F482018

General Info

Members Datasets Scaffolds Average Seq Length
815 288 815 128

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10262607|Ga0265314_102626072
Length 156
Sequence MHGLSRYNPNRFAVRLLPDATDPDDTERLIMTKDAARLVLVVEDDVSVRRPLVKFLEMHGFAVVTAETSDEGLDQLRKNRVVAAVVDLRLRRGSGRDVVTSVPADVPVIIFSGVPSESAELERLRPRTRLIEKPYSLVLLVETLEEMLAESSAPNA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 5.28
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10443799 3300005293 Bacteria 832
2 Ga0065707_10768756 3300005295 Bacteria 592
3 Ga0070658_10012592 3300005327 Bacteria 6785
4 Ga0070683_102245138 3300005329 Unclassified 524
5 Ga0070690_100701936 3300005330 Bacteria 777
6 Ga0070670_100463438 3300005331 Bacteria 1124
7 Ga0070677_10136872 3300005333 Bacteria 1125
8 Ga0070677_10223646 3300005333 Bacteria 921
9 Ga0070677_10314871 3300005333 Archaea 800
10 Ga0068869_100082933 3300005334 Bacteria 2397
11 Ga0068869_100447990 3300005334 Bacteria 1070
12 Ga0068869_100460686 3300005334 Bacteria 1055
13 Ga0068869_100722886 3300005334 Bacteria 851
14 Ga0070666_10869830 3300005335 Bacteria 666
15 Ga0068868_100037394 3300005338 Bacteria 3763
16 Ga0068868_100119930 3300005338 Bacteria 2145
17 Ga0068868_100170374 3300005338 Bacteria 1802
18 Ga0068868_100419711 3300005338 Bacteria 1158
19 Ga0070660_100064261 3300005339 Bacteria 2855
20 Ga0070689_100094020 3300005340 Unclassified 2367
21 Ga0070689_100967094 3300005340 Bacteria 756
22 Ga0070687_100224423 3300005343 Bacteria 1153
23 Ga0070687_100506445 3300005343 Bacteria 814
24 Ga0070661_100211698 3300005344 Bacteria 1484
25 Ga0070661_100564304 3300005344 Bacteria 917
26 Ga0070692_10593538 3300005345 Bacteria 732
27 Ga0070668_100350158 3300005347 Bacteria 1250
28 Ga0070669_100046718 3300005353 Bacteria 3157
29 Ga0070669_100047404 3300005353 Unclassified 3135
30 Ga0070669_100093200 3300005353 Bacteria 2262
31 Ga0070669_100205521 3300005353 Unclassified 1551
32 Ga0070675_100004928 3300005354 Bacteria 10178
33 Ga0070675_100083888 3300005354 Bacteria 2660
34 Ga0070675_100357175 3300005354 Bacteria 1297
35 Ga0070675_100394357 3300005354 Bacteria 1234
36 Ga0070675_100769245 3300005354 Unclassified 879
37 Ga0070671_100044941 3300005355 Bacteria 3670
38 Ga0070671_100361176 3300005355 Bacteria 1240
39 Ga0070671_100365478 3300005355 Bacteria 1232
40 Ga0070674_100072587 3300005356 Unclassified 2437
41 Ga0070674_100121193 3300005356 Bacteria 1936
42 Ga0070674_100139155 3300005356 Bacteria 1820
43 Ga0070674_100183991 3300005356 Bacteria 1602
44 Ga0070674_100490309 3300005356 Bacteria 1021
45 Ga0070674_100575658 3300005356 Bacteria 948
46 Ga0070673_100063214 3300005364 Bacteria 2945
47 Ga0070673_100098118 3300005364 Unclassified 2407
48 Ga0070673_100167660 3300005364 Unclassified 1872
49 Ga0070673_100305577 3300005364 Bacteria 1401
50 Ga0070673_100811122 3300005364 Unclassified 864
51 Ga0070673_101028703 3300005364 Unclassified 768
52 Ga0070688_100134780 3300005365 Unclassified 1671
53 Ga0070688_100313434 3300005365 Bacteria 1138
54 Ga0070667_100009819 3300005367 Bacteria 7934
55 Ga0070667_100318647 3300005367 Bacteria 1403
56 Ga0070709_10080261 3300005434 Bacteria 2127
57 Ga0070709_10245755 3300005434 Bacteria 1287
58 Ga0070714_100044820 3300005435 Bacteria 3745
59 Ga0070705_100483740 3300005440 Unclassified 936
60 Ga0070705_101144018 3300005440 Bacteria 639
61 Ga0070700_100122822 3300005441 Bacteria 1742
62 Ga0070700_100856071 3300005441 Bacteria 737
63 Ga0070694_100062300 3300005444 Bacteria 2548
64 Ga0070694_100096741 3300005444 Bacteria 2081
65 Ga0070694_100705236 3300005444 Bacteria 821
66 Ga0070708_100164533 3300005445 Bacteria 2069
67 Ga0070708_100554904 3300005445 Bacteria 1083
68 Ga0070708_100771718 3300005445 Bacteria 904
69 Ga0070708_101925576 3300005445 Unclassified 548
70 Ga0070678_100612660 3300005456 Bacteria 973
71 Ga0070678_101175206 3300005456 Bacteria 711
72 Ga0070678_101499574 3300005456 Bacteria 631
73 Ga0070678_101779224 3300005456 Bacteria 581
74 Ga0070662_100344256 3300005457 Bacteria 1220
75 Ga0070662_100723809 3300005457 Bacteria 843
76 Ga0070662_101188238 3300005457 Bacteria 655
77 Ga0070662_101194822 3300005457 Bacteria 654
78 Ga0070681_10474497 3300005458 Bacteria 1163
79 Ga0070681_11423507 3300005458 Bacteria 617
80 Ga0070681_11774500 3300005458 Unclassified 544
81 Ga0068867_100046159 3300005459 Bacteria 3199
82 Ga0068867_100382326 3300005459 Bacteria 1183
83 Ga0068867_100758830 3300005459 Bacteria 861
84 Ga0068867_101181283 3300005459 Bacteria 702
85 Ga0070685_10109186 3300005466 Bacteria 1701
86 Ga0070706_100208008 3300005467 Bacteria 1827
87 Ga0070706_100475305 3300005467 Bacteria 1163
88 Ga0070706_101588395 3300005467 Viruses 597
89 Ga0070706_101865449 3300005467 Bacteria 546
90 Ga0070707_100036870 3300005468 Bacteria 4666
91 Ga0070707_100061815 3300005468 Bacteria 3593
92 Ga0070707_100263363 3300005468 Bacteria 1677
93 Ga0070707_100421753 3300005468 Unclassified 1295
94 Ga0070707_100723988 3300005468 Bacteria 958
95 Ga0070698_100014460 3300005471 Bacteria 8337
96 Ga0070698_100246029 3300005471 Bacteria 1721
97 Ga0070698_101082948 3300005471 Archaea 750
98 Ga0070698_101720080 3300005471 Bacteria 580
99 Ga0070699_100004418 3300005518 Bacteria 12429
100 Ga0070699_100127022 3300005518 Bacteria 2246
101 Ga0070699_100559274 3300005518 Bacteria 1041
102 Ga0070699_101457645 3300005518 Bacteria 628
103 Ga0070684_101378596 3300005535 Unclassified 664
104 Ga0070697_100030072 3300005536 Bacteria 4360
105 Ga0070697_100137743 3300005536 Bacteria 2051
106 Ga0070697_100384029 3300005536 Unclassified 1217
107 Ga0070697_100415161 3300005536 Bacteria 1169
108 Ga0070697_100464079 3300005536 Bacteria 1104
109 Ga0070672_100018842 3300005543 Bacteria 4998
110 Ga0070672_100111115 3300005543 Bacteria 2234
111 Ga0070672_100385756 3300005543 Bacteria 1199
112 Ga0070672_100628876 3300005543 Bacteria 936
113 Ga0070672_100916554 3300005543 Bacteria 774
114 Ga0070686_100477557 3300005544 Bacteria 963
115 Ga0070686_101120361 3300005544 Bacteria 651
116 Ga0070695_100035574 3300005545 Bacteria 3129
117 Ga0070695_100242718 3300005545 Bacteria 1307
118 Ga0070696_100054449 3300005546 Bacteria 2788
119 Ga0070696_100334602 3300005546 Bacteria 1169
120 Ga0070696_100368348 3300005546 Bacteria 1117
121 Ga0070696_100555178 3300005546 Bacteria 921
122 Ga0070693_100299339 3300005547 Bacteria 1084
123 Ga0070665_100007922 3300005548 Bacteria 10770
124 Ga0070665_100020938 3300005548 Bacteria 6572
125 Ga0070665_100044139 3300005548 Bacteria 4477
126 Ga0070665_100473760 3300005548 Bacteria 1263
127 Ga0070704_100031805 3300005549 Bacteria 3553
128 Ga0070704_100130483 3300005549 Unclassified 1947
129 Ga0070704_100206782 3300005549 Unclassified 1588
130 Ga0070704_100662055 3300005549 Bacteria 923
131 Ga0070704_100701266 3300005549 Bacteria 898
132 Ga0070704_100988370 3300005549 Bacteria 761
133 Ga0068855_100141000 3300005563 Bacteria 2748
134 Ga0070664_100403298 3300005564 Bacteria 1251
135 Ga0068854_100917123 3300005578 Bacteria 771
136 Ga0068856_100679517 3300005614 Unclassified 1050
137 Ga0070702_100473531 3300005615 Unclassified 914
138 Ga0068852_101250882 3300005616 Bacteria 764
139 Ga0068852_102033183 3300005616 Unclassified 597
140 Ga0068859_100007252 3300005617 Bacteria 11245
141 Ga0068859_100256114 3300005617 Bacteria 1841
142 Ga0068859_100341004 3300005617 Unclassified 1593
143 Ga0068859_100388259 3300005617 Unclassified 1492
144 Ga0068859_100641225 3300005617 Bacteria 1154
145 Ga0068859_101014369 3300005617 Bacteria 912
146 Ga0068859_101412808 3300005617 Unclassified 768
147 Ga0068859_101892345 3300005617 Bacteria 659
148 Ga0068859_101920156 3300005617 Bacteria 654
149 Ga0068859_102661461 3300005617 Bacteria 550
150 Ga0068864_100008563 3300005618 Bacteria 8442
151 Ga0068864_100220254 3300005618 Bacteria 1751
152 Ga0068864_102226010 3300005618 Archaea 555
153 Ga0068866_10094100 3300005718 Bacteria 1639
154 Ga0068866_10223482 3300005718 Bacteria 1137
155 Ga0068866_10232523 3300005718 Bacteria 1119
156 Ga0068866_10322634 3300005718 Bacteria 972
157 Ga0068866_10344498 3300005718 Bacteria 945
158 Ga0068866_11003586 3300005718 Bacteria 593
159 Ga0068861_100014808 3300005719 Bacteria 5481
160 Ga0068861_100375462 3300005719 Bacteria 1254
161 Ga0068861_100656303 3300005719 Bacteria 970
162 Ga0068861_100752572 3300005719 Bacteria 910
163 Ga0068870_10927106 3300005840 Bacteria 617
164 Ga0068863_100011271 3300005841 Bacteria 8659
165 Ga0068863_100767668 3300005841 Bacteria 960
166 Ga0068863_101486205 3300005841 Bacteria 686
167 Ga0068858_100116716 3300005842 Archaea 2494
168 Ga0068858_100127832 3300005842 Bacteria 2381
169 Ga0068858_100245466 3300005842 Bacteria 1700
170 Ga0068858_100466665 3300005842 Bacteria 1217
171 Ga0068858_100797066 3300005842 Bacteria 922
172 Ga0068858_102085652 3300005842 Bacteria 561
173 Ga0068860_100049142 3300005843 Bacteria 4019
174 Ga0068860_100076396 3300005843 Bacteria 3186
175 Ga0068860_100154553 3300005843 Bacteria 2211
176 Ga0068860_100402509 3300005843 Bacteria 1354
177 Ga0068860_100581434 3300005843 Bacteria 1124
178 Ga0068860_100807238 3300005843 Bacteria 952
179 Ga0068860_101234856 3300005843 Unclassified 768
180 Ga0068862_100043489 3300005844 Bacteria 3830
181 Ga0068862_100130187 3300005844 Unclassified 2225
182 Ga0068862_100372530 3300005844 Bacteria 1330
183 Ga0068862_100571967 3300005844 Bacteria 1081
184 Ga0081455_10033163 3300005937 Bacteria 4644
185 Ga0081455_10095237 3300005937 Bacteria 2403
186 Ga0081539_10012200 3300005985 Bacteria 6668
187 Ga0070717_10367399 3300006028 Bacteria 1289
188 Ga0070717_10482438 3300006028 Bacteria 1119
189 Ga0070717_10972207 3300006028 Unclassified 773
190 Ga0075432_10143502 3300006058 Bacteria 913
191 Ga0075432_10265698 3300006058 Bacteria 701
192 Ga0070715_10248955 3300006163 Unclassified 928
193 Ga0070716_100911557 3300006173 Unclassified 689
194 Ga0097621_100006112 3300006237 Bacteria 8524
195 Ga0097621_100009489 3300006237 Bacteria 7064
196 Ga0097621_100012698 3300006237 Bacteria 6257
197 Ga0097621_100023804 3300006237 Unclassified 4772
198 Ga0097621_100027466 3300006237 Bacteria 4476
199 Ga0068871_100002793 3300006358 Bacteria 11934
200 Ga0068871_100003046 3300006358 Bacteria 11499
201 Ga0068871_100007740 3300006358 Bacteria 7693
202 Ga0068871_100012348 3300006358 Bacteria 6293
203 Ga0068871_100438342 3300006358 Bacteria 1169
204 Ga0068871_100506652 3300006358 Bacteria 1089
205 Ga0068871_100561590 3300006358 Bacteria 1035
206 Ga0075428_100117748 3300006844 Bacteria 2894
207 Ga0075428_100148388 3300006844 Bacteria 2548
208 Ga0075428_100455326 3300006844 Bacteria 1370
209 Ga0075431_100092801 3300006847 Bacteria 3116
210 Ga0075431_100369325 3300006847 Archaea 1440
211 Ga0075433_10024699 3300006852 Bacteria 5075
212 Ga0075433_10078981 3300006852 Bacteria 2899
213 Ga0075433_10098176 3300006852 Bacteria 2593
214 Ga0075433_10108884 3300006852 Bacteria 2458
215 Ga0075433_10148238 3300006852 Bacteria 2086
216 Ga0075433_10490583 3300006852 Bacteria 1082
217 Ga0075434_100000776 3300006871 Bacteria 25295
218 Ga0075434_100102251 3300006871 Bacteria 2873
219 Ga0075434_100133145 3300006871 Bacteria 2505
220 Ga0075434_100500448 3300006871 Bacteria 1236
221 Ga0075434_100529729 3300006871 Bacteria 1198
222 Ga0075434_100568177 3300006871 Bacteria 1153
223 Ga0075434_101288614 3300006871 Unclassified 742
224 Ga0075429_100433410 3300006880 Bacteria 1152
225 Ga0075429_100551931 3300006880 Bacteria 1010
226 Ga0075429_100575771 3300006880 Bacteria 987
227 Ga0068865_100005193 3300006881 Bacteria 7874
228 Ga0068865_100153959 3300006881 Bacteria 1747
229 Ga0068865_100399449 3300006881 Bacteria 1125
230 Ga0075436_100001718 3300006914 Bacteria 14994
231 Ga0075436_100035222 3300006914 Bacteria 3453
232 Ga0075436_100068074 3300006914 Bacteria 2460
233 Ga0075436_100082118 3300006914 Bacteria 2235
234 Ga0075436_100186902 3300006914 Bacteria 1465
235 Ga0075436_100386884 3300006914 Unclassified 1012
236 Ga0075436_100923072 3300006914 Unclassified 653
237 Ga0097620_100007252 3300006931 Bacteria 11245
238 Ga0097620_100256122 3300006931 Bacteria 1841
239 Ga0097620_100340988 3300006931 Unclassified 1593
240 Ga0097620_100388233 3300006931 Unclassified 1492
241 Ga0097620_100641198 3300006931 Bacteria 1154
242 Ga0097620_101014319 3300006931 Bacteria 912
243 Ga0097620_101171163 3300006931 Unclassified 846
244 Ga0097620_101412800 3300006931 Unclassified 768
245 Ga0097620_101892456 3300006931 Bacteria 659
246 Ga0097620_101919824 3300006931 Bacteria 654
247 Ga0097620_102659845 3300006931 Bacteria 550
248 Ga0075435_100000189 3300007076 Bacteria 36888
249 Ga0075435_100004108 3300007076 Bacteria 9977
250 Ga0075435_100021273 3300007076 Bacteria 4986
251 Ga0075435_100025175 3300007076 Bacteria 4629
252 Ga0075435_100069738 3300007076 Bacteria 2867
253 Ga0075435_100242264 3300007076 Bacteria 1534
254 Ga0075435_100260423 3300007076 Bacteria 1478
255 Ga0075435_100315623 3300007076 Bacteria 1337
256 Ga0075435_102060320 3300007076 Unclassified 501
257 Ga0105251_10337275 3300009011 Bacteria 687
258 Ga0105240_10007971 3300009093 Bacteria 15273
259 Ga0105240_10040742 3300009093 Bacteria 5937
260 Ga0105240_10162808 3300009093 Bacteria 2648
261 Ga0105240_10612425 3300009093 Bacteria 1198
262 Ga0105240_11429199 3300009093 Unclassified 727
263 Ga0111539_10000001 3300009094 Bacteria 1035431
264 Ga0111539_10001163 3300009094 Bacteria 34801
265 Ga0111539_10041743 3300009094 Bacteria 5513
266 Ga0111539_10877699 3300009094 Unclassified 1043
267 Ga0111539_11553529 3300009094 Bacteria 767
268 Ga0111539_12621075 3300009094 Unclassified 584
269 Ga0105245_10277601 3300009098 Bacteria 1637
270 Ga0105245_10295177 3300009098 Bacteria 1589
271 Ga0105245_10360859 3300009098 Bacteria 1442
272 Ga0105245_10597083 3300009098 Bacteria 1130
273 Ga0105245_10970075 3300009098 Bacteria 894
274 Ga0105245_11323948 3300009098 Bacteria 769
275 Ga0105245_11327211 3300009098 Bacteria 769
276 Ga0105245_12112189 3300009098 Unclassified 617
277 Ga0105247_10035108 3300009101 Archaea 3055
278 Ga0105247_10060281 3300009101 Bacteria 2351
279 Ga0114129_10000304 3300009147 Bacteria 57173
280 Ga0114129_10001441 3300009147 Bacteria 32078
281 Ga0114129_10008836 3300009147 Bacteria 14376
282 Ga0114129_10014923 3300009147 Bacteria 11068
283 Ga0114129_10021549 3300009147 Bacteria 9148
284 Ga0114129_10032236 3300009147 Bacteria 7406
285 Ga0114129_10054047 3300009147 Bacteria 5632
286 Ga0114129_10163513 3300009147 Bacteria 3039
287 Ga0114129_10200874 3300009147 Bacteria 2700
288 Ga0114129_10296085 3300009147 Bacteria 2158
289 Ga0114129_10594551 3300009147 Bacteria 1434
290 Ga0114129_10893496 3300009147 Bacteria 1126
291 Ga0114129_10952269 3300009147 Bacteria 1084
292 Ga0114129_12478354 3300009147 Unclassified 620
293 Ga0114129_12964982 3300009147 Unclassified 559
294 Ga0114129_13016541 3300009147 Bacteria 553
295 Ga0105243_10146032 3300009148 Bacteria 2023
296 Ga0105243_10296654 3300009148 Bacteria 1463
297 Ga0105243_10388504 3300009148 Unclassified 1293
298 Ga0105243_10465088 3300009148 Bacteria 1190
299 Ga0105241_10115966 3300009174 Bacteria 2150
300 Ga0105242_10007403 3300009176 Bacteria 8452
301 Ga0105242_10009179 3300009176 Bacteria 7591
302 Ga0105242_10089248 3300009176 Bacteria 2591
303 Ga0105242_10565662 3300009176 Bacteria 1092
304 Ga0105242_10585879 3300009176 Bacteria 1075
305 Ga0105242_10640830 3300009176 Bacteria 1032
306 Ga0105242_10893161 3300009176 Bacteria 888
307 Ga0105242_10905622 3300009176 Unclassified 882
308 Ga0105242_11398436 3300009176 Unclassified 727
309 Ga0105248_10040761 3300009177 Bacteria 5205
310 Ga0105248_10048968 3300009177 Bacteria 4740
311 Ga0105248_10069671 3300009177 Bacteria 3949
312 Ga0105248_10080366 3300009177 Bacteria 3664
313 Ga0105248_10099960 3300009177 Bacteria 3268
314 Ga0105248_10302070 3300009177 Bacteria 1802
315 Ga0105248_11244520 3300009177 Unclassified 842
316 Ga0105248_11357468 3300009177 Bacteria 804
317 Ga0105248_12134615 3300009177 Bacteria 637
318 Ga0105248_12260191 3300009177 Bacteria 619
319 Ga0105237_10199846 3300009545 Bacteria 1998
320 Ga0105238_10508750 3300009551 Bacteria 1206
321 Ga0105238_11551387 3300009551 Bacteria 692
322 Ga0105249_10058904 3300009553 Bacteria 3522
323 Ga0105249_10843395 3300009553 Bacteria 982
324 Ga0105249_10892409 3300009553 Bacteria 956
325 Ga0105249_12157448 3300009553 Unclassified 630
326 Ga0105239_10760707 3300010375 Bacteria 1109
327 Ga0105246_10322115 3300011119 Bacteria 1256
328 Ga0105246_10384715 3300011119 Bacteria 1160
329 Ga0105246_11232811 3300011119 Archaea 690
330 Ga0157328_1018368 3300012478 Unclassified 567
331 Ga0157370_11042514 3300013104 Bacteria 740
332 Ga0157374_10040325 3300013296 Bacteria 4299
333 Ga0157374_10257291 3300013296 Unclassified 1719
334 Ga0157374_10619609 3300013296 Bacteria 1093
335 Ga0157374_11185322 3300013296 Bacteria 785
336 Ga0157378_10090322 3300013297 Bacteria 2783
337 Ga0157378_10131912 3300013297 Bacteria 2314
338 Ga0157378_11735819 3300013297 Bacteria 672
339 Ga0157378_13024023 3300013297 Bacteria 522
340 Ga0163162_10049261 3300013306 Bacteria 4222
341 Ga0163162_10155039 3300013306 Bacteria 2410
342 Ga0163162_10999959 3300013306 Bacteria 945
343 Ga0163162_11154335 3300013306 Bacteria 878
344 Ga0163162_11573505 3300013306 Bacteria 749
345 Ga0163162_12545413 3300013306 Bacteria 589
346 Ga0163162_13473214 3300013306 Bacteria 502
347 Ga0157372_11208997 3300013307 Unclassified 873
348 Ga0157375_10032644 3300013308 Bacteria 4939
349 Ga0157375_10142643 3300013308 Unclassified 2523
350 Ga0157375_10756113 3300013308 Bacteria 1123
351 Ga0157375_10797951 3300013308 Bacteria 1093
352 Ga0157375_11076476 3300013308 Bacteria 940
353 Ga0157375_11447046 3300013308 Bacteria 810
354 Ga0163163_10178821 3300014325 Bacteria 2168
355 Ga0163163_10523579 3300014325 Bacteria 1248
356 Ga0157380_10143390 3300014326 Unclassified 2055
357 Ga0157380_10507128 3300014326 Bacteria 1173
358 Ga0157380_10686266 3300014326 Unclassified 1027
359 Ga0157380_10715163 3300014326 Bacteria 1008
360 Ga0157380_11308939 3300014326 Bacteria 772
361 Ga0157380_11343240 3300014326 Bacteria 763
362 Ga0157377_10034898 3300014745 Bacteria 2754
363 Ga0157377_10365622 3300014745 Bacteria 972
364 Ga0157377_10724071 3300014745 Bacteria 725
365 Ga0157379_10010988 3300014968 Bacteria 7895
366 Ga0157379_10025920 3300014968 Bacteria 5213
367 Ga0157379_10962878 3300014968 Bacteria 812
368 Ga0157379_11184895 3300014968 Unclassified 734
369 Ga0157379_11296613 3300014968 Bacteria 703
370 Ga0157379_11793903 3300014968 Unclassified 603
371 Ga0157376_10012899 3300014969 Bacteria 6218
372 Ga0157376_10086880 3300014969 Unclassified 2697
373 Ga0157376_10111594 3300014969 Bacteria 2408
374 Ga0157376_10424767 3300014969 Bacteria 1291
375 Ga0157376_10525221 3300014969 Bacteria 1167
376 Ga0157376_10600664 3300014969 Bacteria 1095
377 Ga0157376_10733139 3300014969 Unclassified 996
378 Ga0163161_10221081 3300017792 Bacteria 1466
379 Ga0163161_11436934 3300017792 Bacteria 603
380 Ga0207656_10204214 3300025321 Unclassified 955
381 Ga0207682_10173766 3300025893 Bacteria 981
382 Ga0207642_10177406 3300025899 Bacteria 1158
383 Ga0207642_10258513 3300025899 Bacteria 992
384 Ga0207642_10370264 3300025899 Bacteria 850
385 Ga0207642_10422692 3300025899 Unclassified 802
386 Ga0207642_10581084 3300025899 Bacteria 695
387 Ga0207710_10036542 3300025900 Bacteria 2166
388 Ga0207710_10178965 3300025900 Unclassified 1040
389 Ga0207688_10264745 3300025901 Bacteria 1044
390 Ga0207688_10839974 3300025901 Bacteria 582
391 Ga0207680_10101420 3300025903 Bacteria 1850
392 Ga0207680_10159962 3300025903 Bacteria 1509
393 Ga0207680_10183012 3300025903 Bacteria 1418
394 Ga0207680_10386207 3300025903 Bacteria 988
395 Ga0207685_10592085 3300025905 Bacteria 594
396 Ga0207699_10059499 3300025906 Bacteria 2290
397 Ga0207699_10504311 3300025906 Bacteria 874
398 Ga0207645_10067485 3300025907 Bacteria 2286
399 Ga0207645_10256823 3300025907 Bacteria 1157
400 Ga0207705_10088924 3300025909 Bacteria 2260
401 Ga0207684_10283973 3300025910 Bacteria 1427
402 Ga0207684_10369012 3300025910 Bacteria 1235
403 Ga0207684_10433462 3300025910 Bacteria 1129
404 Ga0207707_10080438 3300025912 Bacteria 2846
405 Ga0207707_10391360 3300025912 Bacteria 1194
406 Ga0207695_10062269 3300025913 Bacteria 3852
407 Ga0207695_10063368 3300025913 Bacteria 3812
408 Ga0207695_10570565 3300025913 Bacteria 1013
409 Ga0207671_10168089 3300025914 Bacteria 1701
410 Ga0207660_10142932 3300025917 Bacteria 1831
411 Ga0207660_11246153 3300025917 Unclassified 605
412 Ga0207662_10057610 3300025918 Bacteria 2322
413 Ga0207662_10158413 3300025918 Bacteria 1445
414 Ga0207657_10006081 3300025919 Bacteria 12554
415 Ga0207657_10601530 3300025919 Bacteria 858
416 Ga0207652_10048088 3300025921 Bacteria 3645
417 Ga0207652_10400588 3300025921 Bacteria 1238
418 Ga0207646_10333229 3300025922 Bacteria 1371
419 Ga0207646_10432425 3300025922 Unclassified 1188
420 Ga0207646_10511335 3300025922 Bacteria 1082
421 Ga0207646_10711523 3300025922 Bacteria 898
422 Ga0207646_11314866 3300025922 Bacteria 631
423 Ga0207681_10089928 3300025923 Unclassified 2190
424 Ga0207681_10345390 3300025923 Bacteria 1190
425 Ga0207681_10939831 3300025923 Bacteria 725
426 Ga0207681_11129313 3300025923 Unclassified 658
427 Ga0207681_11641385 3300025923 Unclassified 538
428 Ga0207694_10220033 3300025924 Bacteria 1548
429 Ga0207650_10297249 3300025925 Bacteria 1318
430 Ga0207650_10765489 3300025925 Bacteria 817
431 Ga0207659_10000637 3300025926 Bacteria 20834
432 Ga0207659_10165352 3300025926 Bacteria 1741
433 Ga0207659_10300931 3300025926 Bacteria 1317
434 Ga0207659_10396980 3300025926 Bacteria 1153
435 Ga0207687_10088125 3300025927 Bacteria 2257
436 Ga0207687_10745116 3300025927 Bacteria 833
437 Ga0207687_10812495 3300025927 Bacteria 798
438 Ga0207700_11530832 3300025928 Unclassified 591
439 Ga0207664_10182318 3300025929 Bacteria 1803
440 Ga0207644_10006773 3300025931 Bacteria 7466
441 Ga0207644_10467038 3300025931 Bacteria 1038
442 Ga0207706_10077394 3300025933 Bacteria 2925
443 Ga0207706_10170600 3300025933 Bacteria 1912
444 Ga0207706_10294293 3300025933 Bacteria 1415
445 Ga0207706_10477703 3300025933 Bacteria 1077
446 Ga0207706_10654566 3300025933 Bacteria 899
447 Ga0207706_10790302 3300025933 Bacteria 807
448 Ga0207686_10057789 3300025934 Bacteria 2443
449 Ga0207686_10087097 3300025934 Bacteria 2053
450 Ga0207686_10489239 3300025934 Bacteria 953
451 Ga0207686_10739682 3300025934 Bacteria 784
452 Ga0207709_10071590 3300025935 Archaea 2202
453 Ga0207709_10391646 3300025935 Bacteria 1060
454 Ga0207670_10576900 3300025936 Unclassified 921
455 Ga0207670_10750858 3300025936 Bacteria 810
456 Ga0207669_10099901 3300025937 Bacteria 1915
457 Ga0207669_10138763 3300025937 Bacteria 1684
458 Ga0207669_10237005 3300025937 Bacteria 1350
459 Ga0207669_10290965 3300025937 Bacteria 1237
460 Ga0207669_10565564 3300025937 Bacteria 919
461 Ga0207669_10924318 3300025937 Unclassified 730
462 Ga0207669_11052373 3300025937 Bacteria 685
463 Ga0207704_10075233 3300025938 Bacteria 2158
464 Ga0207704_10578764 3300025938 Bacteria 916
465 Ga0207704_10717944 3300025938 Unclassified 829
466 Ga0207704_11130190 3300025938 Bacteria 666
467 Ga0207691_10019546 3300025940 Bacteria 6408
468 Ga0207691_10025756 3300025940 Bacteria 5520
469 Ga0207691_10424004 3300025940 Bacteria 1133
470 Ga0207691_10460108 3300025940 Bacteria 1082
471 Ga0207691_10523565 3300025940 Bacteria 1006
472 Ga0207691_10773407 3300025940 Bacteria 808
473 Ga0207711_10026730 3300025941 Bacteria 4845
474 Ga0207711_10032038 3300025941 Bacteria 4442
475 Ga0207711_10045130 3300025941 Bacteria 3766
476 Ga0207711_10094262 3300025941 Bacteria 2638
477 Ga0207711_10128602 3300025941 Bacteria 2268
478 Ga0207711_10286243 3300025941 Bacteria 1518
479 Ga0207711_10684874 3300025941 Bacteria 956
480 Ga0207689_10230024 3300025942 Bacteria 1532
481 Ga0207689_10383580 3300025942 Bacteria 1170
482 Ga0207689_10552672 3300025942 Unclassified 967
483 Ga0207689_10653785 3300025942 Bacteria 886
484 Ga0207661_10972814 3300025944 Bacteria 782
485 Ga0207679_10071806 3300025945 Bacteria 2612
486 Ga0207679_10212907 3300025945 Bacteria 1622
487 Ga0207679_10976976 3300025945 Bacteria 776
488 Ga0207667_10336673 3300025949 Bacteria 1540
489 Ga0207651_10056250 3300025960 Bacteria 2706
490 Ga0207651_10260993 3300025960 Bacteria 1422
491 Ga0207651_10399417 3300025960 Bacteria 1169
492 Ga0207651_10785291 3300025960 Bacteria 843
493 Ga0207651_10921709 3300025960 Bacteria 779
494 Ga0207651_11486750 3300025960 Bacteria 610
495 Ga0207651_11536133 3300025960 Bacteria 600
496 Ga0207712_10415008 3300025961 Bacteria 1134
497 Ga0207712_10554786 3300025961 Bacteria 989
498 Ga0207712_10710531 3300025961 Bacteria 878
499 Ga0207712_12073488 3300025961 Unclassified 509
500 Ga0207668_10241805 3300025972 Bacteria 1461
501 Ga0207668_10657224 3300025972 Bacteria 918
502 Ga0207668_10695391 3300025972 Bacteria 893
503 Ga0207640_10032202 3300025981 Bacteria 3249
504 Ga0207640_10310768 3300025981 Bacteria 1251
505 Ga0207640_11470412 3300025981 Bacteria 612
506 Ga0207658_10047007 3300025986 Bacteria 3156
507 Ga0207658_10047326 3300025986 Bacteria 3147
508 Ga0207677_10026731 3300026023 Bacteria 3624
509 Ga0207677_10139859 3300026023 Bacteria 1852
510 Ga0207677_10309145 3300026023 Bacteria 1309
511 Ga0207677_10391125 3300026023 Bacteria 1176
512 Ga0207677_10672825 3300026023 Bacteria 916
513 Ga0207677_11517129 3300026023 Bacteria 619
514 Ga0207703_10080790 3300026035 Archaea 2708
515 Ga0207703_10213043 3300026035 Bacteria 1723
516 Ga0207703_10650301 3300026035 Unclassified 1000
517 Ga0207703_10733969 3300026035 Bacteria 940
518 Ga0207703_10805945 3300026035 Bacteria 897
519 Ga0207703_10993421 3300026035 Bacteria 805
520 Ga0207703_12215109 3300026035 Unclassified 525
521 Ga0207639_10313539 3300026041 Unclassified 1390
522 Ga0207708_10014526 3300026075 Bacteria 5893
523 Ga0207708_10912844 3300026075 Unclassified 760
524 Ga0207702_10604977 3300026078 Unclassified 1076
525 Ga0207641_10001439 3300026088 Bacteria 23394
526 Ga0207641_10860684 3300026088 Bacteria 899
527 Ga0207641_12058910 3300026088 Bacteria 572
528 Ga0207648_10044459 3300026089 Bacteria 3896
529 Ga0207648_10045180 3300026089 Bacteria 3864
530 Ga0207648_10267230 3300026089 Bacteria 1527
531 Ga0207648_10303051 3300026089 Bacteria 1433
532 Ga0207648_11849341 3300026089 Bacteria 565
533 Ga0207676_10064447 3300026095 Bacteria 2914
534 Ga0207676_10181317 3300026095 Bacteria 1844
535 Ga0207675_100048362 3300026118 Bacteria 3970
536 Ga0207675_100275600 3300026118 Bacteria 1633
537 Ga0207675_100387325 3300026118 Bacteria 1375
538 Ga0207675_100621867 3300026118 Bacteria 1084
539 Ga0207675_102098936 3300026118 Unclassified 582
540 Ga0207675_102204307 3300026118 Bacteria 566
541 Ga0207683_10106566 3300026121 Bacteria 2506
542 Ga0207683_10138777 3300026121 Bacteria 2189
543 Ga0207683_10500067 3300026121 Bacteria 1123
544 Ga0207683_10713573 3300026121 Bacteria 930
545 Ga0207683_11105561 3300026121 Bacteria 735
546 Ga0207683_11393168 3300026121 Bacteria 648
547 Ga0207698_10911727 3300026142 Bacteria 886
548 Ga0207698_11602920 3300026142 Unclassified 666
549 Ga0207428_10000002 3300027907 Bacteria 854851
550 Ga0207428_10037252 3300027907 Bacteria 3958
551 Ga0207428_10917606 3300027907 Bacteria 618
552 Ga0268266_10019305 3300028379 Bacteria 5806
553 Ga0268266_10118962 3300028379 Bacteria 2349
554 Ga0268266_10701308 3300028379 Bacteria 975
555 Ga0268265_10112247 3300028380 Unclassified 2228
556 Ga0268265_10168612 3300028380 Bacteria 1868
557 Ga0268265_10187836 3300028380 Bacteria 1782
558 Ga0268265_10460791 3300028380 Bacteria 1189
559 Ga0268265_10978488 3300028380 Bacteria 835
560 Ga0268265_11596331 3300028380 Unclassified 657
561 Ga0268264_10153392 3300028381 Bacteria 2068
562 Ga0268264_10339737 3300028381 Bacteria 1426
563 Ga0268264_10429873 3300028381 Bacteria 1275
564 Ga0268264_10697811 3300028381 Bacteria 1008
565 Ga0268264_10762872 3300028381 Bacteria 964
566 Ga0268264_11069935 3300028381 Bacteria 814
567 Ga0268264_11256535 3300028381 Bacteria 750
568 Ga0268264_11544979 3300028381 Bacteria 674
569 Ga0268264_11567202 3300028381 Unclassified 669
570 Ga0265330_10183302 3300031235 Bacteria 887
571 Ga0307408_101282512 3300031548 Bacteria 686
572 Ga0307408_101326310 3300031548 Bacteria 675
573 Ga0307408_101910592 3300031548 Unclassified 569
574 Ga0265314_10262607 3300031711 Bacteria 985
575 Ga0307406_11396297 3300031901 Bacteria 614
576 Ga0307407_11321949 3300031903 Bacteria 566
577 Ga0307412_10794267 3300031911 Bacteria 821
578 Ga0307412_11676121 3300031911 Bacteria 582
579 Ga0307409_100402933 3300031995 Bacteria 1307
580 Ga0307416_100438744 3300032002 Unclassified 1355
581 Ga0373930_0000245 3300034816 Bacteria 6897
582 Ga0373948_0028959 3300034817 Bacteria 1105
583 Ga0373950_0002004 3300034818 Bacteria 2752
584 Ga0373959_0000405 3300034820 Bacteria 8377
585 Ga0373938_0005187 3300034957 Bacteria 2207
586 Ga0373928_0002313 3300035084 Bacteria 3703
587 Ga0373929_0014335 3300035085 Unclassified 1530
588 Ga0373929_0088576 3300035085 Unclassified 764
589 Ga0373934_0287715 3300035086 Bacteria 681
590 Ga0373940_0021100 3300035088 Bacteria 1661
591 Ga0373949_0003515 3300035090 Bacteria 3710
592 Ga0373951_0000437 3300035091 Bacteria 12172
593 Ga0373952_0019680 3300035092 Bacteria 1408
594 Ga0373923_0293796 3300035111 Unclassified 768
595 Ga0373932_0014002 3300035112 Unclassified 2008
596 Ga0373932_0142400 3300035112 Unclassified 816
597 Ga0373932_0438474 3300035112 Unclassified 511
598 Ga0373939_0001301 3300035114 Bacteria 6061
599 Ga0373941_0013444 3300035115 Bacteria 2164
600 Ga0373941_0015421 3300035115 Bacteria 2060
601 Ga0373941_0144295 3300035115 Unclassified 868
602 Ga0373945_0044414 3300035116 Bacteria 1616
603 Ga0373953_0126978 3300035117 Bacteria 1086
604 Ga0373956_0166493 3300035119 Unclassified 1040
605 Ga0373957_0339783 3300035120 Unclassified 640
606 Ga0373960_0004257 3300035121 Bacteria 3268
607 Ga0373943_0342927 3300035170 Unclassified 855
608 Ga0373943_0486564 3300035170 Bacteria 720
609 Ga0373946_0179247 3300035171 Bacteria 1005
610 Ga0373955_0044020 3300035172 Archaea 2403
611 Ga0373955_0096801 3300035172 Bacteria 1689
612 Ga0373955_0106148 3300035172 Unclassified 1619
613 Ga0373942_0018432 3300035207 Unclassified 1732
614 Ga0373942_0048593 3300035207 Unclassified 1182
615 Ga0373961_0005744 3300035241 Bacteria 2977
616 Ga0373962_0036497 3300035242 Unclassified 1368
617 Ga0373931_0076384 3300035691 Bacteria 1840
618 Ga0373935_0993189 3300035692 Bacteria 623
619 Ga0373935_1091961 3300035692 Bacteria 594
620 Ga0373933_0182731 3300035724 Bacteria 1338
621 Ga0373933_0437136 3300035724 Bacteria 855
622 Ga0373947_0088685 3300035725 Unclassified 1926
623 Ga0373937_0151733 3300036401 Unclassified 2171
624 Ga0373937_0472667 3300036401 Bacteria 1191
625 Ga0373937_0562246 3300036401 Bacteria 1083
626 Ga0373937_0629949 3300036401 Bacteria 1018
627 Ga0373937_0762680 3300036401 Bacteria 915
628 Ga0373937_0801211 3300036401 Unclassified 890
629 Ga0373925_1365082 3300037068 Bacteria 581
630 Ga0373925_1685848 3300037068 Unclassified 518
631 Ga0395898_1248308 3300037466 Bacteria 673
632 Ga0439435_0182494 3300042436 Unclassified 686
633 Ga0466963_0203622 3300044694 Bacteria 1384
634 Ga0466963_0580345 3300044694 Bacteria 792
635 Ga0451576_0042753 3300045051 Bacteria 4784
636 Ga0451576_0289395 3300045051 Bacteria 1713
637 Ga0451576_0562465 3300045051 Bacteria 1198
638 Ga0466967_0304786 3300045976 Bacteria 1533
639 Ga0466967_0312203 3300045976 Bacteria 1515
640 Ga0466967_1257198 3300045976 Unclassified 737
641 Ga0495592_0770343 3300046454 Unclassified 574
642 Ga0495603_0147776 3300046455 Bacteria 1366
643 Ga0495629_0255721 3300046459 Bacteria 1204
644 Ga0495629_0482684 3300046459 Bacteria 837
645 Ga0495651_0191693 3300046462 Bacteria 1438
646 Ga0495651_0330708 3300046462 Archaea 1013
647 Ga0495653_0146527 3300046463 Bacteria 1654
648 Ga0495653_0630818 3300046463 Bacteria 656
649 Ga0495580_0213366 3300046472 Unclassified 1328
650 Ga0495639_0128359 3300046475 Bacteria 1213
651 Ga0495594_0254331 3300046499 Bacteria 1001
652 Ga0495594_0784483 3300046499 Unclassified 537
653 Ga0495628_0071470 3300046516 Archaea 2705
654 Ga0495630_0251315 3300046517 Archaea 1351
655 Ga0495630_1398987 3300046517 Bacteria 526
656 Ga0495644_0355806 3300046523 Unclassified 577
657 Ga0495642_0260238 3300046528 Bacteria 759
658 Ga0495640_0213548 3300046533 Bacteria 1219
659 Ga0495586_0128973 3300046535 Archaea 1416
660 Ga0495587_0195115 3300046536 Bacteria 1146
661 Ga0495645_0056749 3300046543 Bacteria 2843
662 Ga0495633_0148457 3300046558 Unclassified 1083
663 Ga0495633_0280466 3300046558 Bacteria 758
664 Ga0495656_0248450 3300046615 Bacteria 898
665 Ga0495656_0688845 3300046615 Bacteria 550
666 Ga0495634_0335269 3300046642 Bacteria 908
667 Ga0495635_0438884 3300046663 Bacteria 864
668 Ga0495599_0140783 3300046678 Bacteria 1497
669 Ga0495599_0216914 3300046678 Unclassified 1172
670 Ga0495646_0499508 3300046680 Unclassified 625
671 Ga0495647_0044598 3300046681 Bacteria 1701
672 Ga0495647_0206657 3300046681 Unclassified 863
673 Ga0495647_0284674 3300046681 Bacteria 742
674 Ga0495658_0040389 3300046683 Unclassified 2594
675 Ga0495658_0096197 3300046683 Unclassified 1761
676 Ga0495658_0163528 3300046683 Bacteria 1374
677 Ga0495658_0275711 3300046683 Bacteria 1061
678 Ga0495658_0486185 3300046683 Bacteria 789
679 Ga0495669_0007102 3300046684 Bacteria 4691
680 Ga0495669_0074307 3300046684 Bacteria 1554
681 Ga0495669_0177199 3300046684 Unclassified 1015
682 Ga0495613_0394148 3300046689 Bacteria 945
683 Ga0495670_0315638 3300046691 Unclassified 839
684 Ga0495600_0078259 3300046809 Bacteria 2160
685 Ga0495581_0500155 3300047315 Unclassified 707
686 Ga0495604_0874802 3300047317 Unclassified 563
687 Ga0495674_0975457 3300047319 Bacteria 651
688 Ga0495672_0413162 3300047320 Bacteria 615
689 Ga0495680_0864358 3300047322 Bacteria 587
690 Ga0495684_0921757 3300047471 Unclassified 561
691 Ga0496101_0006384 3300048904 Bacteria 7587
692 Ga0496101_0655154 3300048904 Bacteria 830
693 Ga0496101_1102776 3300048904 Unclassified 623
694 Ga0496102_0071174 3300048905 Bacteria 3193
695 Ga0496102_0486300 3300048905 Bacteria 1156
696 Ga0496102_1857583 3300048905 Bacteria 519
697 Ga0496104_0111424 3300048907 Bacteria 2624
698 Ga0496104_0154789 3300048907 Bacteria 2200
699 Ga0496104_0193126 3300048907 Bacteria 1948
700 Ga0496104_0241441 3300048907 Bacteria 1719
701 Ga0496105_0114560 3300048908 Bacteria 2224
702 Ga0496105_0202098 3300048908 Bacteria 1622
703 Ga0496105_0562400 3300048908 Bacteria 889
704 Ga0496105_0748066 3300048908 Bacteria 747
705 Ga0496105_1346145 3300048908 Unclassified 519
706 Ga0496106_0320006 3300048909 Bacteria 1245
707 Ga0496106_0954131 3300048909 Unclassified 676
708 Ga0496106_0984749 3300048909 Unclassified 664
709 Ga0496107_0228327 3300048910 Bacteria 1385
710 Ga0496107_0495879 3300048910 Bacteria 906
711 Ga0496107_0576562 3300048910 Bacteria 832
712 Ga0496107_1280440 3300048910 Unclassified 525
713 Ga0496108_0023039 3300048911 Bacteria 5123
714 Ga0496108_0788156 3300048911 Bacteria 820
715 Ga0496108_1451490 3300048911 Bacteria 572
716 Ga0496108_1513853 3300048911 Unclassified 558
717 Ga0496109_0106622 3300048912 Bacteria 2603
718 Ga0496109_0412495 3300048912 Bacteria 1276
719 Ga0496109_1514171 3300048912 Bacteria 606
720 Ga0496110_0799479 3300048913 Bacteria 847
721 Ga0496110_1782646 3300048913 Bacteria 526
722 Ga0496112_0050925 3300048915 Bacteria 4061
723 Ga0496112_0118215 3300048915 Bacteria 2621
724 Ga0496112_0974937 3300048915 Bacteria 768
725 Ga0496112_1084914 3300048915 Bacteria 719
726 Ga0496112_1728411 3300048915 Unclassified 538
727 Ga0496112_1832169 3300048915 Unclassified 519
728 Ga0496113_0032383 3300048916 Bacteria 3800
729 Ga0496113_1497134 3300048916 Unclassified 521
730 Ga0496114_0000233 3300048917 Bacteria 40546
731 Ga0496114_0339497 3300048917 Bacteria 1328
732 Ga0496114_1707900 3300048917 Unclassified 518
733 Ga0496115_0039023 3300048918 Unclassified 3771
734 Ga0501033_1001729 3300049570 Unclassified 558
735 Ga0501036_0113960 3300049572 Unclassified 2285
736 Ga0501038_1261748 3300049574 Unclassified 535
737 Ga0501040_0109559 3300049576 Bacteria 1931
738 Ga0501041_0804657 3300049577 Unclassified 603
739 Ga0501048_0357454 3300049582 Unclassified 1042
740 Ga0501072_0765996 3300049588 Bacteria 757
741 Ga0501072_1081175 3300049588 Unclassified 624
742 Ga0501073_0325887 3300049589 Bacteria 1060
743 Ga0501074_0158801 3300049590 Unclassified 1615
744 Ga0501075_0048565 3300049591 Bacteria 3189
745 Ga0501076_1312294 3300049592 Unclassified 595
746 Ga0501076_1448133 3300049592 Bacteria 564
747 Ga0501077_0729247 3300049593 Bacteria 637
748 Ga0501081_0838868 3300049743 Unclassified 692
749 Ga0501083_1153495 3300049744 Bacteria 504
750 Ga0501045_0050177 3300049824 Bacteria 3044
751 nmdc:mga05p37_12782_c1 3300050507 Bacteria 10033
752 nmdc:mga05p37_159826_c1 3300050507 Bacteria 2752
753 nmdc:mga05p37_209765_c1 3300050507 Bacteria 2355
754 nmdc:mga05p37_4258_c1 3300050507 Bacteria 16719
755 nmdc:mga05p37_4313_c1 3300050507 Bacteria 16614
756 nmdc:mga05p37_65425_c1 3300050507 Unclassified 4473
757 nmdc:mga05p37_795253_c1 3300050507 Bacteria 1036
758 nmdc:mga05p37_884224_c1 3300050507 Bacteria 966
759 nmdc:mga09592_374685_c1 3300050508 Bacteria 1231
760 nmdc:mga09592_475115_c1 3300050508 Bacteria 1077
761 nmdc:mga09592_88186_c1 3300050508 Bacteria 2649
762 nmdc:mga06r32_294603_c1 3300050510 Bacteria 1609
763 nmdc:mga06r32_80473_c1 3300050510 Bacteria 3170
764 nmdc:mga08y16_1265735_c1 3300050511 Bacteria 706
765 nmdc:mga08y16_197841_c1 3300050511 Bacteria 2083
766 nmdc:mga08y16_201982_c1 3300050511 Bacteria 2060
767 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
768 nmdc:mga08y16_457449_c1 3300050511 Unclassified 1301
769 nmdc:mga08y16_791116_c1 3300050511 Bacteria 942
770 nmdc:mga0n895_1049307_c1 3300050512 Bacteria 794
771 nmdc:mga0n895_1060144_c1 3300050512 Bacteria 789
772 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
773 nmdc:mga0n895_14813_c1 3300050512 Bacteria 7095
774 nmdc:mga0n895_218051_c1 3300050512 Bacteria 1937
775 nmdc:mga0n895_240784_c1 3300050512 Bacteria 1836
776 nmdc:mga0n895_26137_c1 3300050512 Bacteria 5525
777 nmdc:mga0n895_426174_c1 3300050512 Bacteria 1341
778 nmdc:mga0n895_438852_c1 3300050512 Bacteria 1319
779 nmdc:mga0n895_48914_c1 3300050512 Bacteria 4141
780 nmdc:mga0n895_514927_c1 3300050512 Bacteria 1204
781 nmdc:mga0n895_77005_c1 3300050512 Bacteria 3317
782 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
783 nmdc:mga0rr50_130263_c1 3300050513 Unclassified 2013
784 nmdc:mga0rr50_18927_c1 3300050513 Bacteria 4638
785 nmdc:mga0rr50_32117_c1 3300050513 Bacteria 3737
786 nmdc:mga0rr50_46055_c1 3300050513 Unclassified 3210
787 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
788 nmdc:mga0rr50_809806_c1 3300050513 Unclassified 799
789 nmdc:mga08x19_20121_c1 3300050514 Bacteria 4108
790 nmdc:mga08x19_285618_c1 3300050514 Unclassified 1144
791 nmdc:mga08x19_351166_c1 3300050514 Bacteria 1030
792 nmdc:mga08x19_89438_c1 3300050514 Bacteria 2031
793 nmdc:mga08x19_967_c1 3300050514 Bacteria 17964
794 nmdc:mga0a205_1142858_c1 3300050515 Bacteria 626
795 nmdc:mga0a205_1277055_c1 3300050515 Bacteria 582
796 nmdc:mga0a205_131616_c1 3300050515 Bacteria 2402
797 nmdc:mga0a205_139466_c1 3300050515 Bacteria 2325
798 nmdc:mga0a205_196771_c1 3300050515 Unclassified 1907
799 nmdc:mga0a205_35834_c1 3300050515 Bacteria 4766
800 nmdc:mga0a205_528173_c1 3300050515 Unclassified 1036
801 nmdc:mga0a205_599235_c1 3300050515 Bacteria 955
802 nmdc:mga0a205_94698_c1 3300050515 Bacteria 2885
803 Ga0495601_0146171 3300053077 Bacteria 1543
804 Ga0495601_0240595 3300053077 Unclassified 1182
805 Ga0495595_0010931 3300053084 Bacteria 3788
806 Ga0495595_0115286 3300053084 Unclassified 1306
807 Ga0495595_0739682 3300053084 Unclassified 504
808 Ga0495619_0278926 3300053085 Bacteria 1158
809 Ga0495619_0300223 3300053085 Bacteria 1112
810 Ga0495619_0489034 3300053085 Bacteria 847
811 Ga0495619_0522967 3300053085 Unclassified 815
812 Ga0495619_0744230 3300053085 Bacteria 665
813 Ga0500658_0445202 3300053134 Bacteria 590
814 Ga0501082_0611277 3300060353 Unclassified 954
815 Ga0530510_0413395 3300061734 Unclassified 1018

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0312203 Ga0466967_0312203_951_1343 120
2 3300005334 Ga0068869_100722886 Ga0068869_1007228861 122
3 3300005440 Ga0070705_101144018 Ga0070705_1011440181 122
4 3300005444 Ga0070694_100062300 Ga0070694_1000623003 122
5 3300005458 Ga0070681_11423507 Ga0070681_114235072 122
6 3300005467 Ga0070706_100208008 Ga0070706_1002080083 122
7 3300005545 Ga0070695_100035574 Ga0070695_1000355743 122
8 3300005546 Ga0070696_100555178 Ga0070696_1005551782 122
9 3300005547 Ga0070693_100299339 Ga0070693_1002993392 122
10 3300005549 Ga0070704_100662055 Ga0070704_1006620551 122
11 3300005578 Ga0068854_100917123 Ga0068854_1009171232 122
12 3300005615 Ga0070702_100473531 Ga0070702_1004735313 122
13 3300005617 Ga0068859_100007252 Ga0068859_1000072526 122
14 3300005719 Ga0068861_100014808 Ga0068861_1000148083 122
15 3300005840 Ga0068870_10927106 Ga0068870_109271061 122
16 3300005844 Ga0068862_100372530 Ga0068862_1003725301 122
17 3300006028 Ga0070717_10367399 Ga0070717_103673992 122
18 3300006237 Ga0097621_100006112 Ga0097621_1000061123 122
19 3300006237 Ga0097621_100012698 Ga0097621_1000126988 122
20 3300006358 Ga0068871_100007740 Ga0068871_1000077405 122
21 3300006914 Ga0075436_100386884 Ga0075436_1003868842 122
22 3300006914 Ga0075436_100923072 Ga0075436_1009230722 122
23 3300006931 Ga0097620_100007252 Ga0097620_1000072529 122
24 3300007076 Ga0075435_100242264 Ga0075435_1002422642 122
25 3300009093 Ga0105240_10612425 Ga0105240_106124251 122
26 3300009147 Ga0114129_10200874 Ga0114129_102008743 122
27 3300009148 Ga0105243_10388504 Ga0105243_103885043 122
28 3300013296 Ga0157374_10257291 Ga0157374_102572911 122
29 3300013297 Ga0157378_13024023 Ga0157378_130240231 122
30 3300014969 Ga0157376_10600664 Ga0157376_106006643 122
31 3300014969 Ga0157376_10733139 Ga0157376_107331392 122
32 3300050507 nmdc:mga05p37_159826_c1 nmdc:mga05p37_159826_c1_655_1032 122
33 3300005330 Ga0070690_100701936 Ga0070690_1007019362 123
34 3300005334 Ga0068869_100082933 Ga0068869_1000829332 123
35 3300005335 Ga0070666_10869830 Ga0070666_108698301 123
36 3300005338 Ga0068868_100119930 Ga0068868_1001199302 123
37 3300005356 Ga0070674_100072587 Ga0070674_1000725873 123
38 3300005356 Ga0070674_100121193 Ga0070674_1001211933 123
39 3300005356 Ga0070674_100575658 Ga0070674_1005756581 123
40 3300005364 Ga0070673_100167660 Ga0070673_1001676602 123
41 3300005458 Ga0070681_11774500 Ga0070681_117745001 123
42 3300005459 Ga0068867_100758830 Ga0068867_1007588302 123
43 3300005467 Ga0070706_101588395 Ga0070706_1015883951 123
44 3300005471 Ga0070698_101720080 Ga0070698_1017200801 123
45 3300005535 Ga0070684_101378596 Ga0070684_1013785961 123
46 3300005543 Ga0070672_100385756 Ga0070672_1003857562 123
47 3300005543 Ga0070672_100916554 Ga0070672_1009165542 123
48 3300005548 Ga0070665_100044139 Ga0070665_1000441392 123
49 3300005718 Ga0068866_10094100 Ga0068866_100941001 123
50 3300005843 Ga0068860_100807238 Ga0068860_1008072382 123
51 3300006028 Ga0070717_10482438 Ga0070717_104824382 123
52 3300006237 Ga0097621_100009489 Ga0097621_1000094895 123
53 3300006237 Ga0097621_100023804 Ga0097621_1000238045 123
54 3300006358 Ga0068871_100003046 Ga0068871_1000030464 123
55 3300006358 Ga0068871_100012348 Ga0068871_1000123482 123
56 3300006881 Ga0068865_100399449 Ga0068865_1003994492 123
57 3300009098 Ga0105245_10597083 Ga0105245_105970833 123
58 3300009148 Ga0105243_10465088 Ga0105243_104650883 123
59 3300009176 Ga0105242_10565662 Ga0105242_105656622 123
60 3300009176 Ga0105242_10640830 Ga0105242_106408302 123
61 3300009176 Ga0105242_11398436 Ga0105242_113984362 123
62 3300009177 Ga0105248_11244520 Ga0105248_112445202 123
63 3300009177 Ga0105248_12134615 Ga0105248_121346151 123
64 3300009551 Ga0105238_10508750 Ga0105238_105087501 123
65 3300013306 Ga0163162_10049261 Ga0163162_100492615 123
66 3300013306 Ga0163162_10999959 Ga0163162_109999592 123
67 3300013306 Ga0163162_11154335 Ga0163162_111543352 123
68 3300014968 Ga0157379_11793903 Ga0157379_117939031 123
69 3300014969 Ga0157376_10086880 Ga0157376_100868803 123
70 3300025899 Ga0207642_10581084 Ga0207642_105810841 123
71 3300025903 Ga0207680_10183012 Ga0207680_101830122 123
72 3300025907 Ga0207645_10067485 Ga0207645_100674852 123
73 3300025928 Ga0207700_11530832 Ga0207700_115308322 123
74 3300025937 Ga0207669_10099901 Ga0207669_100999013 123
75 3300025937 Ga0207669_10237005 Ga0207669_102370053 123
76 3300025938 Ga0207704_10578764 Ga0207704_105787642 123
77 3300025940 Ga0207691_10460108 Ga0207691_104601083 123
78 3300025941 Ga0207711_10684874 Ga0207711_106848742 123
79 3300025942 Ga0207689_10552672 Ga0207689_105526722 123
80 3300025960 Ga0207651_11486750 Ga0207651_114867501 123
81 3300026035 Ga0207703_10993421 Ga0207703_109934213 123
82 3300026121 Ga0207683_11393168 Ga0207683_113931683 123
83 3300028379 Ga0268266_10118962 Ga0268266_101189622 123
84 3300028381 Ga0268264_10762872 Ga0268264_107628722 123
85 3300035111 Ga0373923_0293796 Ga0373923_0293796_305_682 123
86 3300035119 Ga0373956_0166493 Ga0373956_0166493_270_647 123
87 3300035120 Ga0373957_0339783 Ga0373957_0339783_11_388 123
88 3300035172 Ga0373955_0106148 Ga0373955_0106148_602_979 123
89 3300035692 Ga0373935_1091961 Ga0373935_1091961_134_511 123
90 3300036401 Ga0373937_0629949 Ga0373937_0629949_574_951 123
91 3300037068 Ga0373925_1685848 Ga0373925_1685848_106_483 123
92 3300046459 Ga0495629_0255721 Ga0495629_0255721_528_905 123
93 3300046472 Ga0495580_0213366 Ga0495580_0213366_580_957 123
94 3300046681 Ga0495647_0206657 Ga0495647_0206657_292_669 123
95 3300046683 Ga0495658_0096197 Ga0495658_0096197_907_1284 123
96 3300046683 Ga0495658_0486185 Ga0495658_0486185_340_717 123
97 3300046684 Ga0495669_0007102 Ga0495669_0007102_4270_4647 123
98 3300047322 Ga0495680_0864358 Ga0495680_0864358_33_410 123
99 3300048904 Ga0496101_0006384 Ga0496101_0006384_1776_2153 123
100 3300048904 Ga0496101_1102776 Ga0496101_1102776_64_441 123
101 3300048905 Ga0496102_0071174 Ga0496102_0071174_324_701 123
102 3300048907 Ga0496104_0154789 Ga0496104_0154789_1658_2035 123
103 3300048907 Ga0496104_0241441 Ga0496104_0241441_59_436 123
104 3300048908 Ga0496105_0114560 Ga0496105_0114560_654_1031 123
105 3300048908 Ga0496105_0202098 Ga0496105_0202098_565_942 123
106 3300048908 Ga0496105_0748066 Ga0496105_0748066_28_405 123
107 3300048908 Ga0496105_1346145 Ga0496105_1346145_41_418 123
108 3300048910 Ga0496107_0576562 Ga0496107_0576562_18_395 123
109 3300048911 Ga0496108_0788156 Ga0496108_0788156_92_469 123
110 3300048912 Ga0496109_1514171 Ga0496109_1514171_91_468 123
111 3300048917 Ga0496114_0000233 Ga0496114_0000233_18156_18533 123
112 3300049744 Ga0501083_1153495 Ga0501083_1153495_32_409 123
113 3300053084 Ga0495595_0115286 Ga0495595_0115286_529_906 123
114 3300053084 Ga0495595_0739682 Ga0495595_0739682_82_459 123
115 3300053085 Ga0495619_0278926 Ga0495619_0278926_477_854 123
116 3300005340 Ga0070689_100967094 Ga0070689_1009670941 124
117 3300005344 Ga0070661_100211698 Ga0070661_1002116982 124
118 3300005353 Ga0070669_100093200 Ga0070669_1000932003 124
119 3300005354 Ga0070675_100394357 Ga0070675_1003943573 124
120 3300005355 Ga0070671_100361176 Ga0070671_1003611762 124
121 3300005456 Ga0070678_101175206 Ga0070678_1011752062 124
122 3300005456 Ga0070678_101779224 Ga0070678_1017792242 124
123 3300005466 Ga0070685_10109186 Ga0070685_101091863 124
124 3300005543 Ga0070672_100111115 Ga0070672_1001111153 124
125 3300005841 Ga0068863_101486205 Ga0068863_1014862051 124
126 3300006163 Ga0070715_10248955 Ga0070715_102489552 124
127 3300006847 Ga0075431_100092801 Ga0075431_1000928012 124
128 3300006881 Ga0068865_100153959 Ga0068865_1001539592 124
129 3300009094 Ga0111539_10000001 Ga0111539_10000001413 124
130 3300009147 Ga0114129_13016541 Ga0114129_130165412 124
131 3300013308 Ga0157375_11076476 Ga0157375_110764763 124
132 3300014745 Ga0157377_10724071 Ga0157377_107240712 124
133 3300014968 Ga0157379_10962878 Ga0157379_109628781 124
134 3300025901 Ga0207688_10839974 Ga0207688_108399742 124
135 3300025923 Ga0207681_10345390 Ga0207681_103453902 124
136 3300025925 Ga0207650_10297249 Ga0207650_102972491 124
137 3300025926 Ga0207659_10165352 Ga0207659_101653523 124
138 3300025933 Ga0207706_10294293 Ga0207706_102942931 124
139 3300025937 Ga0207669_10924318 Ga0207669_109243182 124
140 3300025938 Ga0207704_11130190 Ga0207704_111301901 124
141 3300025940 Ga0207691_10025756 Ga0207691_100257565 124
142 3300025945 Ga0207679_10212907 Ga0207679_102129072 124
143 3300027907 Ga0207428_10000002 Ga0207428_10000002424 124
144 3300042436 Ga0439435_0182494 Ga0439435_0182494_165_545 124
145 3300049570 Ga0501033_1001729 Ga0501033_1001729_58_438 124
146 3300049574 Ga0501038_1261748 Ga0501038_1261748_38_418 124
147 3300049576 Ga0501040_0109559 Ga0501040_0109559_1423_1803 124
148 3300049582 Ga0501048_0357454 Ga0501048_0357454_260_640 124
149 3300049588 Ga0501072_0765996 Ga0501072_0765996_260_640 124
150 3300049588 Ga0501072_1081175 Ga0501072_1081175_190_570 124
151 3300049590 Ga0501074_0158801 Ga0501074_0158801_946_1326 124
152 3300049591 Ga0501075_0048565 Ga0501075_0048565_2207_2587 124
153 3300049592 Ga0501076_1312294 Ga0501076_1312294_36_416 124
154 3300049592 Ga0501076_1448133 Ga0501076_1448133_110_490 124
155 3300049593 Ga0501077_0729247 Ga0501077_0729247_245_625 124
156 3300049743 Ga0501081_0838868 Ga0501081_0838868_249_629 124
157 3300049824 Ga0501045_0050177 Ga0501045_0050177_1001_1381 124
158 3300050510 nmdc:mga06r32_80473_c1 nmdc:mga06r32_80473_c1_2078_2458 124
159 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_442599_442979 124
160 3300060353 Ga0501082_0611277 Ga0501082_0611277_469_849 124
161 3300061734 Ga0530510_0413395 Ga0530510_0413395_467_847 124
162 3300005457 Ga0070662_100344256 Ga0070662_1003442562 125
163 3300005842 Ga0068858_100116716 Ga0068858_1001167162 125
164 3300005843 Ga0068860_100076396 Ga0068860_1000763963 125
165 3300005843 Ga0068860_100402509 Ga0068860_1004025091 125
166 3300006931 Ga0097620_101171163 Ga0097620_1011711632 125
167 3300009101 Ga0105247_10035108 Ga0105247_100351082 125
168 3300014326 Ga0157380_10143390 Ga0157380_101433905 125
169 3300014326 Ga0157380_10686266 Ga0157380_106862661 125
170 3300014968 Ga0157379_10025920 Ga0157379_100259205 125
171 3300025899 Ga0207642_10422692 Ga0207642_104226922 125
172 3300025900 Ga0207710_10178965 Ga0207710_101789652 125
173 3300025921 Ga0207652_10400588 Ga0207652_104005882 125
174 3300025923 Ga0207681_11129313 Ga0207681_111293131 125
175 3300025935 Ga0207709_10071590 Ga0207709_100715903 125
176 3300025936 Ga0207670_10576900 Ga0207670_105769002 125
177 3300026035 Ga0207703_10080790 Ga0207703_100807902 125
178 3300026089 Ga0207648_10267230 Ga0207648_102672302 125
179 3300026121 Ga0207683_10500067 Ga0207683_105000672 125
180 3300028381 Ga0268264_11567202 Ga0268264_115672022 125
181 3300031235 Ga0265330_10183302 Ga0265330_101833022 125
182 3300031711 Ga0265314_10262607 Ga0265314_102626072 125
183 3300045051 Ga0451576_0562465 Ga0451576_0562465_98_475 125
184 3300048911 Ga0496108_1513853 Ga0496108_1513853_121_498 125
185 3300049589 Ga0501073_0325887 Ga0501073_0325887_140_523 125
186 3300050511 nmdc:mga08y16_791116_c1 nmdc:mga08y16_791116_c1_194_571 125
187 3300005344 Ga0070661_100564304 Ga0070661_1005643042 126
188 3300005444 Ga0070694_100096741 Ga0070694_1000967414 126
189 3300005445 Ga0070708_100771718 Ga0070708_1007717182 126
190 3300005467 Ga0070706_101865449 Ga0070706_1018654491 126
191 3300005468 Ga0070707_100036870 Ga0070707_1000368706 126
192 3300005468 Ga0070707_100421753 Ga0070707_1004217532 126
193 3300005536 Ga0070697_100384029 Ga0070697_1003840291 126
194 3300005545 Ga0070695_100242718 Ga0070695_1002427182 126
195 3300005549 Ga0070704_100130483 Ga0070704_1001304833 126
196 3300005549 Ga0070704_100206782 Ga0070704_1002067821 126
197 3300005614 Ga0068856_100679517 Ga0068856_1006795172 126
198 3300005719 Ga0068861_100752572 Ga0068861_1007525722 126
199 3300005843 Ga0068860_100581434 Ga0068860_1005814342 126
200 3300005844 Ga0068862_100130187 Ga0068862_1001301873 126
201 3300006058 Ga0075432_10143502 Ga0075432_101435022 126
202 3300006058 Ga0075432_10265698 Ga0075432_102656981 126
203 3300006847 Ga0075431_100369325 Ga0075431_1003693252 126
204 3300006852 Ga0075433_10024699 Ga0075433_100246993 126
205 3300006852 Ga0075433_10108884 Ga0075433_101088843 126
206 3300006852 Ga0075433_10490583 Ga0075433_104905832 126
207 3300006871 Ga0075434_100102251 Ga0075434_1001022512 126
208 3300006871 Ga0075434_100500448 Ga0075434_1005004481 126
209 3300006880 Ga0075429_100551931 Ga0075429_1005519313 126
210 3300006914 Ga0075436_100035222 Ga0075436_1000352223 126
211 3300007076 Ga0075435_100025175 Ga0075435_1000251755 126
212 3300007076 Ga0075435_100315623 Ga0075435_1003156233 126
213 3300009093 Ga0105240_10040742 Ga0105240_100407426 126
214 3300009093 Ga0105240_11429199 Ga0105240_114291992 126
215 3300009147 Ga0114129_10014923 Ga0114129_100149238 126
216 3300009147 Ga0114129_10032236 Ga0114129_100322363 126
217 3300009147 Ga0114129_10163513 Ga0114129_101635134 126
218 3300009147 Ga0114129_10952269 Ga0114129_109522692 126
219 3300013104 Ga0157370_11042514 Ga0157370_110425141 126
220 3300013307 Ga0157372_11208997 Ga0157372_112089972 126
221 3300025912 Ga0207707_10080438 Ga0207707_100804382 126
222 3300025922 Ga0207646_10432425 Ga0207646_104324251 126
223 3300025941 Ga0207711_10286243 Ga0207711_102862432 126
224 3300025945 Ga0207679_10976976 Ga0207679_109769761 126
225 3300026078 Ga0207702_10604977 Ga0207702_106049772 126
226 3300027907 Ga0207428_10917606 Ga0207428_109176062 126
227 3300028380 Ga0268265_10187836 Ga0268265_101878362 126
228 3300028381 Ga0268264_10339737 Ga0268264_103397372 126
229 3300031548 Ga0307408_101910592 Ga0307408_1019105921 126
230 3300031911 Ga0307412_10794267 Ga0307412_107942672 126
231 3300031911 Ga0307412_11676121 Ga0307412_116761212 126
232 3300031995 Ga0307409_100402933 Ga0307409_1004029332 126
233 3300032002 Ga0307416_100438744 Ga0307416_1004387442 126
234 3300044694 Ga0466963_0580345 Ga0466963_0580345_35_421 126
235 3300045051 Ga0451576_0289395 Ga0451576_0289395_397_777 126
236 3300045976 Ga0466967_0304786 Ga0466967_0304786_459_839 126
237 3300045976 Ga0466967_1257198 Ga0466967_1257198_49_435 126
238 3300049572 Ga0501036_0113960 Ga0501036_0113960_1803_2183 126
239 3300049577 Ga0501041_0804657 Ga0501041_0804657_12_392 126
240 3300050507 nmdc:mga05p37_4313_c1 nmdc:mga05p37_4313_c1_2868_3248 126
241 3300050507 nmdc:mga05p37_884224_c1 nmdc:mga05p37_884224_c1_295_675 126
242 3300050508 nmdc:mga09592_88186_c1 nmdc:mga09592_88186_c1_1842_2225 126
243 3300050510 nmdc:mga06r32_294603_c1 nmdc:mga06r32_294603_c1_134_517 126
244 3300050512 nmdc:mga0n895_1060144_c1 nmdc:mga0n895_1060144_c1_101_484 126
245 3300050512 nmdc:mga0n895_14813_c1 nmdc:mga0n895_14813_c1_1436_1867 126
246 3300050512 nmdc:mga0n895_26137_c1 nmdc:mga0n895_26137_c1_1415_1795 126
247 3300050513 nmdc:mga0rr50_32117_c1 nmdc:mga0rr50_32117_c1_2803_3183 126
248 3300050513 nmdc:mga0rr50_46055_c1 nmdc:mga0rr50_46055_c1_1680_2111 126
249 3300050514 nmdc:mga08x19_89438_c1 nmdc:mga08x19_89438_c1_1212_1592 126
250 3300050515 nmdc:mga0a205_131616_c1 nmdc:mga0a205_131616_c1_397_780 126
251 3300050515 nmdc:mga0a205_139466_c1 nmdc:mga0a205_139466_c1_148_528 126
252 3300050515 nmdc:mga0a205_196771_c1 nmdc:mga0a205_196771_c1_1109_1540 126
253 3300050515 nmdc:mga0a205_94698_c1 nmdc:mga0a205_94698_c1_123_503 126
254 3300005327 Ga0070658_10012592 Ga0070658_100125922 127
255 3300005329 Ga0070683_102245138 Ga0070683_1022451381 127
256 3300005331 Ga0070670_100463438 Ga0070670_1004634382 127
257 3300005333 Ga0070677_10136872 Ga0070677_101368722 127
258 3300005333 Ga0070677_10314871 Ga0070677_103148711 127
259 3300005334 Ga0068869_100447990 Ga0068869_1004479901 127
260 3300005334 Ga0068869_100460686 Ga0068869_1004606862 127
261 3300005338 Ga0068868_100037394 Ga0068868_1000373943 127
262 3300005338 Ga0068868_100170374 Ga0068868_1001703742 127
263 3300005338 Ga0068868_100419711 Ga0068868_1004197112 127
264 3300005339 Ga0070660_100064261 Ga0070660_1000642614 127
265 3300005340 Ga0070689_100094020 Ga0070689_1000940202 127
266 3300005343 Ga0070687_100224423 Ga0070687_1002244232 127
267 3300005343 Ga0070687_100506445 Ga0070687_1005064452 127
268 3300005347 Ga0070668_100350158 Ga0070668_1003501581 127
269 3300005353 Ga0070669_100047404 Ga0070669_1000474043 127
270 3300005354 Ga0070675_100357175 Ga0070675_1003571752 127
271 3300005354 Ga0070675_100769245 Ga0070675_1007692452 127
272 3300005355 Ga0070671_100044941 Ga0070671_1000449414 127
273 3300005355 Ga0070671_100365478 Ga0070671_1003654781 127
274 3300005356 Ga0070674_100139155 Ga0070674_1001391551 127
275 3300005364 Ga0070673_100063214 Ga0070673_1000632143 127
276 3300005364 Ga0070673_100098118 Ga0070673_1000981183 127
277 3300005364 Ga0070673_100305577 Ga0070673_1003055772 127
278 3300005364 Ga0070673_101028703 Ga0070673_1010287032 127
279 3300005365 Ga0070688_100134780 Ga0070688_1001347801 127
280 3300005365 Ga0070688_100313434 Ga0070688_1003134342 127
281 3300005367 Ga0070667_100009819 Ga0070667_1000098194 127
282 3300005367 Ga0070667_100318647 Ga0070667_1003186472 127
283 3300005434 Ga0070709_10245755 Ga0070709_102457552 127
284 3300005435 Ga0070714_100044820 Ga0070714_1000448204 127
285 3300005440 Ga0070705_100483740 Ga0070705_1004837402 127
286 3300005444 Ga0070694_100705236 Ga0070694_1007052361 127
287 3300005445 Ga0070708_100164533 Ga0070708_1001645332 127
288 3300005445 Ga0070708_101925576 Ga0070708_1019255762 127
289 3300005456 Ga0070678_100612660 Ga0070678_1006126602 127
290 3300005456 Ga0070678_101499574 Ga0070678_1014995742 127
291 3300005457 Ga0070662_101194822 Ga0070662_1011948222 127
292 3300005458 Ga0070681_10474497 Ga0070681_104744972 127
293 3300005459 Ga0068867_100382326 Ga0068867_1003823262 127
294 3300005459 Ga0068867_101181283 Ga0068867_1011812831 127
295 3300005467 Ga0070706_100475305 Ga0070706_1004753051 127
296 3300005468 Ga0070707_100263363 Ga0070707_1002633632 127
297 3300005468 Ga0070707_100723988 Ga0070707_1007239881 127
298 3300005471 Ga0070698_100014460 Ga0070698_1000144607 127
299 3300005471 Ga0070698_101082948 Ga0070698_1010829482 127
300 3300005518 Ga0070699_100004418 Ga0070699_1000044183 127
301 3300005518 Ga0070699_100559274 Ga0070699_1005592741 127
302 3300005518 Ga0070699_101457645 Ga0070699_1014576451 127
303 3300005536 Ga0070697_100137743 Ga0070697_1001377433 127
304 3300005536 Ga0070697_100415161 Ga0070697_1004151612 127
305 3300005536 Ga0070697_100464079 Ga0070697_1004640792 127
306 3300005543 Ga0070672_100018842 Ga0070672_1000188422 127
307 3300005544 Ga0070686_101120361 Ga0070686_1011203612 127
308 3300005546 Ga0070696_100368348 Ga0070696_1003683482 127
309 3300005548 Ga0070665_100007922 Ga0070665_1000079224 127
310 3300005548 Ga0070665_100020938 Ga0070665_1000209383 127
311 3300005548 Ga0070665_100473760 Ga0070665_1004737602 127
312 3300005549 Ga0070704_100031805 Ga0070704_1000318053 127
313 3300005549 Ga0070704_100988370 Ga0070704_1009883702 127
314 3300005563 Ga0068855_100141000 Ga0068855_1001410004 127
315 3300005564 Ga0070664_100403298 Ga0070664_1004032982 127
316 3300005616 Ga0068852_101250882 Ga0068852_1012508822 127
317 3300005616 Ga0068852_102033183 Ga0068852_1020331831 127
318 3300005617 Ga0068859_100256114 Ga0068859_1002561142 127
319 3300005617 Ga0068859_100388259 Ga0068859_1003882592 127
320 3300005617 Ga0068859_100641225 Ga0068859_1006412251 127
321 3300005617 Ga0068859_101014369 Ga0068859_1010143692 127
322 3300005617 Ga0068859_101412808 Ga0068859_1014128082 127
323 3300005617 Ga0068859_101920156 Ga0068859_1019201561 127
324 3300005617 Ga0068859_102661461 Ga0068859_1026614611 127
325 3300005618 Ga0068864_100008563 Ga0068864_1000085639 127
326 3300005618 Ga0068864_100220254 Ga0068864_1002202542 127
327 3300005618 Ga0068864_102226010 Ga0068864_1022260101 127
328 3300005718 Ga0068866_10232523 Ga0068866_102325233 127
329 3300005718 Ga0068866_10322634 Ga0068866_103226342 127
330 3300005718 Ga0068866_10344498 Ga0068866_103444982 127
331 3300005718 Ga0068866_11003586 Ga0068866_110035862 127
332 3300005719 Ga0068861_100375462 Ga0068861_1003754621 127
333 3300005719 Ga0068861_100656303 Ga0068861_1006563031 127
334 3300005841 Ga0068863_100011271 Ga0068863_10001127115 127
335 3300005841 Ga0068863_100767668 Ga0068863_1007676682 127
336 3300005842 Ga0068858_100127832 Ga0068858_1001278323 127
337 3300005842 Ga0068858_100466665 Ga0068858_1004666652 127
338 3300005842 Ga0068858_100797066 Ga0068858_1007970662 127
339 3300005842 Ga0068858_102085652 Ga0068858_1020856522 127
340 3300005843 Ga0068860_100049142 Ga0068860_1000491424 127
341 3300005843 Ga0068860_100154553 Ga0068860_1001545533 127
342 3300005843 Ga0068860_101234856 Ga0068860_1012348562 127
343 3300005937 Ga0081455_10095237 Ga0081455_100952371 127
344 3300005985 Ga0081539_10012200 Ga0081539_100122002 127
345 3300006028 Ga0070717_10972207 Ga0070717_109722072 127
346 3300006173 Ga0070716_100911557 Ga0070716_1009115572 127
347 3300006237 Ga0097621_100027466 Ga0097621_1000274664 127
348 3300006358 Ga0068871_100002793 Ga0068871_10000279311 127
349 3300006358 Ga0068871_100438342 Ga0068871_1004383422 127
350 3300006358 Ga0068871_100506652 Ga0068871_1005066522 127
351 3300006844 Ga0075428_100117748 Ga0075428_1001177483 127
352 3300006844 Ga0075428_100148388 Ga0075428_1001483882 127
353 3300006844 Ga0075428_100455326 Ga0075428_1004553262 127
354 3300006852 Ga0075433_10098176 Ga0075433_100981762 127
355 3300006852 Ga0075433_10148238 Ga0075433_101482382 127
356 3300006880 Ga0075429_100433410 Ga0075429_1004334102 127
357 3300006880 Ga0075429_100575771 Ga0075429_1005757712 127
358 3300006881 Ga0068865_100005193 Ga0068865_1000051935 127
359 3300006914 Ga0075436_100082118 Ga0075436_1000821181 127
360 3300006931 Ga0097620_100256122 Ga0097620_1002561222 127
361 3300006931 Ga0097620_100388233 Ga0097620_1003882331 127
362 3300006931 Ga0097620_100641198 Ga0097620_1006411982 127
363 3300006931 Ga0097620_101014319 Ga0097620_1010143192 127
364 3300006931 Ga0097620_101412800 Ga0097620_1014128002 127
365 3300006931 Ga0097620_101919824 Ga0097620_1019198242 127
366 3300006931 Ga0097620_102659845 Ga0097620_1026598451 127
367 3300007076 Ga0075435_100021273 Ga0075435_1000212735 127
368 3300007076 Ga0075435_100260423 Ga0075435_1002604233 127
369 3300007076 Ga0075435_102060320 Ga0075435_1020603201 127
370 3300009011 Ga0105251_10337275 Ga0105251_103372752 127
371 3300009093 Ga0105240_10007971 Ga0105240_1000797113 127
372 3300009093 Ga0105240_10162808 Ga0105240_101628083 127
373 3300009094 Ga0111539_10001163 Ga0111539_1000116330 127
374 3300009094 Ga0111539_10041743 Ga0111539_100417436 127
375 3300009094 Ga0111539_10877699 Ga0111539_108776993 127
376 3300009094 Ga0111539_11553529 Ga0111539_115535292 127
377 3300009094 Ga0111539_12621075 Ga0111539_126210751 127
378 3300009098 Ga0105245_10277601 Ga0105245_102776013 127
379 3300009098 Ga0105245_10295177 Ga0105245_102951772 127
380 3300009098 Ga0105245_10360859 Ga0105245_103608592 127
381 3300009098 Ga0105245_11323948 Ga0105245_113239482 127
382 3300009098 Ga0105245_12112189 Ga0105245_121121891 127
383 3300009101 Ga0105247_10060281 Ga0105247_100602814 127
384 3300009147 Ga0114129_10001441 Ga0114129_1000144115 127
385 3300009147 Ga0114129_10008836 Ga0114129_1000883614 127
386 3300009147 Ga0114129_10054047 Ga0114129_100540474 127
387 3300009147 Ga0114129_10296085 Ga0114129_102960854 127
388 3300009147 Ga0114129_10594551 Ga0114129_105945512 127
389 3300009147 Ga0114129_10893496 Ga0114129_108934962 127
390 3300009147 Ga0114129_12478354 Ga0114129_124783541 127
391 3300009147 Ga0114129_12964982 Ga0114129_129649821 127
392 3300009148 Ga0105243_10146032 Ga0105243_101460323 127
393 3300009176 Ga0105242_10007403 Ga0105242_100074036 127
394 3300009176 Ga0105242_10009179 Ga0105242_100091796 127
395 3300009176 Ga0105242_10089248 Ga0105242_100892483 127
396 3300009176 Ga0105242_10585879 Ga0105242_105858792 127
397 3300009176 Ga0105242_10905622 Ga0105242_109056222 127
398 3300009177 Ga0105248_10040761 Ga0105248_100407615 127
399 3300009177 Ga0105248_10048968 Ga0105248_100489682 127
400 3300009177 Ga0105248_10069671 Ga0105248_100696714 127
401 3300009177 Ga0105248_10080366 Ga0105248_100803664 127
402 3300009177 Ga0105248_10302070 Ga0105248_103020703 127
403 3300009177 Ga0105248_11357468 Ga0105248_113574682 127
404 3300009545 Ga0105237_10199846 Ga0105237_101998462 127
405 3300009551 Ga0105238_11551387 Ga0105238_115513872 127
406 3300009553 Ga0105249_12157448 Ga0105249_121574481 127
407 3300011119 Ga0105246_10322115 Ga0105246_103221152 127
408 3300011119 Ga0105246_10384715 Ga0105246_103847152 127
409 3300012478 Ga0157328_1018368 Ga0157328_10183682 127
410 3300013296 Ga0157374_10040325 Ga0157374_100403253 127
411 3300013296 Ga0157374_11185322 Ga0157374_111853222 127
412 3300013297 Ga0157378_10090322 Ga0157378_100903223 127
413 3300013297 Ga0157378_10131912 Ga0157378_101319122 127
414 3300013297 Ga0157378_11735819 Ga0157378_117358192 127
415 3300013306 Ga0163162_10155039 Ga0163162_101550393 127
416 3300013306 Ga0163162_11573505 Ga0163162_115735052 127
417 3300013306 Ga0163162_13473214 Ga0163162_134732141 127
418 3300013308 Ga0157375_10032644 Ga0157375_100326441 127
419 3300013308 Ga0157375_10142643 Ga0157375_101426431 127
420 3300013308 Ga0157375_10756113 Ga0157375_107561133 127
421 3300013308 Ga0157375_10797951 Ga0157375_107979512 127
422 3300013308 Ga0157375_11447046 Ga0157375_114470462 127
423 3300014325 Ga0163163_10178821 Ga0163163_101788212 127
424 3300014325 Ga0163163_10523579 Ga0163163_105235792 127
425 3300014326 Ga0157380_11308939 Ga0157380_113089392 127
426 3300014326 Ga0157380_11343240 Ga0157380_113432401 127
427 3300014745 Ga0157377_10034898 Ga0157377_100348984 127
428 3300014745 Ga0157377_10365622 Ga0157377_103656222 127
429 3300014968 Ga0157379_10010988 Ga0157379_100109884 127
430 3300014968 Ga0157379_11296613 Ga0157379_112966132 127
431 3300014969 Ga0157376_10012899 Ga0157376_100128991 127
432 3300014969 Ga0157376_10111594 Ga0157376_101115942 127
433 3300014969 Ga0157376_10424767 Ga0157376_104247672 127
434 3300014969 Ga0157376_10525221 Ga0157376_105252212 127
435 3300017792 Ga0163161_10221081 Ga0163161_102210812 127
436 3300017792 Ga0163161_11436934 Ga0163161_114369342 127
437 3300025321 Ga0207656_10204214 Ga0207656_102042143 127
438 3300025899 Ga0207642_10177406 Ga0207642_101774062 127
439 3300025899 Ga0207642_10258513 Ga0207642_102585132 127
440 3300025899 Ga0207642_10370264 Ga0207642_103702642 127
441 3300025900 Ga0207710_10036542 Ga0207710_100365423 127
442 3300025903 Ga0207680_10101420 Ga0207680_101014201 127
443 3300025903 Ga0207680_10159962 Ga0207680_101599622 127
444 3300025903 Ga0207680_10386207 Ga0207680_103862072 127
445 3300025905 Ga0207685_10592085 Ga0207685_105920852 127
446 3300025906 Ga0207699_10504311 Ga0207699_105043112 127
447 3300025907 Ga0207645_10256823 Ga0207645_102568232 127
448 3300025909 Ga0207705_10088924 Ga0207705_100889242 127
449 3300025910 Ga0207684_10283973 Ga0207684_102839732 127
450 3300025910 Ga0207684_10369012 Ga0207684_103690122 127
451 3300025912 Ga0207707_10391360 Ga0207707_103913602 127
452 3300025913 Ga0207695_10063368 Ga0207695_100633683 127
453 3300025913 Ga0207695_10570565 Ga0207695_105705652 127
454 3300025914 Ga0207671_10168089 Ga0207671_101680892 127
455 3300025917 Ga0207660_10142932 Ga0207660_101429322 127
456 3300025917 Ga0207660_11246153 Ga0207660_112461531 127
457 3300025918 Ga0207662_10057610 Ga0207662_100576104 127
458 3300025919 Ga0207657_10006081 Ga0207657_1000608113 127
459 3300025919 Ga0207657_10601530 Ga0207657_106015303 127
460 3300025921 Ga0207652_10048088 Ga0207652_100480883 127
461 3300025922 Ga0207646_10333229 Ga0207646_103332292 127
462 3300025922 Ga0207646_10511335 Ga0207646_105113352 127
463 3300025923 Ga0207681_10089928 Ga0207681_100899283 127
464 3300025923 Ga0207681_10939831 Ga0207681_109398312 127
465 3300025925 Ga0207650_10765489 Ga0207650_107654892 127
466 3300025926 Ga0207659_10396980 Ga0207659_103969801 127
467 3300025927 Ga0207687_10088125 Ga0207687_100881253 127
468 3300025927 Ga0207687_10745116 Ga0207687_107451162 127
469 3300025927 Ga0207687_10812495 Ga0207687_108124952 127
470 3300025929 Ga0207664_10182318 Ga0207664_101823182 127
471 3300025931 Ga0207644_10006773 Ga0207644_100067733 127
472 3300025933 Ga0207706_10654566 Ga0207706_106545662 127
473 3300025933 Ga0207706_10790302 Ga0207706_107903022 127
474 3300025934 Ga0207686_10057789 Ga0207686_100577893 127
475 3300025934 Ga0207686_10087097 Ga0207686_100870973 127
476 3300025936 Ga0207670_10750858 Ga0207670_107508582 127
477 3300025937 Ga0207669_10138763 Ga0207669_101387633 127
478 3300025937 Ga0207669_10290965 Ga0207669_102909652 127
479 3300025938 Ga0207704_10075233 Ga0207704_100752332 127
480 3300025938 Ga0207704_10717944 Ga0207704_107179441 127
481 3300025940 Ga0207691_10019546 Ga0207691_100195463 127
482 3300025940 Ga0207691_10424004 Ga0207691_104240043 127
483 3300025940 Ga0207691_10523565 Ga0207691_105235652 127
484 3300025941 Ga0207711_10026730 Ga0207711_100267304 127
485 3300025941 Ga0207711_10032038 Ga0207711_100320385 127
486 3300025941 Ga0207711_10094262 Ga0207711_100942623 127
487 3300025941 Ga0207711_10128602 Ga0207711_101286022 127
488 3300025942 Ga0207689_10230024 Ga0207689_102300242 127
489 3300025942 Ga0207689_10383580 Ga0207689_103835802 127
490 3300025942 Ga0207689_10653785 Ga0207689_106537852 127
491 3300025944 Ga0207661_10972814 Ga0207661_109728142 127
492 3300025945 Ga0207679_10071806 Ga0207679_100718063 127
493 3300025949 Ga0207667_10336673 Ga0207667_103366732 127
494 3300025960 Ga0207651_10056250 Ga0207651_100562502 127
495 3300025960 Ga0207651_10260993 Ga0207651_102609932 127
496 3300025960 Ga0207651_10399417 Ga0207651_103994171 127
497 3300025960 Ga0207651_10921709 Ga0207651_109217092 127
498 3300025961 Ga0207712_10415008 Ga0207712_104150082 127
499 3300025972 Ga0207668_10241805 Ga0207668_102418052 127
500 3300025981 Ga0207640_11470412 Ga0207640_114704121 127
501 3300025986 Ga0207658_10047007 Ga0207658_100470072 127
502 3300025986 Ga0207658_10047326 Ga0207658_100473264 127
503 3300026023 Ga0207677_10026731 Ga0207677_100267313 127
504 3300026023 Ga0207677_10139859 Ga0207677_101398593 127
505 3300026023 Ga0207677_10309145 Ga0207677_103091452 127
506 3300026023 Ga0207677_10391125 Ga0207677_103911252 127
507 3300026023 Ga0207677_10672825 Ga0207677_106728252 127
508 3300026023 Ga0207677_11517129 Ga0207677_115171292 127
509 3300026035 Ga0207703_10650301 Ga0207703_106503012 127
510 3300026035 Ga0207703_10733969 Ga0207703_107339692 127
511 3300026035 Ga0207703_10805945 Ga0207703_108059452 127
512 3300026075 Ga0207708_10912844 Ga0207708_109128441 127
513 3300026088 Ga0207641_10001439 Ga0207641_1000143914 127
514 3300026088 Ga0207641_10860684 Ga0207641_108606842 127
515 3300026088 Ga0207641_12058910 Ga0207641_120589101 127
516 3300026089 Ga0207648_10045180 Ga0207648_100451805 127
517 3300026089 Ga0207648_10303051 Ga0207648_103030513 127
518 3300026089 Ga0207648_11849341 Ga0207648_118493412 127
519 3300026095 Ga0207676_10064447 Ga0207676_100644471 127
520 3300026095 Ga0207676_10181317 Ga0207676_101813172 127
521 3300026118 Ga0207675_100387325 Ga0207675_1003873253 127
522 3300026118 Ga0207675_100621867 Ga0207675_1006218672 127
523 3300026118 Ga0207675_102098936 Ga0207675_1020989361 127
524 3300026121 Ga0207683_10106566 Ga0207683_101065665 127
525 3300026121 Ga0207683_10713573 Ga0207683_107135733 127
526 3300026121 Ga0207683_11105561 Ga0207683_111055611 127
527 3300026142 Ga0207698_10911727 Ga0207698_109117272 127
528 3300026142 Ga0207698_11602920 Ga0207698_116029202 127
529 3300027907 Ga0207428_10037252 Ga0207428_100372525 127
530 3300028379 Ga0268266_10019305 Ga0268266_100193053 127
531 3300028379 Ga0268266_10701308 Ga0268266_107013082 127
532 3300028380 Ga0268265_10112247 Ga0268265_101122473 127
533 3300028380 Ga0268265_10978488 Ga0268265_109784882 127
534 3300028380 Ga0268265_11596331 Ga0268265_115963312 127
535 3300028381 Ga0268264_10153392 Ga0268264_101533923 127
536 3300028381 Ga0268264_10429873 Ga0268264_104298731 127
537 3300028381 Ga0268264_10697811 Ga0268264_106978112 127
538 3300028381 Ga0268264_11544979 Ga0268264_115449792 127
539 3300031548 Ga0307408_101282512 Ga0307408_1012825123 127
540 3300031548 Ga0307408_101326310 Ga0307408_1013263102 127
541 3300031901 Ga0307406_11396297 Ga0307406_113962972 127
542 3300035085 Ga0373929_0088576 Ga0373929_0088576_212_598 127
543 3300035086 Ga0373934_0287715 Ga0373934_0287715_188_574 127
544 3300035112 Ga0373932_0142400 Ga0373932_0142400_243_629 127
545 3300035112 Ga0373932_0438474 Ga0373932_0438474_31_417 127
546 3300035115 Ga0373941_0144295 Ga0373941_0144295_271_657 127
547 3300035116 Ga0373945_0044414 Ga0373945_0044414_245_631 127
548 3300035117 Ga0373953_0126978 Ga0373953_0126978_146_562 127
549 3300035170 Ga0373943_0342927 Ga0373943_0342927_458_844 127
550 3300035171 Ga0373946_0179247 Ga0373946_0179247_345_731 127
551 3300035172 Ga0373955_0044020 Ga0373955_0044020_1548_1934 127
552 3300035172 Ga0373955_0096801 Ga0373955_0096801_357_773 127
553 3300035691 Ga0373931_0076384 Ga0373931_0076384_147_533 127
554 3300035692 Ga0373935_0993189 Ga0373935_0993189_87_473 127
555 3300035724 Ga0373933_0182731 Ga0373933_0182731_546_962 127
556 3300035725 Ga0373947_0088685 Ga0373947_0088685_1410_1796 127
557 3300036401 Ga0373937_0151733 Ga0373937_0151733_272_658 127
558 3300036401 Ga0373937_0472667 Ga0373937_0472667_153_539 127
559 3300036401 Ga0373937_0562246 Ga0373937_0562246_685_1071 127
560 3300036401 Ga0373937_0762680 Ga0373937_0762680_355_741 127
561 3300036401 Ga0373937_0801211 Ga0373937_0801211_273_659 127
562 3300037068 Ga0373925_1365082 Ga0373925_1365082_51_437 127
563 3300037466 Ga0395898_1248308 Ga0395898_1248308_111_497 127
564 3300045051 Ga0451576_0042753 Ga0451576_0042753_117_503 127
565 3300046454 Ga0495592_0770343 Ga0495592_0770343_92_478 127
566 3300046455 Ga0495603_0147776 Ga0495603_0147776_960_1346 127
567 3300046459 Ga0495629_0482684 Ga0495629_0482684_315_701 127
568 3300046462 Ga0495651_0191693 Ga0495651_0191693_403_819 127
569 3300046462 Ga0495651_0330708 Ga0495651_0330708_509_895 127
570 3300046463 Ga0495653_0146527 Ga0495653_0146527_388_774 127
571 3300046463 Ga0495653_0630818 Ga0495653_0630818_33_419 127
572 3300046475 Ga0495639_0128359 Ga0495639_0128359_809_1195 127
573 3300046499 Ga0495594_0254331 Ga0495594_0254331_235_621 127
574 3300046499 Ga0495594_0784483 Ga0495594_0784483_103_495 127
575 3300046516 Ga0495628_0071470 Ga0495628_0071470_2234_2620 127
576 3300046517 Ga0495630_0251315 Ga0495630_0251315_341_727 127
577 3300046517 Ga0495630_1398987 Ga0495630_1398987_23_409 127
578 3300046523 Ga0495644_0355806 Ga0495644_0355806_136_522 127
579 3300046528 Ga0495642_0260238 Ga0495642_0260238_95_481 127
580 3300046533 Ga0495640_0213548 Ga0495640_0213548_188_574 127
581 3300046535 Ga0495586_0128973 Ga0495586_0128973_896_1282 127
582 3300046536 Ga0495587_0195115 Ga0495587_0195115_203_619 127
583 3300046543 Ga0495645_0056749 Ga0495645_0056749_1989_2405 127
584 3300046558 Ga0495633_0280466 Ga0495633_0280466_339_725 127
585 3300046615 Ga0495656_0248450 Ga0495656_0248450_37_423 127
586 3300046615 Ga0495656_0688845 Ga0495656_0688845_83_475 127
587 3300046642 Ga0495634_0335269 Ga0495634_0335269_485_871 127
588 3300046663 Ga0495635_0438884 Ga0495635_0438884_86_472 127
589 3300046678 Ga0495599_0140783 Ga0495599_0140783_399_815 127
590 3300046678 Ga0495599_0216914 Ga0495599_0216914_482_868 127
591 3300046680 Ga0495646_0499508 Ga0495646_0499508_192_578 127
592 3300046681 Ga0495647_0044598 Ga0495647_0044598_709_1095 127
593 3300046681 Ga0495647_0284674 Ga0495647_0284674_104_550 127
594 3300046683 Ga0495658_0040389 Ga0495658_0040389_379_765 127
595 3300046683 Ga0495658_0163528 Ga0495658_0163528_486_872 127
596 3300046683 Ga0495658_0275711 Ga0495658_0275711_139_525 127
597 3300046684 Ga0495669_0074307 Ga0495669_0074307_243_629 127
598 3300046689 Ga0495613_0394148 Ga0495613_0394148_159_545 127
599 3300046691 Ga0495670_0315638 Ga0495670_0315638_407_793 127
600 3300046809 Ga0495600_0078259 Ga0495600_0078259_368_784 127
601 3300047315 Ga0495581_0500155 Ga0495581_0500155_36_422 127
602 3300047317 Ga0495604_0874802 Ga0495604_0874802_99_485 127
603 3300047319 Ga0495674_0975457 Ga0495674_0975457_26_412 127
604 3300047320 Ga0495672_0413162 Ga0495672_0413162_19_405 127
605 3300047471 Ga0495684_0921757 Ga0495684_0921757_83_469 127
606 3300048905 Ga0496102_0486300 Ga0496102_0486300_534_920 127
607 3300048905 Ga0496102_1857583 Ga0496102_1857583_19_405 127
608 3300048907 Ga0496104_0111424 Ga0496104_0111424_2068_2457 127
609 3300048907 Ga0496104_0193126 Ga0496104_0193126_705_1091 127
610 3300048908 Ga0496105_0562400 Ga0496105_0562400_187_573 127
611 3300048909 Ga0496106_0320006 Ga0496106_0320006_469_855 127
612 3300048910 Ga0496107_0495879 Ga0496107_0495879_306_692 127
613 3300048910 Ga0496107_1280440 Ga0496107_1280440_117_503 127
614 3300048911 Ga0496108_0023039 Ga0496108_0023039_2210_2599 127
615 3300048911 Ga0496108_1451490 Ga0496108_1451490_36_422 127
616 3300048912 Ga0496109_0106622 Ga0496109_0106622_2050_2436 127
617 3300048912 Ga0496109_0412495 Ga0496109_0412495_227_616 127
618 3300048913 Ga0496110_0799479 Ga0496110_0799479_198_584 127
619 3300048915 Ga0496112_0050925 Ga0496112_0050925_2690_3079 127
620 3300048915 Ga0496112_1084914 Ga0496112_1084914_212_598 127
621 3300048915 Ga0496112_1728411 Ga0496112_1728411_92_481 127
622 3300048915 Ga0496112_1832169 Ga0496112_1832169_105_491 127
623 3300048916 Ga0496113_0032383 Ga0496113_0032383_2389_2778 127
624 3300048916 Ga0496113_1497134 Ga0496113_1497134_117_503 127
625 3300048917 Ga0496114_0339497 Ga0496114_0339497_840_1226 127
626 3300048917 Ga0496114_1707900 Ga0496114_1707900_97_483 127
627 3300048918 Ga0496115_0039023 Ga0496115_0039023_15_401 127
628 3300050507 nmdc:mga05p37_12782_c1 nmdc:mga05p37_12782_c1_187_573 127
629 3300050507 nmdc:mga05p37_65425_c1 nmdc:mga05p37_65425_c1_2501_2887 127
630 3300050507 nmdc:mga05p37_795253_c1 nmdc:mga05p37_795253_c1_488_883 127
631 3300050508 nmdc:mga09592_374685_c1 nmdc:mga09592_374685_c1_494_928 127
632 3300050508 nmdc:mga09592_475115_c1 nmdc:mga09592_475115_c1_412_798 127
633 3300050511 nmdc:mga08y16_1265735_c1 nmdc:mga08y16_1265735_c1_213_599 127
634 3300050511 nmdc:mga08y16_197841_c1 nmdc:mga08y16_197841_c1_211_645 127
635 3300050511 nmdc:mga08y16_201982_c1 nmdc:mga08y16_201982_c1_1318_1704 127
636 3300050511 nmdc:mga08y16_457449_c1 nmdc:mga08y16_457449_c1_549_935 127
637 3300050512 nmdc:mga0n895_240784_c1 nmdc:mga0n895_240784_c1_509_895 127
638 3300050512 nmdc:mga0n895_514927_c1 nmdc:mga0n895_514927_c1_52_438 127
639 3300050513 nmdc:mga0rr50_130263_c1 nmdc:mga0rr50_130263_c1_351_746 127
640 3300050513 nmdc:mga0rr50_809806_c1 nmdc:mga0rr50_809806_c1_336_722 127
641 3300050514 nmdc:mga08x19_285618_c1 nmdc:mga08x19_285618_c1_404_799 127
642 3300050515 nmdc:mga0a205_1142858_c1 nmdc:mga0a205_1142858_c1_176_580 127
643 3300050515 nmdc:mga0a205_528173_c1 nmdc:mga0a205_528173_c1_497_901 127
644 3300050515 nmdc:mga0a205_599235_c1 nmdc:mga0a205_599235_c1_167_553 127
645 3300053077 Ga0495601_0146171 Ga0495601_0146171_305_691 127
646 3300053077 Ga0495601_0240595 Ga0495601_0240595_236_622 127
647 3300053084 Ga0495595_0010931 Ga0495595_0010931_2177_2593 127
648 3300053085 Ga0495619_0300223 Ga0495619_0300223_67_453 127
649 3300053085 Ga0495619_0489034 Ga0495619_0489034_155_544 127
650 3300053085 Ga0495619_0522967 Ga0495619_0522967_140_526 127
651 3300053085 Ga0495619_0744230 Ga0495619_0744230_92_478 127
652 3300053134 Ga0500658_0445202 Ga0500658_0445202_171_557 127
653 3300005293 Ga0065715_10443799 Ga0065715_104437992 128
654 3300005295 Ga0065707_10768756 Ga0065707_107687561 128
655 3300005333 Ga0070677_10223646 Ga0070677_102236462 128
656 3300005345 Ga0070692_10593538 Ga0070692_105935381 128
657 3300005353 Ga0070669_100046718 Ga0070669_1000467183 128
658 3300005353 Ga0070669_100205521 Ga0070669_1002055211 128
659 3300005354 Ga0070675_100004928 Ga0070675_1000049287 128
660 3300005354 Ga0070675_100083888 Ga0070675_1000838882 128
661 3300005356 Ga0070674_100183991 Ga0070674_1001839912 128
662 3300005356 Ga0070674_100490309 Ga0070674_1004903092 128
663 3300005364 Ga0070673_100811122 Ga0070673_1008111222 128
664 3300005434 Ga0070709_10080261 Ga0070709_100802614 128
665 3300005441 Ga0070700_100122822 Ga0070700_1001228222 128
666 3300005441 Ga0070700_100856071 Ga0070700_1008560712 128
667 3300005445 Ga0070708_100554904 Ga0070708_1005549042 128
668 3300005457 Ga0070662_100723809 Ga0070662_1007238092 128
669 3300005457 Ga0070662_101188238 Ga0070662_1011882381 128
670 3300005459 Ga0068867_100046159 Ga0068867_1000461594 128
671 3300005468 Ga0070707_100061815 Ga0070707_1000618154 128
672 3300005471 Ga0070698_100246029 Ga0070698_1002460293 128
673 3300005518 Ga0070699_100127022 Ga0070699_1001270222 128
674 3300005536 Ga0070697_100030072 Ga0070697_1000300723 128
675 3300005543 Ga0070672_100628876 Ga0070672_1006288762 128
676 3300005544 Ga0070686_100477557 Ga0070686_1004775571 128
677 3300005546 Ga0070696_100054449 Ga0070696_1000544493 128
678 3300005546 Ga0070696_100334602 Ga0070696_1003346022 128
679 3300005549 Ga0070704_100701266 Ga0070704_1007012661 128
680 3300005617 Ga0068859_100341004 Ga0068859_1003410041 128
681 3300005617 Ga0068859_101892345 Ga0068859_1018923451 128
682 3300005718 Ga0068866_10223482 Ga0068866_102234822 128
683 3300005842 Ga0068858_100245466 Ga0068858_1002454662 128
684 3300005844 Ga0068862_100043489 Ga0068862_1000434896 128
685 3300005844 Ga0068862_100571967 Ga0068862_1005719672 128
686 3300005937 Ga0081455_10033163 Ga0081455_100331634 128
687 3300006358 Ga0068871_100561590 Ga0068871_1005615901 128
688 3300006852 Ga0075433_10078981 Ga0075433_100789813 128
689 3300006871 Ga0075434_100000776 Ga0075434_1000007761 128
690 3300006871 Ga0075434_100133145 Ga0075434_1001331454 128
691 3300006871 Ga0075434_100529729 Ga0075434_1005297292 128
692 3300006871 Ga0075434_100568177 Ga0075434_1005681772 128
693 3300006871 Ga0075434_101288614 Ga0075434_1012886142 128
694 3300006914 Ga0075436_100001718 Ga0075436_1000017187 128
695 3300006914 Ga0075436_100068074 Ga0075436_1000680743 128
696 3300006914 Ga0075436_100186902 Ga0075436_1001869023 128
697 3300006931 Ga0097620_100340988 Ga0097620_1003409881 128
698 3300006931 Ga0097620_101892456 Ga0097620_1018924562 128
699 3300007076 Ga0075435_100000189 Ga0075435_10000018916 128
700 3300007076 Ga0075435_100004108 Ga0075435_1000041085 128
701 3300007076 Ga0075435_100069738 Ga0075435_1000697382 128
702 3300009098 Ga0105245_10970075 Ga0105245_109700751 128
703 3300009098 Ga0105245_11327211 Ga0105245_113272112 128
704 3300009147 Ga0114129_10000304 Ga0114129_100003049 128
705 3300009147 Ga0114129_10021549 Ga0114129_100215495 128
706 3300009148 Ga0105243_10296654 Ga0105243_102966542 128
707 3300009174 Ga0105241_10115966 Ga0105241_101159662 128
708 3300009176 Ga0105242_10893161 Ga0105242_108931612 128
709 3300009177 Ga0105248_10099960 Ga0105248_100999603 128
710 3300009177 Ga0105248_12260191 Ga0105248_122601912 128
711 3300009553 Ga0105249_10058904 Ga0105249_100589043 128
712 3300009553 Ga0105249_10843395 Ga0105249_108433952 128
713 3300009553 Ga0105249_10892409 Ga0105249_108924092 128
714 3300010375 Ga0105239_10760707 Ga0105239_107607073 128
715 3300011119 Ga0105246_11232811 Ga0105246_112328112 128
716 3300013296 Ga0157374_10619609 Ga0157374_106196092 128
717 3300013306 Ga0163162_12545413 Ga0163162_125454132 128
718 3300014326 Ga0157380_10507128 Ga0157380_105071282 128
719 3300014326 Ga0157380_10715163 Ga0157380_107151632 128
720 3300014968 Ga0157379_11184895 Ga0157379_111848952 128
721 3300025893 Ga0207682_10173766 Ga0207682_101737662 128
722 3300025901 Ga0207688_10264745 Ga0207688_102647452 128
723 3300025906 Ga0207699_10059499 Ga0207699_100594992 128
724 3300025910 Ga0207684_10433462 Ga0207684_104334622 128
725 3300025913 Ga0207695_10062269 Ga0207695_100622694 128
726 3300025918 Ga0207662_10158413 Ga0207662_101584132 128
727 3300025922 Ga0207646_10711523 Ga0207646_107115233 128
728 3300025922 Ga0207646_11314866 Ga0207646_113148662 128
729 3300025923 Ga0207681_11641385 Ga0207681_116413851 128
730 3300025924 Ga0207694_10220033 Ga0207694_102200332 128
731 3300025926 Ga0207659_10000637 Ga0207659_1000063716 128
732 3300025926 Ga0207659_10300931 Ga0207659_103009312 128
733 3300025931 Ga0207644_10467038 Ga0207644_104670382 128
734 3300025933 Ga0207706_10077394 Ga0207706_100773942 128
735 3300025933 Ga0207706_10170600 Ga0207706_101706003 128
736 3300025933 Ga0207706_10477703 Ga0207706_104777032 128
737 3300025934 Ga0207686_10489239 Ga0207686_104892392 128
738 3300025934 Ga0207686_10739682 Ga0207686_107396822 128
739 3300025935 Ga0207709_10391646 Ga0207709_103916461 128
740 3300025937 Ga0207669_10565564 Ga0207669_105655642 128
741 3300025937 Ga0207669_11052373 Ga0207669_110523732 128
742 3300025940 Ga0207691_10773407 Ga0207691_107734072 128
743 3300025941 Ga0207711_10045130 Ga0207711_100451304 128
744 3300025960 Ga0207651_10785291 Ga0207651_107852911 128
745 3300025960 Ga0207651_11536133 Ga0207651_115361331 128
746 3300025961 Ga0207712_10554786 Ga0207712_105547863 128
747 3300025961 Ga0207712_10710531 Ga0207712_107105312 128
748 3300025961 Ga0207712_12073488 Ga0207712_120734882 128
749 3300025972 Ga0207668_10657224 Ga0207668_106572242 128
750 3300025972 Ga0207668_10695391 Ga0207668_106953912 128
751 3300025981 Ga0207640_10032202 Ga0207640_100322024 128
752 3300025981 Ga0207640_10310768 Ga0207640_103107682 128
753 3300026035 Ga0207703_10213043 Ga0207703_102130432 128
754 3300026035 Ga0207703_12215109 Ga0207703_122151092 128
755 3300026041 Ga0207639_10313539 Ga0207639_103135392 128
756 3300026075 Ga0207708_10014526 Ga0207708_100145262 128
757 3300026089 Ga0207648_10044459 Ga0207648_100444593 128
758 3300026118 Ga0207675_100048362 Ga0207675_1000483625 128
759 3300026118 Ga0207675_100275600 Ga0207675_1002756003 128
760 3300026118 Ga0207675_102204307 Ga0207675_1022043072 128
761 3300026121 Ga0207683_10138777 Ga0207683_101387773 128
762 3300028380 Ga0268265_10168612 Ga0268265_101686122 128
763 3300028380 Ga0268265_10460791 Ga0268265_104607912 128
764 3300028381 Ga0268264_11069935 Ga0268264_110699353 128
765 3300028381 Ga0268264_11256535 Ga0268264_112565352 128
766 3300031903 Ga0307407_11321949 Ga0307407_113219491 128
767 3300034816 Ga0373930_0000245 Ga0373930_0000245_950_1342 128
768 3300034817 Ga0373948_0028959 Ga0373948_0028959_499_891 128
769 3300034818 Ga0373950_0002004 Ga0373950_0002004_2160_2552 128
770 3300034820 Ga0373959_0000405 Ga0373959_0000405_871_1263 128
771 3300034957 Ga0373938_0005187 Ga0373938_0005187_284_676 128
772 3300035084 Ga0373928_0002313 Ga0373928_0002313_545_937 128
773 3300035085 Ga0373929_0014335 Ga0373929_0014335_303_695 128
774 3300035088 Ga0373940_0021100 Ga0373940_0021100_1048_1440 128
775 3300035090 Ga0373949_0003515 Ga0373949_0003515_2078_2470 128
776 3300035091 Ga0373951_0000437 Ga0373951_0000437_171_563 128
777 3300035092 Ga0373952_0019680 Ga0373952_0019680_848_1240 128
778 3300035112 Ga0373932_0014002 Ga0373932_0014002_950_1342 128
779 3300035114 Ga0373939_0001301 Ga0373939_0001301_1869_2261 128
780 3300035115 Ga0373941_0013444 Ga0373941_0013444_1078_1473 128
781 3300035115 Ga0373941_0015421 Ga0373941_0015421_1514_1906 128
782 3300035121 Ga0373960_0004257 Ga0373960_0004257_2276_2668 128
783 3300035170 Ga0373943_0486564 Ga0373943_0486564_314_706 128
784 3300035207 Ga0373942_0018432 Ga0373942_0018432_670_1062 128
785 3300035207 Ga0373942_0048593 Ga0373942_0048593_754_1149 128
786 3300035241 Ga0373961_0005744 Ga0373961_0005744_785_1177 128
787 3300035242 Ga0373962_0036497 Ga0373962_0036497_653_1045 128
788 3300035724 Ga0373933_0437136 Ga0373933_0437136_121_516 128
789 3300044694 Ga0466963_0203622 Ga0466963_0203622_297_686 128
790 3300046558 Ga0495633_0148457 Ga0495633_0148457_229_624 128
791 3300046684 Ga0495669_0177199 Ga0495669_0177199_212_604 128
792 3300048904 Ga0496101_0655154 Ga0496101_0655154_69_461 128
793 3300048909 Ga0496106_0954131 Ga0496106_0954131_79_471 128
794 3300048909 Ga0496106_0984749 Ga0496106_0984749_19_417 128
795 3300048910 Ga0496107_0228327 Ga0496107_0228327_183_575 128
796 3300048913 Ga0496110_1782646 Ga0496110_1782646_39_437 128
797 3300048915 Ga0496112_0118215 Ga0496112_0118215_1288_1686 128
798 3300048915 Ga0496112_0974937 Ga0496112_0974937_277_669 128
799 3300050507 nmdc:mga05p37_209765_c1 nmdc:mga05p37_209765_c1_1297_1689 128
800 3300050507 nmdc:mga05p37_4258_c1 nmdc:mga05p37_4258_c1_14526_14924 128
801 3300050512 nmdc:mga0n895_1049307_c1 nmdc:mga0n895_1049307_c1_20_412 128
802 3300050512 nmdc:mga0n895_121_c1 nmdc:mga0n895_121_c1_24865_25257 128
803 3300050512 nmdc:mga0n895_218051_c1 nmdc:mga0n895_218051_c1_560_952 128
804 3300050512 nmdc:mga0n895_426174_c1 nmdc:mga0n895_426174_c1_103_495 128
805 3300050512 nmdc:mga0n895_438852_c1 nmdc:mga0n895_438852_c1_881_1279 128
806 3300050512 nmdc:mga0n895_48914_c1 nmdc:mga0n895_48914_c1_695_1087 128
807 3300050512 nmdc:mga0n895_77005_c1 nmdc:mga0n895_77005_c1_1871_2269 128
808 3300050513 nmdc:mga0rr50_107_c1 nmdc:mga0rr50_107_c1_24865_25257 128
809 3300050513 nmdc:mga0rr50_18927_c1 nmdc:mga0rr50_18927_c1_696_1088 128
810 3300050513 nmdc:mga0rr50_673_c1 nmdc:mga0rr50_673_c1_5460_5852 128
811 3300050514 nmdc:mga08x19_20121_c1 nmdc:mga08x19_20121_c1_2866_3258 128
812 3300050514 nmdc:mga08x19_351166_c1 nmdc:mga08x19_351166_c1_625_1017 128
813 3300050514 nmdc:mga08x19_967_c1 nmdc:mga08x19_967_c1_6453_6845 128
814 3300050515 nmdc:mga0a205_1277055_c1 nmdc:mga0a205_1277055_c1_106_498 128
815 3300050515 nmdc:mga0a205_35834_c1 nmdc:mga0a205_35834_c1_2609_3007 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

39

145

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crn-assembly1.cif.gz_B crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 0.9015 5 125
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.8981 8 124
3dgf-assembly1.cif.gz_C structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism 0.8926 6 118
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.891 6 118
2rdm-assembly1.cif.gz_A crystal structure of response regulator receiver protein from sinorhizobium medicae wsm419 0.8866 5 121
ID Description Score Start End Superfamily
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9289 6 70 3.40.50.2300
af_Q2G2G2_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9189 8 70 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9043 8 83 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9037 8 83 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8991 5 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F2VT48-F1-model_v4 Response regulatory domain-containing protein 0.9847 9 124 GO:0000160
AF-A0A2V8GDY5-F1-model_v4 Response regulator 0.9751 10 118 GO:0000160
AF-A0A3N5NGM7-F1-model_v4 Response regulator 0.9499 1 121 GO:0000160
AF-A0A2V8BL56-F1-model_v4 Response regulatory domain-containing protein 0.9458 16 128 GO:0000160
AF-A0A2V8BL56-F1-model_v4 Response regulatory domain-containing protein 0.9375 16 128 GO:0000160

Feature Viewer

pLDDT pTM Quality
88.92 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map