2842487260 2842482326 Bacteria 7212537
739 2842494103 2842489311 Bacteria 6620893
740 2842501252 2842495871 Bacteria 6820686
741 2842507261 2842502639 Bacteria 6604161
742 2842514535 2842509118 Bacteria 6850950
743 2844107699 2844104063 Bacteria 6440972
744 2844456593 2844454524 Bacteria 7952546
745 2844539642 2844533157 Bacteria 7517899
746 2851183540 2851182111 Bacteria 6047226
747 2851249805 2851246043 Bacteria 6439203
748 2852387859 2852387548 Bacteria 8025568
749 2857520889 2857516855 Bacteria 7787325
750 2884301201 2884298095 Bacteria 3823049
751 2913311946 2913308742 Bacteria 5350706
752 2917702918 2917699015 Bacteria 7043791
753 2919101867 2919100787 Bacteria 7710546
754 2919408323 2919408235 Bacteria 6149349
755 2919496510 2919493220 Bacteria 4598500
756 2919546894 2919543075 Bacteria 4728703
757 2923526553 2923525760 Bacteria 4472324
758 2923556186 2923556063 Bacteria 6793593
759 2933574926 2933570622 Bacteria 7023390
760 2933588358 2933586486 Bacteria 7667493
761 2933601321 2933599457 Bacteria 5858799
762 2935899983 2935894831 Bacteria 6620579
763 2935902320 2935901341 Bacteria 7341747
764 2936369546 2936367885 Bacteria 7324495
765 2936380287 2936375103 Bacteria 6652732
766 2936385256 2936381700 Bacteria 7006523
767 2989776836 2989776772 Bacteria 4843317
768 2996887973 2996887358 Bacteria 5795980
769 2996897594 2996893221 Bacteria 5823108
770 3005410630 3005409236 Bacteria 7188837
771 3005423304 3005416602 Bacteria 7064308
772 3005450091 3005445848 Bacteria 6906074
773 3005456338 3005452660 Bacteria 5889319
774 639646063 639633055 Bacteria 7751309
775 8005247881 8005246636 Bacteria 4933972
776 8005261461 8005258706 Bacteria 6184835
777 8005278289 8005275841 Bacteria 6929066
778 8005282677 8005282627 Bacteria 6675747
779 8005291653 8005289223 Bacteria 6634003
780 8005305474 8005301065 Bacteria 6614431
781 8005310250 8005307578 Bacteria 7395396
782 8005315631 8005314921 Bacteria 7072929
783 8005322500 8005321885 Bacteria 5795980
784 8005378103 8005376324 Bacteria 6590079
785 8005384113 8005382845 Bacteria 6732062
786 8005399609 8005395548 Bacteria 6806915
787 8005433798 8005430974 Bacteria 6689030
788 8005465524 8005460587 Bacteria 7157962
789 8005484462 8005484373 Bacteria 6297373
790 8005498107 8005497431 Bacteria 6477605
791 8005543239 8005542996 Bacteria 7077758
792 8005559974 8005556819 Bacteria 6908598
793 8005564532 8005563573 Bacteria 7153261
794 8005571218 8005570704 Bacteria 6957481
795 8005619316 8005619151 Bacteria 7030230
796 8005627881 8005626139 Bacteria 6534237
797 8005647382 8005645114 Bacteria 6950293
798 8005669515 8005668836 Bacteria 6953162
799 8005687462 8005682033 Bacteria 6726518
800 8005692774 8005688590 Bacteria 6610080
801 8005701462 8005695170 Bacteria 6912330
802 8018132532 8018127388 Bacteria 7351159
803 8018167608 8018163183 Bacteria 7277977
804 8018176621 8018176218 Bacteria 6896178
805 8023681273 8023680758 Bacteria 7729763
806 8024481896 8024479707 Bacteria 6954785
807 8024488596 8024486573 Bacteria 6540512
808 8024506332 8024501048 Bacteria 6427847
809 8046768686 8046767195 Bacteria 7547379
810 8055433776 8055431914 Bacteria 4551896
811 8056381191 8056375014 Bacteria 7006639
812 8056382684 8056382006 Bacteria 6408074
813 8057533124 8057529695 Bacteria 6306553
814 8057582461 8057575449 Bacteria 7367519
815 8057878702 8057874678 Bacteria 7494653
816 Ga0209025_1002792
817 JGI25155J39150_1000110
818 JGI25156J39149_1000192
819 JGI25162J39368_1000302
820 JGI25162J39368_1001704
821 JGI25154J39366_1000196
822 JGI25157J39369_1000228
823 JGI25152J39213_1001971
824 JGI25152J39213_1003728
825 JGI25152J39213_1006980
826 JGI25152J39213_1007954
827 JGI25150J39212_1000261
828 JGI25150J39212_1012436
829 JGI25159J45721_1000790
830 JGI25159J45721_1001258
831 JGI25151J46595_10000359
832 JGI25151J46595_10002653
833 JGI25151J46595_10002809
834 JGI25151J46595_10022409
835 JGI25165J46597_1000390
836 JGI25165J46597_1001069
837 JGI25165J46597_1005760
838 JGI25153J46596_10005292
839 JGI25153J46596_10006944
840 JGI25153J46596_10013626
841 JGI25153J46596_10041150
842 rootL2_10029991
843 JGI25160J50197_1000044
844 JGI25160J50197_1005892
845 JGI25160J50197_1007642
846 JGI25160J50197_1010225
847 JGI25161J50226_1000028
848 JGI25161J50226_1000078
849 Ga0006562J51391_1014638
850 Ga0055526_1000242
851 Ga0055526_1002943
852 Ga0055526_1008596
853 Ga0055526_1011220
854 Ga0055526_1024393
855 Ga0055526_1027275
856 Ga0055524_1007816
857 Ga0055524_1010378
858 Ga0055524_1014128
859 Ga0055524_1026395
860 Ga0055524_1031439
861 Ga0055528_1000113
862 Ga0055528_1009089
863 Ga0055528_1016207
864 Ga0055528_1025007
865 Ga0055528_1025022
866 Ga0055530_10009535
867 Ga0055540_1009829
868 Ga0055540_1013267
869 Ga0055540_1018007
870 Ga0055531_10041958
871 JGI25405J52794_10023527
872 Ga0055543_1000054
873 Ga0055543_1000069
874 Ga0055543_1008099
875 Ga0065165_1000318
876 Ga0065165_1001841
877 Ga0065165_1009690
878 Ga0065707_10097784
879 Ga0065707_10106344
880 Ga0070658_10002626
881 Ga0070683_100044725
882 Ga0070670_100000105
883 Ga0070666_10131717
884 Ga0070680_100003898
885 Ga0070689_100118840
886 Ga0070691_10103671
887 Ga0070661_100056787
888 Ga0070668_100008388
889 Ga0070668_100367952
890 Ga0070669_100009624
891 Ga0070675_100061463
892 Ga0070671_100037812
893 Ga0070674_100007923
894 Ga0070674_100062032
895 Ga0070688_100220092
896 Ga0070667_100001050
897 Ga0070713_100019350
898 Ga0070708_100444427
899 Ga0070678_100107072
900 Ga0070662_100302187
901 Ga0070681_10039594
902 Ga0068867_100002992
903 Ga0070706_100000708
904 Ga0070706_100282245
905 Ga0070707_100057697
906 Ga0070698_100000987
907 Ga0070699_100025390
908 Ga0070699_100040866
909 Ga0070699_100450560
910 Ga0070679_100030405
911 Ga0070697_100010490
912 Ga0070697_100195872
913 Ga0068853_100290516
914 Ga0068853_100298914
915 Ga0070672_100024302
916 Ga0070696_100036846
917 Ga0070665_100025181
918 Ga0070665_100032009
919 Ga0068855_100088510
920 Ga0068855_100088724
921 Ga0068857_100122150
922 Ga0068857_100124930
923 Ga0068856_100063949
924 Ga0068852_100146981
925 Ga0068859_100089126
926 Ga0068859_100181250
927 Ga0068866_10017754
928 Ga0068866_10078466
929 Ga0068861_100000849
930 Ga0068861_100033362
931 Ga0068870_10139131
932 Ga0068858_100043489
933 Ga0068860_100004285
934 Ga0068860_100122017
935 Ga0068862_100005672
936 Ga0068862_100023621
937 Ga0081455_10001748
938 Ga0081455_10026351
939 Ga0081455_10259731
940 Ga0081538_10010243
941 Ga0081538_10129361
942 Ga0081540_1009139
943 Ga0081540_1050186
944 Ga0081539_10002734
945 Ga0081539_10044159
946 Ga0075365_10002194
947 Ga0075365_10009158
948 Ga0075365_10132854
949 Ga0075364_10165295
950 Ga0070712_100168158
951 Ga0075362_10114791
952 Ga0075367_10056918
953 Ga0075367_10119885
954 Ga0075367_10134136
955 Ga0075369_10021432
956 Ga0075366_10007808
957 Ga0075366_10065212
958 Ga0075366_10175270
959 Ga0075370_10005472
960 Ga0075370_10036990
961 Ga0075431_100001768
962 Ga0075429_100058767
963 Ga0068865_100002258
964 Ga0068865_100051171
965 Ga0097620_100089125
966 Ga0097620_100181249
967 Ga0099794_10042247
968 Ga0105240_10001468
969 Ga0105240_10009499
970 Ga0111539_10000042
971 Ga0111539_10179738
972 Ga0111539_10481012
973 Ga0105245_10301045
974 Ga0105245_10319723
975 Ga0114129_10002929
976 Ga0105248_10019677
977 Ga0105248_10214978
978 Ga0105237_10004445
979 Ga0105238_10027122
980 Ga0105249_10365488
981 Ga0105249_10488272
982 Ga0105249_10559291
983 Ga0123341_1000017
984 Ga0099796_10014736
985 Ga0105239_10012629
986 Ga0157322_1000006
987 Ga0157373_10017731
988 Ga0157373_10212350
989 Ga0157370_10001796
990 Ga0157370_10241175
991 Ga0157370_10269875
992 Ga0171462_1013
993 Ga0157378_10004470
994 Ga0163162_10056123
995 Ga0163162_10122458
996 Ga0163162_10452500
997 Ga0157372_10048084
998 Ga0157375_10138727
999 Ga0157375_10656686
1000 Ga0157380_10006304
1001 Ga0157379_10027342
1002 Ga0163161_10169229
1003 Ga0213874_10031175
1004 Ga0213876_10001403
1005 Ga0213876_10008021
1006 Ga0213876_10033662
1007 Ga0213875_10003372
1008 Ga0209435_100087
1009 Ga0209436_100268
1010 Ga0209437_100050
1011 Ga0209437_100205
1012 Ga0209437_103334
1013 Ga0207425_1000052
1014 Ga0207425_1000527
1015 Ga0207425_1000665
1016 Ga0207425_1005861
1017 Ga0209646_1000285
1018 Ga0209026_1000347
1019 Ga0209148_1002865
1020 Ga0209759_1000482
1021 Ga0209129_1000041
1022 Ga0209129_1000066
1023 Ga0209129_1000141
1024 Ga0209129_1001099
1025 Ga0209129_1003016
1026 Ga0209129_1011192
1027 Ga0209129_1017206
1028 Ga0209233_1000037
1029 Ga0209233_1000187
1030 Ga0209233_1000232
1031 Ga0209455_1001248
1032 Ga0209673_1000024
1033 Ga0209673_1000911
1034 Ga0209673_1012356
1035 Ga0209673_1013782
1036 Ga0209673_1043372
1037 Ga0209130_1000002
1038 Ga0209130_1000093
1039 Ga0209130_1000422
1040 Ga0209676_1019999
1041 Ga0209025_1000053
1042 Ga0209025_1000144
1043 Ga0209025_1000274
1044 Ga0209025_1000275
1045 Ga0209025_1003887
1046 Ga0209025_1013651
1047 Ga0209025_1022384
1048 Ga0209564_1000029
1049 Ga0209564_1000043
1050 Ga0209564_1000262
1051 Ga0209564_1000474
1052 Ga0209564_1000486
1053 Ga0209758_1000043
1054 Ga0209758_1000057
1055 Ga0209758_1000229
1056 Ga0209758_1000466
1057 Ga0209758_1002556
1058 Ga0209758_1017231
1059 Ga0209050_1000149
1060 Ga0209050_1010764
1061 Ga0209256_1000868
1062 Ga0209256_1001436
1063 Ga0209256_1003327
1064 Ga0209256_1011918
1065 Ga0209256_1013244
1066 Ga0207426_1000012
1067 Ga0207426_1000013
1068 Ga0207426_1000142
1069 Ga0207426_1000198
1070 Ga0207426_1002097
1071 Ga0207426_1021381
1072 Ga0209051_1000170
1073 Ga0209051_1010621
1074 Ga0209051_1014264
1075 Ga0209051_1027331
1076 Ga0209257_1027182
1077 Ga0207656_10075949
1078 Ga0207642_10038830
1079 Ga0207688_10102761
1080 Ga0207688_10211085
1081 Ga0207680_10049806
1082 Ga0207645_10052145
1083 Ga0207645_10076364
1084 Ga0207705_10280623
1085 Ga0207684_10066252
1086 Ga0207707_10019725
1087 Ga0207707_10386837
1088 Ga0207695_10000427
1089 Ga0207695_10126172
1090 Ga0207671_10002841
1091 Ga0207693_10033704
1092 Ga0207652_10048257
1093 Ga0207646_10190607
1094 Ga0207681_10012222
1095 Ga0207681_10013114
1096 Ga0207681_10070454
1097 Ga0207694_10078016
1098 Ga0207650_10000302
1099 Ga0207687_10036195
1100 Ga0207700_10084832
1101 Ga0207644_10022013
1102 Ga0207706_10209385
1103 Ga0207670_10071609
1104 Ga0207669_10202397
1105 Ga0207704_10006660
1106 Ga0207704_10032588
1107 Ga0207704_10037628
1108 Ga0207691_10009293
1109 Ga0207711_10078855
1110 Ga0207661_10031766
1111 Ga0207667_10022968
1112 Ga0207668_10038371
1113 Ga0207658_10000576
1114 Ga0207658_10028202
1115 Ga0207677_10369710
1116 Ga0207703_10021969
1117 Ga0207639_10252353
1118 Ga0207678_10041986
1119 Ga0207708_10047648
1120 Ga0207702_10038579
1121 Ga0207702_10052722
1122 Ga0207702_10081555
1123 Ga0207648_10009516
1124 Ga0207674_10048582
1125 Ga0207674_10145686
1126 Ga0207675_100002512
1127 Ga0207675_100020788
1128 Ga0207675_100144260
1129 Ga0207683_10005865
1130 Ga0207683_10095318
1131 Ga0207683_10248498
1132 Ga0209371_1002100
1133 Ga0207428_10000092
1134 Ga0207428_10055437
1135 Ga0268266_10004190
1136 Ga0268266_10099248
1137 Ga0268265_10013241
1138 Ga0268265_10026643
1139 Ga0268264_10001072
1140 Ga0268264_10479516
1141 Ga0265334_10005584
1142 Ga0307517_10000922
1143 Ga0307517_10101384
1144 Ga0307515_10000306
1145 Ga0307515_10008185
1146 Ga0307515_10301336
1147 Ga0268256_1005033
1148 Ga0307512_10034912
1149 Ga0265331_10011765
1150 Ga0265316_10073853
1151 Ga0307513_10113027
1152 Ga0307513_10166937
1153 Ga0307513_10212882
1154 Ga0307509_10000041
1155 Ga0307509_10003895
1156 Ga0265313_10053406
1157 Ga0307508_10000113
1158 Ga0307508_10036513
1159 Ga0307514_10008015
1160 Ga0307516_10041776
1161 Ga0307405_10001044
1162 Ga0307413_10040277
1163 Ga0307413_10217504
1164 Ga0307406_10006383
1165 Ga0307406_10085735
1166 Ga0307407_10100207
1167 Ga0307407_10182785
1168 Ga0307412_10002606
1169 Ga0307409_100025293
1170 Ga0307415_100134848
1171 Ga0307510_10011906
1172 Ga0307510_10027735
1173 Ga0307510_10037985
1174 Ga0307510_10045419
1175 Ga0307510_10167569
1176 Ga0373929_0009326
1177 Ga0373939_0078319
1178 Ga0373931_0146349
1179 Ga0373935_0209583
1180 Ga0373927_0098951
1181 Ga0373947_0153017
1182 Ga0373925_0003621
1183 Ga0373925_0182507
1184 Ga0395900_0011631
1185 Ga0395900_0019809
1186 Ga0395900_0061251
1187 Ga0395898_0017238
1188 Ga0395898_0252071
1189 Ga0395905_0054137
1190 Ga0436364_0677535
1191 Ga0395901_0001404
1192 Ga0395901_0006779
1193 Ga0395901_0069622
1194 Ga0436365_0021793
1195 Ga0436365_0184712
1196 Ga0436365_1374407
1197 Ga0436360_1291673
1198 Ga0436363_0337627
1199 Ga0436363_1409112
1200 Ga0436362_0108458
1201 Ga0436362_1202906
1202 Ga0451800_0415455
1203 Ga0451804_0831358
1204 Ga0451839_0183003
1205 Ga0451851_0442598
1206 Ga0451843_0766251
1207 Ga0451854_34019
1208 Ga0451855_0326464
1209 Ga0451853_1746300
1210 Ga0452268_37843
1211 Ga0452271_05939
1212 Ga0439431_0019793
1213 Ga0439448_0038522
1214 Ga0439449_0024843
1215 Ga0450894_006327
1216 Ga0439435_0001104
1217 Ga0439460_0025686
1218 Ga0466969_0031481
1219 Ga0466961_0172707
1220 Ga0466963_0080558
1221 Ga0453684_0111102
1222 Ga0466960_0063410
1223 Ga0466959_0091715
1224 Ga0451576_0006848
1225 Ga0451576_0132046
1226 Ga0466967_0014017
1227 Ga0466967_0585001
1228 Ga0495592_0000942
1229 Ga0495638_0001022
1230 Ga0495638_0154329
1231 Ga0495585_0038200
1232 Ga0495610_0007299
1233 Ga0495610_0008615
1234 Ga0495632_0004698
1235 Ga0495632_0005440
1236 Ga0495632_0039431
1237 Ga0495643_0023147
1238 Ga0495643_0030815
1239 Ga0495642_0052531
1240 Ga0495654_0022823
1241 Ga0495597_0011802
1242 Ga0495656_0020512
1243 Ga0495668_0036483
1244 Ga0495625_0088888
1245 Ga0495646_0101016
1246 Ga0495671_0053401
1247 Ga0495600_0025245
1248 Ga0495660_0015916
1249 Ga0495683_0031177
1250 Ga0495685_049203
1251 Ga0495686_0033227
1252 Ga0495686_0088798
1253 Ga0496106_0005047
1254 Ga0496116_0007488
1255 Ga0496117_0035780
1256 Ga0496117_0085263
1257 Ga0496118_0017292
1258 Ga0496121_0005879
1259 Ga0496121_0091173
1260 Ga0496122_0072947
1261 Ga0496122_0110837
1262 Ga0496123_0036381
1263 Ga0496123_0038564
1264 Ga0496124_0005332
1265 Ga0496124_0009932
1266 Ga0496124_0100512
1267 Ga0496124_0121213
1268 Ga0496125_0120455
1269 Ga0496126_0038443
1270 Ga0496126_0261458
1271 Ga0496126_0298649
1272 Ga0495678_009804
1273 Ga0495682_0034235
1274 Ga0501032_0010551
1275 Ga0501032_0094432
1276 Ga0501033_0003346
1277 Ga0501034_0001155
1278 Ga0501034_0001184
1279 Ga0501034_0050984
1280 Ga0501034_0082348
1281 Ga0501036_0003819
1282 Ga0501037_0032773
1283 Ga0501038_0027793
1284 Ga0501039_0173614
1285 Ga0501043_0005235
1286 Ga0501043_0094246
1287 Ga0501046_0006691
1288 Ga0501046_0280718
1289 Ga0501047_0008841
1290 Ga0501047_0153097
1291 Ga0501048_0311097
1292 Ga0501067_0016526
1293 Ga0501068_0003406
1294 Ga0501068_0013434
1295 Ga0501069_0001256
1296 Ga0501070_0007366
1297 Ga0501072_0071160
1298 Ga0501072_0138969
1299 Ga0501073_0007895
1300 Ga0501074_0022480
1301 Ga0501074_0032660
1302 Ga0501206_011512
1303 Ga0501257_011803
1304 Ga0501080_0002543
1305 Ga0501083_0079471
1306 Ga0501044_0008176
1307 Ga0501044_0038523
1308 nmdc:mga03683_100597_c1
1309 nmdc:mga03n38_47757_c1
1310 nmdc:mga00v17_103364_c1
1311 nmdc:mga0yw44_266293_c1
1312 nmdc:mga0yw44_56616_c1
1313 nmdc:mga0k408_102585_c1
1314 nmdc:mga0k408_121234_c1
1315 nmdc:mga0k408_42625_c1
1316 nmdc:mga0k408_97866_c1
1317 nmdc:mga06z11_11845_c1
1318 nmdc:mga06z11_134282_c1
1319 nmdc:mga07m45_11762_c1
1320 nmdc:mga07m45_30780_c1
1321 nmdc:mga05p37_31046_c1
1322 nmdc:mga05p37_320098_c1
1323 nmdc:mga09592_61927_c1
1324 nmdc:mga06r32_21551_c1
1325 nmdc:mga08y16_428007_c1
1326 nmdc:mga08y16_46_c1
1327 nmdc:mga08y16_51467_c1
1328 nmdc:mga0sz30_3471_c1
1329 nmdc:mga0sz30_47533_c1
1330 Ga0495612_0077768
1331 Ga0500578_0000011
1332 Ga0500578_0238126
1333 Ga0500644_0006020
1334 Ga0500646_0009446
1335 Ga0500647_0080266
1336 Ga0500651_0009464
1337 Ga0500651_0030780
1338 Ga0500641_0000382
1339 Ga0500594_0014610
1340 Ga0500623_083455
1341 Ga0500628_001535
1342 Ga0500642_0013263
1343 Ga0500642_0058475
1344 Ga0500652_000495
1345 Ga0500655_004188
1346 Ga0500658_0001766
1347 Ga0500559_0000175
1348 Ga0500568_0067092
1349 Ga0500577_0023036
1350 Ga0500590_058104
1351 Ga0500604_0072238
1352 Ga0500616_0002146
1353 Ga0500616_0007056
1354 Ga0500616_0046348
1355 Ga0500622_0000689
1356 Ga0500622_0001214
1357 Ga0500622_0003093
1358 Ga0500627_0141133
1359 Ga0500636_0097121
1360 Ga0500552_006428
1361 Ga0500587_001344
1362 Ga0501084_0006097
1363 Ga0590077_016072
1364 Ga0587073_0020941
1365 Ga0501082_0003890
1366 Ga0501082_0159757
1367 Ga0501082_0484692
1368 2509388999
1369 2509444589
1370 2510135664
1371 2510897137
1372 2511137157
1373 2511185331
1374 2511200527
1375 2513570825
1376 2513574960
1377 2513595608
1378 2513633744
1379 2513707591
1380 2513865367
1381 2513910993
1382 2513924301
1383 2514023675
1384 2515114828
1385 2515635815
1386 2515641429
1387 2515659318
1388 2515741187
1389 2517038446
1390 2517078722
1391 2517097464
1392 2517408920
1393 2520379186
1394 2524461876
1395 2530648349
1396 2535514579
1397 2585201276
1398 2585223254
1399 2585256419
1400 2585273453
1401 2585283165
1402 2585328206
1403 2585330618
1404 2585399095
1405 2585523963
1406 2585536013
1407 2585542107
1408 2585546150
1409 2585556659
1410 2585564019
1411 2585818755
1412 2585840683
1413 2585843699
1414 2585900311
1415 2585909273
1416 2587730362
1417 2587736867
1418 2587984625
1419 2588291771
1420 2599419741
1421 2616293966
1422 2616311192
1423 2616556074
1424 2617380727
1425 2643972405
1426 2644004422
1427 2644138587
1428 2644272913
1429 2644298206
1430 2644305782
1431 2644656458
1432 2644737562
1433 2644743829
1434 2671115841
1435 2719183327
1436 2719388087
1437 2719667710
1438 2719734044
1439 2720494130
1440 2720615593
1441 2720622376
1442 2720633730
1443 2720777430
1444 2721149439
1445 2721160842
1446 2721166276
1447 2721401720
1448 2722842446
1449 2723029027
1450 2723562644
1451 2723569337
1452 2724040534
1453 2724046800
1454 2724092037
1455 2724106602
1456 2724112410
1457 2725949672
1458 2730109963
1459 2730166562
1460 2730300474
1461 2738800774
1462 2738946696
1463 2739037356
1464 2766067166
1465 2776915985
1466 2778179502
1467 2793283108
1468 2793298455
1469 2793315705
1470 2793323488
1471 2793327566
1472 2793335637
1473 2793341031
1474 2793350292
1475 2793354767
1476 2793358536
1477 2793368988
1478 2805928912
1479 2805934533
1480 2806047083
1481 2806054918
1482 2806061854
1483 2806069623
1484 2806076006
1485 2819244213
1486 2819608885
1487 2819643310
1488 2819720523
1489 2821444385
1490 2838020937
1491 2838026840
1492 2838033950
1493 2838039726
1494 2838044861
1495 2838052914
1496 2838064707
1497 2838070516
1498 2838664004
1499 2838672536
1500 2838685579
1501 2838689845
1502 2838695965
1503 2838705141
1504 2838713364
1505 2838731459
1506 2838744400
1507 2841764853
1508 2841852940
1509 2841870215
1510 2842082598
1511 2842112753
1512 2842123843
1513 2842150135
1514 2842160267
1515 2842165755
1516 2842184067
1517 2842196369
1518 2842202443
1519 2842208905
1520 2842219431
1521 2842231649
1522 2842242898
1523 2842245882
1524 2842254821
1525 2842260260
1526 2842267148
1527 2842273671
1528 2842282405
1529 2842290055
1530 2842296971
1531 2842299942
1532 2842308477
1533 2842312219
1534 2842321813
1535 2842344661
1536 2842359536
1537 2842367764
1538 2842376035
1539 2842383245
1540 2842390378
1541 2842397846
1542 2842407665
1543 2842414296
1544 2842420844
1545 2842424130
1546 2842431156
1547 2842437491
1548 2842444306
1549 2842451267
1550 2842465299
1551 2842472232
1552 2842480696
1553 2842487260
1554 2842494103
1555 2842501252
1556 2842507261
1557 2842514535
1558 2844107699
1559 2844456593
1560 2844539642
1561 2851183540
1562 2851249805
1563 2852387859
1564 2857520889
1565 2884301201
1566 2913311946
1567 2917702918
1568 2919101867
1569 2919408323
1570 2919496510
1571 2919546894
1572 2923526553
1573 2923556186
1574 2933574926
1575 2933588358
1576 2933601321
1577 2935899983
1578 2935902320
1579 2936369546
1580 2936380287
1581 2936385256
1582 2989776836
1583 2996887973
1584 2996897594
1585 3005410630
1586 3005423304
1587 3005450091
1588 3005456338
1589 639646063
1590 8005247881
1591 8005261461
1592 8005278289
1593 8005282677
1594 8005291653
1595 8005305474
1596 8005310250
1597 8005315631
1598 8005322500
1599 8005378103
1600 8005384113
1601 8005399609
1602 8005433798
1603 8005465524
1604 8005484462
1605 8005498107
1606 8005543239
1607 8005559974
1608 8005564532
1609 8005571218
1610 8005619316
1611 8005627881
1612 8005647382
1613 8005669515
1614 8005687462
1615 8005692774
1616 8005701462
1617 8018132532
1618 8018167608
1619 8018176621
1620 8023681273
1621 8024481896
1622 8024488596
1623 8024506332
1624 8046768686
1625 8055433776
1626 8056381191
1627 8056382684
1628 8057533124
1629 8057582461
1630 8057878702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02608

Bmp

ABC transporter substrate-binding protein PnrA-like

26

311

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.931 23 331
2fqy-assembly1.cif.gz_A pnra from treponema pallidum complexed with adenosine. 0.9137 21 320
6shu-assembly1.cif.gz_A borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine 0.9078 23 321
6yab-assembly3.cif.gz_BBB crystal structure of pnra from s. pneumoniae in complex with uridine 0.8959 23 320
2hqb-assembly1.cif.gz_A crystal structure of a transcriptional activator of comk gene from bacillus halodurans 0.8946 23 320
ID Description Score Start End Superfamily
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8654 126 320 3.40.50.2300
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8562 126 320 3.40.50.2300
2fqwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8518 126 320 3.40.50.2300
2hqbA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8159 130 329 3.40.50.2300
2fqwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8077 126 320 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A349KVF0-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.966 26 202 GO:0005886
AF-A0A0S2SMB5-F1-model_v4 Periplasmic component/surface lipoprotein 0.9631 137 329 GO:0005886
AF-A0A212JPP1-F1-model_v4 Nucleoside-binding protein 0.963 20 321 GO:0005886
AF-A0A357T2I1-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.963 70 180 GO:0005886
AF-A0A1W9UHM6-F1-model_v4 ABC transporter substrate-binding protein PnrA-like domain-containing protein 0.961 27 320 GO:0005886

Map