F482018
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 815 | 288 | 815 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10262607|Ga0265314_102626072 |
| Length | 156 |
| Sequence | MHGLSRYNPNRFAVRLLPDATDPDDTERLIMTKDAARLVLVVEDDVSVRRPLVKFLEMHGFAVVTAETSDEGLDQLRKNRVVAAVVDLRLRRGSGRDVVTSVPADVPVIIFSGVPSESAELERLRPRTRLIEKPYSLVLLVETLEEMLAESSAPNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 177 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 5.28 |
| Rhizosphere | 94.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10443799 | 3300005293 | Bacteria | 832 |
| 2 | Ga0065707_10768756 | 3300005295 | Bacteria | 592 |
| 3 | Ga0070658_10012592 | 3300005327 | Bacteria | 6785 |
| 4 | Ga0070683_102245138 | 3300005329 | Unclassified | 524 |
| 5 | Ga0070690_100701936 | 3300005330 | Bacteria | 777 |
| 6 | Ga0070670_100463438 | 3300005331 | Bacteria | 1124 |
| 7 | Ga0070677_10136872 | 3300005333 | Bacteria | 1125 |
| 8 | Ga0070677_10223646 | 3300005333 | Bacteria | 921 |
| 9 | Ga0070677_10314871 | 3300005333 | Archaea | 800 |
| 10 | Ga0068869_100082933 | 3300005334 | Bacteria | 2397 |
| 11 | Ga0068869_100447990 | 3300005334 | Bacteria | 1070 |
| 12 | Ga0068869_100460686 | 3300005334 | Bacteria | 1055 |
| 13 | Ga0068869_100722886 | 3300005334 | Bacteria | 851 |
| 14 | Ga0070666_10869830 | 3300005335 | Bacteria | 666 |
| 15 | Ga0068868_100037394 | 3300005338 | Bacteria | 3763 |
| 16 | Ga0068868_100119930 | 3300005338 | Bacteria | 2145 |
| 17 | Ga0068868_100170374 | 3300005338 | Bacteria | 1802 |
| 18 | Ga0068868_100419711 | 3300005338 | Bacteria | 1158 |
| 19 | Ga0070660_100064261 | 3300005339 | Bacteria | 2855 |
| 20 | Ga0070689_100094020 | 3300005340 | Unclassified | 2367 |
| 21 | Ga0070689_100967094 | 3300005340 | Bacteria | 756 |
| 22 | Ga0070687_100224423 | 3300005343 | Bacteria | 1153 |
| 23 | Ga0070687_100506445 | 3300005343 | Bacteria | 814 |
| 24 | Ga0070661_100211698 | 3300005344 | Bacteria | 1484 |
| 25 | Ga0070661_100564304 | 3300005344 | Bacteria | 917 |
| 26 | Ga0070692_10593538 | 3300005345 | Bacteria | 732 |
| 27 | Ga0070668_100350158 | 3300005347 | Bacteria | 1250 |
| 28 | Ga0070669_100046718 | 3300005353 | Bacteria | 3157 |
| 29 | Ga0070669_100047404 | 3300005353 | Unclassified | 3135 |
| 30 | Ga0070669_100093200 | 3300005353 | Bacteria | 2262 |
| 31 | Ga0070669_100205521 | 3300005353 | Unclassified | 1551 |
| 32 | Ga0070675_100004928 | 3300005354 | Bacteria | 10178 |
| 33 | Ga0070675_100083888 | 3300005354 | Bacteria | 2660 |
| 34 | Ga0070675_100357175 | 3300005354 | Bacteria | 1297 |
| 35 | Ga0070675_100394357 | 3300005354 | Bacteria | 1234 |
| 36 | Ga0070675_100769245 | 3300005354 | Unclassified | 879 |
| 37 | Ga0070671_100044941 | 3300005355 | Bacteria | 3670 |
| 38 | Ga0070671_100361176 | 3300005355 | Bacteria | 1240 |
| 39 | Ga0070671_100365478 | 3300005355 | Bacteria | 1232 |
| 40 | Ga0070674_100072587 | 3300005356 | Unclassified | 2437 |
| 41 | Ga0070674_100121193 | 3300005356 | Bacteria | 1936 |
| 42 | Ga0070674_100139155 | 3300005356 | Bacteria | 1820 |
| 43 | Ga0070674_100183991 | 3300005356 | Bacteria | 1602 |
| 44 | Ga0070674_100490309 | 3300005356 | Bacteria | 1021 |
| 45 | Ga0070674_100575658 | 3300005356 | Bacteria | 948 |
| 46 | Ga0070673_100063214 | 3300005364 | Bacteria | 2945 |
| 47 | Ga0070673_100098118 | 3300005364 | Unclassified | 2407 |
| 48 | Ga0070673_100167660 | 3300005364 | Unclassified | 1872 |
| 49 | Ga0070673_100305577 | 3300005364 | Bacteria | 1401 |
| 50 | Ga0070673_100811122 | 3300005364 | Unclassified | 864 |
| 51 | Ga0070673_101028703 | 3300005364 | Unclassified | 768 |
| 52 | Ga0070688_100134780 | 3300005365 | Unclassified | 1671 |
| 53 | Ga0070688_100313434 | 3300005365 | Bacteria | 1138 |
| 54 | Ga0070667_100009819 | 3300005367 | Bacteria | 7934 |
| 55 | Ga0070667_100318647 | 3300005367 | Bacteria | 1403 |
| 56 | Ga0070709_10080261 | 3300005434 | Bacteria | 2127 |
| 57 | Ga0070709_10245755 | 3300005434 | Bacteria | 1287 |
| 58 | Ga0070714_100044820 | 3300005435 | Bacteria | 3745 |
| 59 | Ga0070705_100483740 | 3300005440 | Unclassified | 936 |
| 60 | Ga0070705_101144018 | 3300005440 | Bacteria | 639 |
| 61 | Ga0070700_100122822 | 3300005441 | Bacteria | 1742 |
| 62 | Ga0070700_100856071 | 3300005441 | Bacteria | 737 |
| 63 | Ga0070694_100062300 | 3300005444 | Bacteria | 2548 |
| 64 | Ga0070694_100096741 | 3300005444 | Bacteria | 2081 |
| 65 | Ga0070694_100705236 | 3300005444 | Bacteria | 821 |
| 66 | Ga0070708_100164533 | 3300005445 | Bacteria | 2069 |
| 67 | Ga0070708_100554904 | 3300005445 | Bacteria | 1083 |
| 68 | Ga0070708_100771718 | 3300005445 | Bacteria | 904 |
| 69 | Ga0070708_101925576 | 3300005445 | Unclassified | 548 |
| 70 | Ga0070678_100612660 | 3300005456 | Bacteria | 973 |
| 71 | Ga0070678_101175206 | 3300005456 | Bacteria | 711 |
| 72 | Ga0070678_101499574 | 3300005456 | Bacteria | 631 |
| 73 | Ga0070678_101779224 | 3300005456 | Bacteria | 581 |
| 74 | Ga0070662_100344256 | 3300005457 | Bacteria | 1220 |
| 75 | Ga0070662_100723809 | 3300005457 | Bacteria | 843 |
| 76 | Ga0070662_101188238 | 3300005457 | Bacteria | 655 |
| 77 | Ga0070662_101194822 | 3300005457 | Bacteria | 654 |
| 78 | Ga0070681_10474497 | 3300005458 | Bacteria | 1163 |
| 79 | Ga0070681_11423507 | 3300005458 | Bacteria | 617 |
| 80 | Ga0070681_11774500 | 3300005458 | Unclassified | 544 |
| 81 | Ga0068867_100046159 | 3300005459 | Bacteria | 3199 |
| 82 | Ga0068867_100382326 | 3300005459 | Bacteria | 1183 |
| 83 | Ga0068867_100758830 | 3300005459 | Bacteria | 861 |
| 84 | Ga0068867_101181283 | 3300005459 | Bacteria | 702 |
| 85 | Ga0070685_10109186 | 3300005466 | Bacteria | 1701 |
| 86 | Ga0070706_100208008 | 3300005467 | Bacteria | 1827 |
| 87 | Ga0070706_100475305 | 3300005467 | Bacteria | 1163 |
| 88 | Ga0070706_101588395 | 3300005467 | Viruses | 597 |
| 89 | Ga0070706_101865449 | 3300005467 | Bacteria | 546 |
| 90 | Ga0070707_100036870 | 3300005468 | Bacteria | 4666 |
| 91 | Ga0070707_100061815 | 3300005468 | Bacteria | 3593 |
| 92 | Ga0070707_100263363 | 3300005468 | Bacteria | 1677 |
| 93 | Ga0070707_100421753 | 3300005468 | Unclassified | 1295 |
| 94 | Ga0070707_100723988 | 3300005468 | Bacteria | 958 |
| 95 | Ga0070698_100014460 | 3300005471 | Bacteria | 8337 |
| 96 | Ga0070698_100246029 | 3300005471 | Bacteria | 1721 |
| 97 | Ga0070698_101082948 | 3300005471 | Archaea | 750 |
| 98 | Ga0070698_101720080 | 3300005471 | Bacteria | 580 |
| 99 | Ga0070699_100004418 | 3300005518 | Bacteria | 12429 |
| 100 | Ga0070699_100127022 | 3300005518 | Bacteria | 2246 |
| 101 | Ga0070699_100559274 | 3300005518 | Bacteria | 1041 |
| 102 | Ga0070699_101457645 | 3300005518 | Bacteria | 628 |
| 103 | Ga0070684_101378596 | 3300005535 | Unclassified | 664 |
| 104 | Ga0070697_100030072 | 3300005536 | Bacteria | 4360 |
| 105 | Ga0070697_100137743 | 3300005536 | Bacteria | 2051 |
| 106 | Ga0070697_100384029 | 3300005536 | Unclassified | 1217 |
| 107 | Ga0070697_100415161 | 3300005536 | Bacteria | 1169 |
| 108 | Ga0070697_100464079 | 3300005536 | Bacteria | 1104 |
| 109 | Ga0070672_100018842 | 3300005543 | Bacteria | 4998 |
| 110 | Ga0070672_100111115 | 3300005543 | Bacteria | 2234 |
| 111 | Ga0070672_100385756 | 3300005543 | Bacteria | 1199 |
| 112 | Ga0070672_100628876 | 3300005543 | Bacteria | 936 |
| 113 | Ga0070672_100916554 | 3300005543 | Bacteria | 774 |
| 114 | Ga0070686_100477557 | 3300005544 | Bacteria | 963 |
| 115 | Ga0070686_101120361 | 3300005544 | Bacteria | 651 |
| 116 | Ga0070695_100035574 | 3300005545 | Bacteria | 3129 |
| 117 | Ga0070695_100242718 | 3300005545 | Bacteria | 1307 |
| 118 | Ga0070696_100054449 | 3300005546 | Bacteria | 2788 |
| 119 | Ga0070696_100334602 | 3300005546 | Bacteria | 1169 |
| 120 | Ga0070696_100368348 | 3300005546 | Bacteria | 1117 |
| 121 | Ga0070696_100555178 | 3300005546 | Bacteria | 921 |
| 122 | Ga0070693_100299339 | 3300005547 | Bacteria | 1084 |
| 123 | Ga0070665_100007922 | 3300005548 | Bacteria | 10770 |
| 124 | Ga0070665_100020938 | 3300005548 | Bacteria | 6572 |
| 125 | Ga0070665_100044139 | 3300005548 | Bacteria | 4477 |
| 126 | Ga0070665_100473760 | 3300005548 | Bacteria | 1263 |
| 127 | Ga0070704_100031805 | 3300005549 | Bacteria | 3553 |
| 128 | Ga0070704_100130483 | 3300005549 | Unclassified | 1947 |
| 129 | Ga0070704_100206782 | 3300005549 | Unclassified | 1588 |
| 130 | Ga0070704_100662055 | 3300005549 | Bacteria | 923 |
| 131 | Ga0070704_100701266 | 3300005549 | Bacteria | 898 |
| 132 | Ga0070704_100988370 | 3300005549 | Bacteria | 761 |
| 133 | Ga0068855_100141000 | 3300005563 | Bacteria | 2748 |
| 134 | Ga0070664_100403298 | 3300005564 | Bacteria | 1251 |
| 135 | Ga0068854_100917123 | 3300005578 | Bacteria | 771 |
| 136 | Ga0068856_100679517 | 3300005614 | Unclassified | 1050 |
| 137 | Ga0070702_100473531 | 3300005615 | Unclassified | 914 |
| 138 | Ga0068852_101250882 | 3300005616 | Bacteria | 764 |
| 139 | Ga0068852_102033183 | 3300005616 | Unclassified | 597 |
| 140 | Ga0068859_100007252 | 3300005617 | Bacteria | 11245 |
| 141 | Ga0068859_100256114 | 3300005617 | Bacteria | 1841 |
| 142 | Ga0068859_100341004 | 3300005617 | Unclassified | 1593 |
| 143 | Ga0068859_100388259 | 3300005617 | Unclassified | 1492 |
| 144 | Ga0068859_100641225 | 3300005617 | Bacteria | 1154 |
| 145 | Ga0068859_101014369 | 3300005617 | Bacteria | 912 |
| 146 | Ga0068859_101412808 | 3300005617 | Unclassified | 768 |
| 147 | Ga0068859_101892345 | 3300005617 | Bacteria | 659 |
| 148 | Ga0068859_101920156 | 3300005617 | Bacteria | 654 |
| 149 | Ga0068859_102661461 | 3300005617 | Bacteria | 550 |
| 150 | Ga0068864_100008563 | 3300005618 | Bacteria | 8442 |
| 151 | Ga0068864_100220254 | 3300005618 | Bacteria | 1751 |
| 152 | Ga0068864_102226010 | 3300005618 | Archaea | 555 |
| 153 | Ga0068866_10094100 | 3300005718 | Bacteria | 1639 |
| 154 | Ga0068866_10223482 | 3300005718 | Bacteria | 1137 |
| 155 | Ga0068866_10232523 | 3300005718 | Bacteria | 1119 |
| 156 | Ga0068866_10322634 | 3300005718 | Bacteria | 972 |
| 157 | Ga0068866_10344498 | 3300005718 | Bacteria | 945 |
| 158 | Ga0068866_11003586 | 3300005718 | Bacteria | 593 |
| 159 | Ga0068861_100014808 | 3300005719 | Bacteria | 5481 |
| 160 | Ga0068861_100375462 | 3300005719 | Bacteria | 1254 |
| 161 | Ga0068861_100656303 | 3300005719 | Bacteria | 970 |
| 162 | Ga0068861_100752572 | 3300005719 | Bacteria | 910 |
| 163 | Ga0068870_10927106 | 3300005840 | Bacteria | 617 |
| 164 | Ga0068863_100011271 | 3300005841 | Bacteria | 8659 |
| 165 | Ga0068863_100767668 | 3300005841 | Bacteria | 960 |
| 166 | Ga0068863_101486205 | 3300005841 | Bacteria | 686 |
| 167 | Ga0068858_100116716 | 3300005842 | Archaea | 2494 |
| 168 | Ga0068858_100127832 | 3300005842 | Bacteria | 2381 |
| 169 | Ga0068858_100245466 | 3300005842 | Bacteria | 1700 |
| 170 | Ga0068858_100466665 | 3300005842 | Bacteria | 1217 |
| 171 | Ga0068858_100797066 | 3300005842 | Bacteria | 922 |
| 172 | Ga0068858_102085652 | 3300005842 | Bacteria | 561 |
| 173 | Ga0068860_100049142 | 3300005843 | Bacteria | 4019 |
| 174 | Ga0068860_100076396 | 3300005843 | Bacteria | 3186 |
| 175 | Ga0068860_100154553 | 3300005843 | Bacteria | 2211 |
| 176 | Ga0068860_100402509 | 3300005843 | Bacteria | 1354 |
| 177 | Ga0068860_100581434 | 3300005843 | Bacteria | 1124 |
| 178 | Ga0068860_100807238 | 3300005843 | Bacteria | 952 |
| 179 | Ga0068860_101234856 | 3300005843 | Unclassified | 768 |
| 180 | Ga0068862_100043489 | 3300005844 | Bacteria | 3830 |
| 181 | Ga0068862_100130187 | 3300005844 | Unclassified | 2225 |
| 182 | Ga0068862_100372530 | 3300005844 | Bacteria | 1330 |
| 183 | Ga0068862_100571967 | 3300005844 | Bacteria | 1081 |
| 184 | Ga0081455_10033163 | 3300005937 | Bacteria | 4644 |
| 185 | Ga0081455_10095237 | 3300005937 | Bacteria | 2403 |
| 186 | Ga0081539_10012200 | 3300005985 | Bacteria | 6668 |
| 187 | Ga0070717_10367399 | 3300006028 | Bacteria | 1289 |
| 188 | Ga0070717_10482438 | 3300006028 | Bacteria | 1119 |
| 189 | Ga0070717_10972207 | 3300006028 | Unclassified | 773 |
| 190 | Ga0075432_10143502 | 3300006058 | Bacteria | 913 |
| 191 | Ga0075432_10265698 | 3300006058 | Bacteria | 701 |
| 192 | Ga0070715_10248955 | 3300006163 | Unclassified | 928 |
| 193 | Ga0070716_100911557 | 3300006173 | Unclassified | 689 |
| 194 | Ga0097621_100006112 | 3300006237 | Bacteria | 8524 |
| 195 | Ga0097621_100009489 | 3300006237 | Bacteria | 7064 |
| 196 | Ga0097621_100012698 | 3300006237 | Bacteria | 6257 |
| 197 | Ga0097621_100023804 | 3300006237 | Unclassified | 4772 |
| 198 | Ga0097621_100027466 | 3300006237 | Bacteria | 4476 |
| 199 | Ga0068871_100002793 | 3300006358 | Bacteria | 11934 |
| 200 | Ga0068871_100003046 | 3300006358 | Bacteria | 11499 |
| 201 | Ga0068871_100007740 | 3300006358 | Bacteria | 7693 |
| 202 | Ga0068871_100012348 | 3300006358 | Bacteria | 6293 |
| 203 | Ga0068871_100438342 | 3300006358 | Bacteria | 1169 |
| 204 | Ga0068871_100506652 | 3300006358 | Bacteria | 1089 |
| 205 | Ga0068871_100561590 | 3300006358 | Bacteria | 1035 |
| 206 | Ga0075428_100117748 | 3300006844 | Bacteria | 2894 |
| 207 | Ga0075428_100148388 | 3300006844 | Bacteria | 2548 |
| 208 | Ga0075428_100455326 | 3300006844 | Bacteria | 1370 |
| 209 | Ga0075431_100092801 | 3300006847 | Bacteria | 3116 |
| 210 | Ga0075431_100369325 | 3300006847 | Archaea | 1440 |
| 211 | Ga0075433_10024699 | 3300006852 | Bacteria | 5075 |
| 212 | Ga0075433_10078981 | 3300006852 | Bacteria | 2899 |
| 213 | Ga0075433_10098176 | 3300006852 | Bacteria | 2593 |
| 214 | Ga0075433_10108884 | 3300006852 | Bacteria | 2458 |
| 215 | Ga0075433_10148238 | 3300006852 | Bacteria | 2086 |
| 216 | Ga0075433_10490583 | 3300006852 | Bacteria | 1082 |
| 217 | Ga0075434_100000776 | 3300006871 | Bacteria | 25295 |
| 218 | Ga0075434_100102251 | 3300006871 | Bacteria | 2873 |
| 219 | Ga0075434_100133145 | 3300006871 | Bacteria | 2505 |
| 220 | Ga0075434_100500448 | 3300006871 | Bacteria | 1236 |
| 221 | Ga0075434_100529729 | 3300006871 | Bacteria | 1198 |
| 222 | Ga0075434_100568177 | 3300006871 | Bacteria | 1153 |
| 223 | Ga0075434_101288614 | 3300006871 | Unclassified | 742 |
| 224 | Ga0075429_100433410 | 3300006880 | Bacteria | 1152 |
| 225 | Ga0075429_100551931 | 3300006880 | Bacteria | 1010 |
| 226 | Ga0075429_100575771 | 3300006880 | Bacteria | 987 |
| 227 | Ga0068865_100005193 | 3300006881 | Bacteria | 7874 |
| 228 | Ga0068865_100153959 | 3300006881 | Bacteria | 1747 |
| 229 | Ga0068865_100399449 | 3300006881 | Bacteria | 1125 |
| 230 | Ga0075436_100001718 | 3300006914 | Bacteria | 14994 |
| 231 | Ga0075436_100035222 | 3300006914 | Bacteria | 3453 |
| 232 | Ga0075436_100068074 | 3300006914 | Bacteria | 2460 |
| 233 | Ga0075436_100082118 | 3300006914 | Bacteria | 2235 |
| 234 | Ga0075436_100186902 | 3300006914 | Bacteria | 1465 |
| 235 | Ga0075436_100386884 | 3300006914 | Unclassified | 1012 |
| 236 | Ga0075436_100923072 | 3300006914 | Unclassified | 653 |
| 237 | Ga0097620_100007252 | 3300006931 | Bacteria | 11245 |
| 238 | Ga0097620_100256122 | 3300006931 | Bacteria | 1841 |
| 239 | Ga0097620_100340988 | 3300006931 | Unclassified | 1593 |
| 240 | Ga0097620_100388233 | 3300006931 | Unclassified | 1492 |
| 241 | Ga0097620_100641198 | 3300006931 | Bacteria | 1154 |
| 242 | Ga0097620_101014319 | 3300006931 | Bacteria | 912 |
| 243 | Ga0097620_101171163 | 3300006931 | Unclassified | 846 |
| 244 | Ga0097620_101412800 | 3300006931 | Unclassified | 768 |
| 245 | Ga0097620_101892456 | 3300006931 | Bacteria | 659 |
| 246 | Ga0097620_101919824 | 3300006931 | Bacteria | 654 |
| 247 | Ga0097620_102659845 | 3300006931 | Bacteria | 550 |
| 248 | Ga0075435_100000189 | 3300007076 | Bacteria | 36888 |
| 249 | Ga0075435_100004108 | 3300007076 | Bacteria | 9977 |
| 250 | Ga0075435_100021273 | 3300007076 | Bacteria | 4986 |
| 251 | Ga0075435_100025175 | 3300007076 | Bacteria | 4629 |
| 252 | Ga0075435_100069738 | 3300007076 | Bacteria | 2867 |
| 253 | Ga0075435_100242264 | 3300007076 | Bacteria | 1534 |
| 254 | Ga0075435_100260423 | 3300007076 | Bacteria | 1478 |
| 255 | Ga0075435_100315623 | 3300007076 | Bacteria | 1337 |
| 256 | Ga0075435_102060320 | 3300007076 | Unclassified | 501 |
| 257 | Ga0105251_10337275 | 3300009011 | Bacteria | 687 |
| 258 | Ga0105240_10007971 | 3300009093 | Bacteria | 15273 |
| 259 | Ga0105240_10040742 | 3300009093 | Bacteria | 5937 |
| 260 | Ga0105240_10162808 | 3300009093 | Bacteria | 2648 |
| 261 | Ga0105240_10612425 | 3300009093 | Bacteria | 1198 |
| 262 | Ga0105240_11429199 | 3300009093 | Unclassified | 727 |
| 263 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 264 | Ga0111539_10001163 | 3300009094 | Bacteria | 34801 |
| 265 | Ga0111539_10041743 | 3300009094 | Bacteria | 5513 |
| 266 | Ga0111539_10877699 | 3300009094 | Unclassified | 1043 |
| 267 | Ga0111539_11553529 | 3300009094 | Bacteria | 767 |
| 268 | Ga0111539_12621075 | 3300009094 | Unclassified | 584 |
| 269 | Ga0105245_10277601 | 3300009098 | Bacteria | 1637 |
| 270 | Ga0105245_10295177 | 3300009098 | Bacteria | 1589 |
| 271 | Ga0105245_10360859 | 3300009098 | Bacteria | 1442 |
| 272 | Ga0105245_10597083 | 3300009098 | Bacteria | 1130 |
| 273 | Ga0105245_10970075 | 3300009098 | Bacteria | 894 |
| 274 | Ga0105245_11323948 | 3300009098 | Bacteria | 769 |
| 275 | Ga0105245_11327211 | 3300009098 | Bacteria | 769 |
| 276 | Ga0105245_12112189 | 3300009098 | Unclassified | 617 |
| 277 | Ga0105247_10035108 | 3300009101 | Archaea | 3055 |
| 278 | Ga0105247_10060281 | 3300009101 | Bacteria | 2351 |
| 279 | Ga0114129_10000304 | 3300009147 | Bacteria | 57173 |
| 280 | Ga0114129_10001441 | 3300009147 | Bacteria | 32078 |
| 281 | Ga0114129_10008836 | 3300009147 | Bacteria | 14376 |
| 282 | Ga0114129_10014923 | 3300009147 | Bacteria | 11068 |
| 283 | Ga0114129_10021549 | 3300009147 | Bacteria | 9148 |
| 284 | Ga0114129_10032236 | 3300009147 | Bacteria | 7406 |
| 285 | Ga0114129_10054047 | 3300009147 | Bacteria | 5632 |
| 286 | Ga0114129_10163513 | 3300009147 | Bacteria | 3039 |
| 287 | Ga0114129_10200874 | 3300009147 | Bacteria | 2700 |
| 288 | Ga0114129_10296085 | 3300009147 | Bacteria | 2158 |
| 289 | Ga0114129_10594551 | 3300009147 | Bacteria | 1434 |
| 290 | Ga0114129_10893496 | 3300009147 | Bacteria | 1126 |
| 291 | Ga0114129_10952269 | 3300009147 | Bacteria | 1084 |
| 292 | Ga0114129_12478354 | 3300009147 | Unclassified | 620 |
| 293 | Ga0114129_12964982 | 3300009147 | Unclassified | 559 |
| 294 | Ga0114129_13016541 | 3300009147 | Bacteria | 553 |
| 295 | Ga0105243_10146032 | 3300009148 | Bacteria | 2023 |
| 296 | Ga0105243_10296654 | 3300009148 | Bacteria | 1463 |
| 297 | Ga0105243_10388504 | 3300009148 | Unclassified | 1293 |
| 298 | Ga0105243_10465088 | 3300009148 | Bacteria | 1190 |
| 299 | Ga0105241_10115966 | 3300009174 | Bacteria | 2150 |
| 300 | Ga0105242_10007403 | 3300009176 | Bacteria | 8452 |
| 301 | Ga0105242_10009179 | 3300009176 | Bacteria | 7591 |
| 302 | Ga0105242_10089248 | 3300009176 | Bacteria | 2591 |
| 303 | Ga0105242_10565662 | 3300009176 | Bacteria | 1092 |
| 304 | Ga0105242_10585879 | 3300009176 | Bacteria | 1075 |
| 305 | Ga0105242_10640830 | 3300009176 | Bacteria | 1032 |
| 306 | Ga0105242_10893161 | 3300009176 | Bacteria | 888 |
| 307 | Ga0105242_10905622 | 3300009176 | Unclassified | 882 |
| 308 | Ga0105242_11398436 | 3300009176 | Unclassified | 727 |
| 309 | Ga0105248_10040761 | 3300009177 | Bacteria | 5205 |
| 310 | Ga0105248_10048968 | 3300009177 | Bacteria | 4740 |
| 311 | Ga0105248_10069671 | 3300009177 | Bacteria | 3949 |
| 312 | Ga0105248_10080366 | 3300009177 | Bacteria | 3664 |
| 313 | Ga0105248_10099960 | 3300009177 | Bacteria | 3268 |
| 314 | Ga0105248_10302070 | 3300009177 | Bacteria | 1802 |
| 315 | Ga0105248_11244520 | 3300009177 | Unclassified | 842 |
| 316 | Ga0105248_11357468 | 3300009177 | Bacteria | 804 |
| 317 | Ga0105248_12134615 | 3300009177 | Bacteria | 637 |
| 318 | Ga0105248_12260191 | 3300009177 | Bacteria | 619 |
| 319 | Ga0105237_10199846 | 3300009545 | Bacteria | 1998 |
| 320 | Ga0105238_10508750 | 3300009551 | Bacteria | 1206 |
| 321 | Ga0105238_11551387 | 3300009551 | Bacteria | 692 |
| 322 | Ga0105249_10058904 | 3300009553 | Bacteria | 3522 |
| 323 | Ga0105249_10843395 | 3300009553 | Bacteria | 982 |
| 324 | Ga0105249_10892409 | 3300009553 | Bacteria | 956 |
| 325 | Ga0105249_12157448 | 3300009553 | Unclassified | 630 |
| 326 | Ga0105239_10760707 | 3300010375 | Bacteria | 1109 |
| 327 | Ga0105246_10322115 | 3300011119 | Bacteria | 1256 |
| 328 | Ga0105246_10384715 | 3300011119 | Bacteria | 1160 |
| 329 | Ga0105246_11232811 | 3300011119 | Archaea | 690 |
| 330 | Ga0157328_1018368 | 3300012478 | Unclassified | 567 |
| 331 | Ga0157370_11042514 | 3300013104 | Bacteria | 740 |
| 332 | Ga0157374_10040325 | 3300013296 | Bacteria | 4299 |
| 333 | Ga0157374_10257291 | 3300013296 | Unclassified | 1719 |
| 334 | Ga0157374_10619609 | 3300013296 | Bacteria | 1093 |
| 335 | Ga0157374_11185322 | 3300013296 | Bacteria | 785 |
| 336 | Ga0157378_10090322 | 3300013297 | Bacteria | 2783 |
| 337 | Ga0157378_10131912 | 3300013297 | Bacteria | 2314 |
| 338 | Ga0157378_11735819 | 3300013297 | Bacteria | 672 |
| 339 | Ga0157378_13024023 | 3300013297 | Bacteria | 522 |
| 340 | Ga0163162_10049261 | 3300013306 | Bacteria | 4222 |
| 341 | Ga0163162_10155039 | 3300013306 | Bacteria | 2410 |
| 342 | Ga0163162_10999959 | 3300013306 | Bacteria | 945 |
| 343 | Ga0163162_11154335 | 3300013306 | Bacteria | 878 |
| 344 | Ga0163162_11573505 | 3300013306 | Bacteria | 749 |
| 345 | Ga0163162_12545413 | 3300013306 | Bacteria | 589 |
| 346 | Ga0163162_13473214 | 3300013306 | Bacteria | 502 |
| 347 | Ga0157372_11208997 | 3300013307 | Unclassified | 873 |
| 348 | Ga0157375_10032644 | 3300013308 | Bacteria | 4939 |
| 349 | Ga0157375_10142643 | 3300013308 | Unclassified | 2523 |
| 350 | Ga0157375_10756113 | 3300013308 | Bacteria | 1123 |
| 351 | Ga0157375_10797951 | 3300013308 | Bacteria | 1093 |
| 352 | Ga0157375_11076476 | 3300013308 | Bacteria | 940 |
| 353 | Ga0157375_11447046 | 3300013308 | Bacteria | 810 |
| 354 | Ga0163163_10178821 | 3300014325 | Bacteria | 2168 |
| 355 | Ga0163163_10523579 | 3300014325 | Bacteria | 1248 |
| 356 | Ga0157380_10143390 | 3300014326 | Unclassified | 2055 |
| 357 | Ga0157380_10507128 | 3300014326 | Bacteria | 1173 |
| 358 | Ga0157380_10686266 | 3300014326 | Unclassified | 1027 |
| 359 | Ga0157380_10715163 | 3300014326 | Bacteria | 1008 |
| 360 | Ga0157380_11308939 | 3300014326 | Bacteria | 772 |
| 361 | Ga0157380_11343240 | 3300014326 | Bacteria | 763 |
| 362 | Ga0157377_10034898 | 3300014745 | Bacteria | 2754 |
| 363 | Ga0157377_10365622 | 3300014745 | Bacteria | 972 |
| 364 | Ga0157377_10724071 | 3300014745 | Bacteria | 725 |
| 365 | Ga0157379_10010988 | 3300014968 | Bacteria | 7895 |
| 366 | Ga0157379_10025920 | 3300014968 | Bacteria | 5213 |
| 367 | Ga0157379_10962878 | 3300014968 | Bacteria | 812 |
| 368 | Ga0157379_11184895 | 3300014968 | Unclassified | 734 |
| 369 | Ga0157379_11296613 | 3300014968 | Bacteria | 703 |
| 370 | Ga0157379_11793903 | 3300014968 | Unclassified | 603 |
| 371 | Ga0157376_10012899 | 3300014969 | Bacteria | 6218 |
| 372 | Ga0157376_10086880 | 3300014969 | Unclassified | 2697 |
| 373 | Ga0157376_10111594 | 3300014969 | Bacteria | 2408 |
| 374 | Ga0157376_10424767 | 3300014969 | Bacteria | 1291 |
| 375 | Ga0157376_10525221 | 3300014969 | Bacteria | 1167 |
| 376 | Ga0157376_10600664 | 3300014969 | Bacteria | 1095 |
| 377 | Ga0157376_10733139 | 3300014969 | Unclassified | 996 |
| 378 | Ga0163161_10221081 | 3300017792 | Bacteria | 1466 |
| 379 | Ga0163161_11436934 | 3300017792 | Bacteria | 603 |
| 380 | Ga0207656_10204214 | 3300025321 | Unclassified | 955 |
| 381 | Ga0207682_10173766 | 3300025893 | Bacteria | 981 |
| 382 | Ga0207642_10177406 | 3300025899 | Bacteria | 1158 |
| 383 | Ga0207642_10258513 | 3300025899 | Bacteria | 992 |
| 384 | Ga0207642_10370264 | 3300025899 | Bacteria | 850 |
| 385 | Ga0207642_10422692 | 3300025899 | Unclassified | 802 |
| 386 | Ga0207642_10581084 | 3300025899 | Bacteria | 695 |
| 387 | Ga0207710_10036542 | 3300025900 | Bacteria | 2166 |
| 388 | Ga0207710_10178965 | 3300025900 | Unclassified | 1040 |
| 389 | Ga0207688_10264745 | 3300025901 | Bacteria | 1044 |
| 390 | Ga0207688_10839974 | 3300025901 | Bacteria | 582 |
| 391 | Ga0207680_10101420 | 3300025903 | Bacteria | 1850 |
| 392 | Ga0207680_10159962 | 3300025903 | Bacteria | 1509 |
| 393 | Ga0207680_10183012 | 3300025903 | Bacteria | 1418 |
| 394 | Ga0207680_10386207 | 3300025903 | Bacteria | 988 |
| 395 | Ga0207685_10592085 | 3300025905 | Bacteria | 594 |
| 396 | Ga0207699_10059499 | 3300025906 | Bacteria | 2290 |
| 397 | Ga0207699_10504311 | 3300025906 | Bacteria | 874 |
| 398 | Ga0207645_10067485 | 3300025907 | Bacteria | 2286 |
| 399 | Ga0207645_10256823 | 3300025907 | Bacteria | 1157 |
| 400 | Ga0207705_10088924 | 3300025909 | Bacteria | 2260 |
| 401 | Ga0207684_10283973 | 3300025910 | Bacteria | 1427 |
| 402 | Ga0207684_10369012 | 3300025910 | Bacteria | 1235 |
| 403 | Ga0207684_10433462 | 3300025910 | Bacteria | 1129 |
| 404 | Ga0207707_10080438 | 3300025912 | Bacteria | 2846 |
| 405 | Ga0207707_10391360 | 3300025912 | Bacteria | 1194 |
| 406 | Ga0207695_10062269 | 3300025913 | Bacteria | 3852 |
| 407 | Ga0207695_10063368 | 3300025913 | Bacteria | 3812 |
| 408 | Ga0207695_10570565 | 3300025913 | Bacteria | 1013 |
| 409 | Ga0207671_10168089 | 3300025914 | Bacteria | 1701 |
| 410 | Ga0207660_10142932 | 3300025917 | Bacteria | 1831 |
| 411 | Ga0207660_11246153 | 3300025917 | Unclassified | 605 |
| 412 | Ga0207662_10057610 | 3300025918 | Bacteria | 2322 |
| 413 | Ga0207662_10158413 | 3300025918 | Bacteria | 1445 |
| 414 | Ga0207657_10006081 | 3300025919 | Bacteria | 12554 |
| 415 | Ga0207657_10601530 | 3300025919 | Bacteria | 858 |
| 416 | Ga0207652_10048088 | 3300025921 | Bacteria | 3645 |
| 417 | Ga0207652_10400588 | 3300025921 | Bacteria | 1238 |
| 418 | Ga0207646_10333229 | 3300025922 | Bacteria | 1371 |
| 419 | Ga0207646_10432425 | 3300025922 | Unclassified | 1188 |
| 420 | Ga0207646_10511335 | 3300025922 | Bacteria | 1082 |
| 421 | Ga0207646_10711523 | 3300025922 | Bacteria | 898 |
| 422 | Ga0207646_11314866 | 3300025922 | Bacteria | 631 |
| 423 | Ga0207681_10089928 | 3300025923 | Unclassified | 2190 |
| 424 | Ga0207681_10345390 | 3300025923 | Bacteria | 1190 |
| 425 | Ga0207681_10939831 | 3300025923 | Bacteria | 725 |
| 426 | Ga0207681_11129313 | 3300025923 | Unclassified | 658 |
| 427 | Ga0207681_11641385 | 3300025923 | Unclassified | 538 |
| 428 | Ga0207694_10220033 | 3300025924 | Bacteria | 1548 |
| 429 | Ga0207650_10297249 | 3300025925 | Bacteria | 1318 |
| 430 | Ga0207650_10765489 | 3300025925 | Bacteria | 817 |
| 431 | Ga0207659_10000637 | 3300025926 | Bacteria | 20834 |
| 432 | Ga0207659_10165352 | 3300025926 | Bacteria | 1741 |
| 433 | Ga0207659_10300931 | 3300025926 | Bacteria | 1317 |
| 434 | Ga0207659_10396980 | 3300025926 | Bacteria | 1153 |
| 435 | Ga0207687_10088125 | 3300025927 | Bacteria | 2257 |
| 436 | Ga0207687_10745116 | 3300025927 | Bacteria | 833 |
| 437 | Ga0207687_10812495 | 3300025927 | Bacteria | 798 |
| 438 | Ga0207700_11530832 | 3300025928 | Unclassified | 591 |
| 439 | Ga0207664_10182318 | 3300025929 | Bacteria | 1803 |
| 440 | Ga0207644_10006773 | 3300025931 | Bacteria | 7466 |
| 441 | Ga0207644_10467038 | 3300025931 | Bacteria | 1038 |
| 442 | Ga0207706_10077394 | 3300025933 | Bacteria | 2925 |
| 443 | Ga0207706_10170600 | 3300025933 | Bacteria | 1912 |
| 444 | Ga0207706_10294293 | 3300025933 | Bacteria | 1415 |
| 445 | Ga0207706_10477703 | 3300025933 | Bacteria | 1077 |
| 446 | Ga0207706_10654566 | 3300025933 | Bacteria | 899 |
| 447 | Ga0207706_10790302 | 3300025933 | Bacteria | 807 |
| 448 | Ga0207686_10057789 | 3300025934 | Bacteria | 2443 |
| 449 | Ga0207686_10087097 | 3300025934 | Bacteria | 2053 |
| 450 | Ga0207686_10489239 | 3300025934 | Bacteria | 953 |
| 451 | Ga0207686_10739682 | 3300025934 | Bacteria | 784 |
| 452 | Ga0207709_10071590 | 3300025935 | Archaea | 2202 |
| 453 | Ga0207709_10391646 | 3300025935 | Bacteria | 1060 |
| 454 | Ga0207670_10576900 | 3300025936 | Unclassified | 921 |
| 455 | Ga0207670_10750858 | 3300025936 | Bacteria | 810 |
| 456 | Ga0207669_10099901 | 3300025937 | Bacteria | 1915 |
| 457 | Ga0207669_10138763 | 3300025937 | Bacteria | 1684 |
| 458 | Ga0207669_10237005 | 3300025937 | Bacteria | 1350 |
| 459 | Ga0207669_10290965 | 3300025937 | Bacteria | 1237 |
| 460 | Ga0207669_10565564 | 3300025937 | Bacteria | 919 |
| 461 | Ga0207669_10924318 | 3300025937 | Unclassified | 730 |
| 462 | Ga0207669_11052373 | 3300025937 | Bacteria | 685 |
| 463 | Ga0207704_10075233 | 3300025938 | Bacteria | 2158 |
| 464 | Ga0207704_10578764 | 3300025938 | Bacteria | 916 |
| 465 | Ga0207704_10717944 | 3300025938 | Unclassified | 829 |
| 466 | Ga0207704_11130190 | 3300025938 | Bacteria | 666 |
| 467 | Ga0207691_10019546 | 3300025940 | Bacteria | 6408 |
| 468 | Ga0207691_10025756 | 3300025940 | Bacteria | 5520 |
| 469 | Ga0207691_10424004 | 3300025940 | Bacteria | 1133 |
| 470 | Ga0207691_10460108 | 3300025940 | Bacteria | 1082 |
| 471 | Ga0207691_10523565 | 3300025940 | Bacteria | 1006 |
| 472 | Ga0207691_10773407 | 3300025940 | Bacteria | 808 |
| 473 | Ga0207711_10026730 | 3300025941 | Bacteria | 4845 |
| 474 | Ga0207711_10032038 | 3300025941 | Bacteria | 4442 |
| 475 | Ga0207711_10045130 | 3300025941 | Bacteria | 3766 |
| 476 | Ga0207711_10094262 | 3300025941 | Bacteria | 2638 |
| 477 | Ga0207711_10128602 | 3300025941 | Bacteria | 2268 |
| 478 | Ga0207711_10286243 | 3300025941 | Bacteria | 1518 |
| 479 | Ga0207711_10684874 | 3300025941 | Bacteria | 956 |
| 480 | Ga0207689_10230024 | 3300025942 | Bacteria | 1532 |
| 481 | Ga0207689_10383580 | 3300025942 | Bacteria | 1170 |
| 482 | Ga0207689_10552672 | 3300025942 | Unclassified | 967 |
| 483 | Ga0207689_10653785 | 3300025942 | Bacteria | 886 |
| 484 | Ga0207661_10972814 | 3300025944 | Bacteria | 782 |
| 485 | Ga0207679_10071806 | 3300025945 | Bacteria | 2612 |
| 486 | Ga0207679_10212907 | 3300025945 | Bacteria | 1622 |
| 487 | Ga0207679_10976976 | 3300025945 | Bacteria | 776 |
| 488 | Ga0207667_10336673 | 3300025949 | Bacteria | 1540 |
| 489 | Ga0207651_10056250 | 3300025960 | Bacteria | 2706 |
| 490 | Ga0207651_10260993 | 3300025960 | Bacteria | 1422 |
| 491 | Ga0207651_10399417 | 3300025960 | Bacteria | 1169 |
| 492 | Ga0207651_10785291 | 3300025960 | Bacteria | 843 |
| 493 | Ga0207651_10921709 | 3300025960 | Bacteria | 779 |
| 494 | Ga0207651_11486750 | 3300025960 | Bacteria | 610 |
| 495 | Ga0207651_11536133 | 3300025960 | Bacteria | 600 |
| 496 | Ga0207712_10415008 | 3300025961 | Bacteria | 1134 |
| 497 | Ga0207712_10554786 | 3300025961 | Bacteria | 989 |
| 498 | Ga0207712_10710531 | 3300025961 | Bacteria | 878 |
| 499 | Ga0207712_12073488 | 3300025961 | Unclassified | 509 |
| 500 | Ga0207668_10241805 | 3300025972 | Bacteria | 1461 |
| 501 | Ga0207668_10657224 | 3300025972 | Bacteria | 918 |
| 502 | Ga0207668_10695391 | 3300025972 | Bacteria | 893 |
| 503 | Ga0207640_10032202 | 3300025981 | Bacteria | 3249 |
| 504 | Ga0207640_10310768 | 3300025981 | Bacteria | 1251 |
| 505 | Ga0207640_11470412 | 3300025981 | Bacteria | 612 |
| 506 | Ga0207658_10047007 | 3300025986 | Bacteria | 3156 |
| 507 | Ga0207658_10047326 | 3300025986 | Bacteria | 3147 |
| 508 | Ga0207677_10026731 | 3300026023 | Bacteria | 3624 |
| 509 | Ga0207677_10139859 | 3300026023 | Bacteria | 1852 |
| 510 | Ga0207677_10309145 | 3300026023 | Bacteria | 1309 |
| 511 | Ga0207677_10391125 | 3300026023 | Bacteria | 1176 |
| 512 | Ga0207677_10672825 | 3300026023 | Bacteria | 916 |
| 513 | Ga0207677_11517129 | 3300026023 | Bacteria | 619 |
| 514 | Ga0207703_10080790 | 3300026035 | Archaea | 2708 |
| 515 | Ga0207703_10213043 | 3300026035 | Bacteria | 1723 |
| 516 | Ga0207703_10650301 | 3300026035 | Unclassified | 1000 |
| 517 | Ga0207703_10733969 | 3300026035 | Bacteria | 940 |
| 518 | Ga0207703_10805945 | 3300026035 | Bacteria | 897 |
| 519 | Ga0207703_10993421 | 3300026035 | Bacteria | 805 |
| 520 | Ga0207703_12215109 | 3300026035 | Unclassified | 525 |
| 521 | Ga0207639_10313539 | 3300026041 | Unclassified | 1390 |
| 522 | Ga0207708_10014526 | 3300026075 | Bacteria | 5893 |
| 523 | Ga0207708_10912844 | 3300026075 | Unclassified | 760 |
| 524 | Ga0207702_10604977 | 3300026078 | Unclassified | 1076 |
| 525 | Ga0207641_10001439 | 3300026088 | Bacteria | 23394 |
| 526 | Ga0207641_10860684 | 3300026088 | Bacteria | 899 |
| 527 | Ga0207641_12058910 | 3300026088 | Bacteria | 572 |
| 528 | Ga0207648_10044459 | 3300026089 | Bacteria | 3896 |
| 529 | Ga0207648_10045180 | 3300026089 | Bacteria | 3864 |
| 530 | Ga0207648_10267230 | 3300026089 | Bacteria | 1527 |
| 531 | Ga0207648_10303051 | 3300026089 | Bacteria | 1433 |
| 532 | Ga0207648_11849341 | 3300026089 | Bacteria | 565 |
| 533 | Ga0207676_10064447 | 3300026095 | Bacteria | 2914 |
| 534 | Ga0207676_10181317 | 3300026095 | Bacteria | 1844 |
| 535 | Ga0207675_100048362 | 3300026118 | Bacteria | 3970 |
| 536 | Ga0207675_100275600 | 3300026118 | Bacteria | 1633 |
| 537 | Ga0207675_100387325 | 3300026118 | Bacteria | 1375 |
| 538 | Ga0207675_100621867 | 3300026118 | Bacteria | 1084 |
| 539 | Ga0207675_102098936 | 3300026118 | Unclassified | 582 |
| 540 | Ga0207675_102204307 | 3300026118 | Bacteria | 566 |
| 541 | Ga0207683_10106566 | 3300026121 | Bacteria | 2506 |
| 542 | Ga0207683_10138777 | 3300026121 | Bacteria | 2189 |
| 543 | Ga0207683_10500067 | 3300026121 | Bacteria | 1123 |
| 544 | Ga0207683_10713573 | 3300026121 | Bacteria | 930 |
| 545 | Ga0207683_11105561 | 3300026121 | Bacteria | 735 |
| 546 | Ga0207683_11393168 | 3300026121 | Bacteria | 648 |
| 547 | Ga0207698_10911727 | 3300026142 | Bacteria | 886 |
| 548 | Ga0207698_11602920 | 3300026142 | Unclassified | 666 |
| 549 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 550 | Ga0207428_10037252 | 3300027907 | Bacteria | 3958 |
| 551 | Ga0207428_10917606 | 3300027907 | Bacteria | 618 |
| 552 | Ga0268266_10019305 | 3300028379 | Bacteria | 5806 |
| 553 | Ga0268266_10118962 | 3300028379 | Bacteria | 2349 |
| 554 | Ga0268266_10701308 | 3300028379 | Bacteria | 975 |
| 555 | Ga0268265_10112247 | 3300028380 | Unclassified | 2228 |
| 556 | Ga0268265_10168612 | 3300028380 | Bacteria | 1868 |
| 557 | Ga0268265_10187836 | 3300028380 | Bacteria | 1782 |
| 558 | Ga0268265_10460791 | 3300028380 | Bacteria | 1189 |
| 559 | Ga0268265_10978488 | 3300028380 | Bacteria | 835 |
| 560 | Ga0268265_11596331 | 3300028380 | Unclassified | 657 |
| 561 | Ga0268264_10153392 | 3300028381 | Bacteria | 2068 |
| 562 | Ga0268264_10339737 | 3300028381 | Bacteria | 1426 |
| 563 | Ga0268264_10429873 | 3300028381 | Bacteria | 1275 |
| 564 | Ga0268264_10697811 | 3300028381 | Bacteria | 1008 |
| 565 | Ga0268264_10762872 | 3300028381 | Bacteria | 964 |
| 566 | Ga0268264_11069935 | 3300028381 | Bacteria | 814 |
| 567 | Ga0268264_11256535 | 3300028381 | Bacteria | 750 |
| 568 | Ga0268264_11544979 | 3300028381 | Bacteria | 674 |
| 569 | Ga0268264_11567202 | 3300028381 | Unclassified | 669 |
| 570 | Ga0265330_10183302 | 3300031235 | Bacteria | 887 |
| 571 | Ga0307408_101282512 | 3300031548 | Bacteria | 686 |
| 572 | Ga0307408_101326310 | 3300031548 | Bacteria | 675 |
| 573 | Ga0307408_101910592 | 3300031548 | Unclassified | 569 |
| 574 | Ga0265314_10262607 | 3300031711 | Bacteria | 985 |
| 575 | Ga0307406_11396297 | 3300031901 | Bacteria | 614 |
| 576 | Ga0307407_11321949 | 3300031903 | Bacteria | 566 |
| 577 | Ga0307412_10794267 | 3300031911 | Bacteria | 821 |
| 578 | Ga0307412_11676121 | 3300031911 | Bacteria | 582 |
| 579 | Ga0307409_100402933 | 3300031995 | Bacteria | 1307 |
| 580 | Ga0307416_100438744 | 3300032002 | Unclassified | 1355 |
| 581 | Ga0373930_0000245 | 3300034816 | Bacteria | 6897 |
| 582 | Ga0373948_0028959 | 3300034817 | Bacteria | 1105 |
| 583 | Ga0373950_0002004 | 3300034818 | Bacteria | 2752 |
| 584 | Ga0373959_0000405 | 3300034820 | Bacteria | 8377 |
| 585 | Ga0373938_0005187 | 3300034957 | Bacteria | 2207 |
| 586 | Ga0373928_0002313 | 3300035084 | Bacteria | 3703 |
| 587 | Ga0373929_0014335 | 3300035085 | Unclassified | 1530 |
| 588 | Ga0373929_0088576 | 3300035085 | Unclassified | 764 |
| 589 | Ga0373934_0287715 | 3300035086 | Bacteria | 681 |
| 590 | Ga0373940_0021100 | 3300035088 | Bacteria | 1661 |
| 591 | Ga0373949_0003515 | 3300035090 | Bacteria | 3710 |
| 592 | Ga0373951_0000437 | 3300035091 | Bacteria | 12172 |
| 593 | Ga0373952_0019680 | 3300035092 | Bacteria | 1408 |
| 594 | Ga0373923_0293796 | 3300035111 | Unclassified | 768 |
| 595 | Ga0373932_0014002 | 3300035112 | Unclassified | 2008 |
| 596 | Ga0373932_0142400 | 3300035112 | Unclassified | 816 |
| 597 | Ga0373932_0438474 | 3300035112 | Unclassified | 511 |
| 598 | Ga0373939_0001301 | 3300035114 | Bacteria | 6061 |
| 599 | Ga0373941_0013444 | 3300035115 | Bacteria | 2164 |
| 600 | Ga0373941_0015421 | 3300035115 | Bacteria | 2060 |
| 601 | Ga0373941_0144295 | 3300035115 | Unclassified | 868 |
| 602 | Ga0373945_0044414 | 3300035116 | Bacteria | 1616 |
| 603 | Ga0373953_0126978 | 3300035117 | Bacteria | 1086 |
| 604 | Ga0373956_0166493 | 3300035119 | Unclassified | 1040 |
| 605 | Ga0373957_0339783 | 3300035120 | Unclassified | 640 |
| 606 | Ga0373960_0004257 | 3300035121 | Bacteria | 3268 |
| 607 | Ga0373943_0342927 | 3300035170 | Unclassified | 855 |
| 608 | Ga0373943_0486564 | 3300035170 | Bacteria | 720 |
| 609 | Ga0373946_0179247 | 3300035171 | Bacteria | 1005 |
| 610 | Ga0373955_0044020 | 3300035172 | Archaea | 2403 |
| 611 | Ga0373955_0096801 | 3300035172 | Bacteria | 1689 |
| 612 | Ga0373955_0106148 | 3300035172 | Unclassified | 1619 |
| 613 | Ga0373942_0018432 | 3300035207 | Unclassified | 1732 |
| 614 | Ga0373942_0048593 | 3300035207 | Unclassified | 1182 |
| 615 | Ga0373961_0005744 | 3300035241 | Bacteria | 2977 |
| 616 | Ga0373962_0036497 | 3300035242 | Unclassified | 1368 |
| 617 | Ga0373931_0076384 | 3300035691 | Bacteria | 1840 |
| 618 | Ga0373935_0993189 | 3300035692 | Bacteria | 623 |
| 619 | Ga0373935_1091961 | 3300035692 | Bacteria | 594 |
| 620 | Ga0373933_0182731 | 3300035724 | Bacteria | 1338 |
| 621 | Ga0373933_0437136 | 3300035724 | Bacteria | 855 |
| 622 | Ga0373947_0088685 | 3300035725 | Unclassified | 1926 |
| 623 | Ga0373937_0151733 | 3300036401 | Unclassified | 2171 |
| 624 | Ga0373937_0472667 | 3300036401 | Bacteria | 1191 |
| 625 | Ga0373937_0562246 | 3300036401 | Bacteria | 1083 |
| 626 | Ga0373937_0629949 | 3300036401 | Bacteria | 1018 |
| 627 | Ga0373937_0762680 | 3300036401 | Bacteria | 915 |
| 628 | Ga0373937_0801211 | 3300036401 | Unclassified | 890 |
| 629 | Ga0373925_1365082 | 3300037068 | Bacteria | 581 |
| 630 | Ga0373925_1685848 | 3300037068 | Unclassified | 518 |
| 631 | Ga0395898_1248308 | 3300037466 | Bacteria | 673 |
| 632 | Ga0439435_0182494 | 3300042436 | Unclassified | 686 |
| 633 | Ga0466963_0203622 | 3300044694 | Bacteria | 1384 |
| 634 | Ga0466963_0580345 | 3300044694 | Bacteria | 792 |
| 635 | Ga0451576_0042753 | 3300045051 | Bacteria | 4784 |
| 636 | Ga0451576_0289395 | 3300045051 | Bacteria | 1713 |
| 637 | Ga0451576_0562465 | 3300045051 | Bacteria | 1198 |
| 638 | Ga0466967_0304786 | 3300045976 | Bacteria | 1533 |
| 639 | Ga0466967_0312203 | 3300045976 | Bacteria | 1515 |
| 640 | Ga0466967_1257198 | 3300045976 | Unclassified | 737 |
| 641 | Ga0495592_0770343 | 3300046454 | Unclassified | 574 |
| 642 | Ga0495603_0147776 | 3300046455 | Bacteria | 1366 |
| 643 | Ga0495629_0255721 | 3300046459 | Bacteria | 1204 |
| 644 | Ga0495629_0482684 | 3300046459 | Bacteria | 837 |
| 645 | Ga0495651_0191693 | 3300046462 | Bacteria | 1438 |
| 646 | Ga0495651_0330708 | 3300046462 | Archaea | 1013 |
| 647 | Ga0495653_0146527 | 3300046463 | Bacteria | 1654 |
| 648 | Ga0495653_0630818 | 3300046463 | Bacteria | 656 |
| 649 | Ga0495580_0213366 | 3300046472 | Unclassified | 1328 |
| 650 | Ga0495639_0128359 | 3300046475 | Bacteria | 1213 |
| 651 | Ga0495594_0254331 | 3300046499 | Bacteria | 1001 |
| 652 | Ga0495594_0784483 | 3300046499 | Unclassified | 537 |
| 653 | Ga0495628_0071470 | 3300046516 | Archaea | 2705 |
| 654 | Ga0495630_0251315 | 3300046517 | Archaea | 1351 |
| 655 | Ga0495630_1398987 | 3300046517 | Bacteria | 526 |
| 656 | Ga0495644_0355806 | 3300046523 | Unclassified | 577 |
| 657 | Ga0495642_0260238 | 3300046528 | Bacteria | 759 |
| 658 | Ga0495640_0213548 | 3300046533 | Bacteria | 1219 |
| 659 | Ga0495586_0128973 | 3300046535 | Archaea | 1416 |
| 660 | Ga0495587_0195115 | 3300046536 | Bacteria | 1146 |
| 661 | Ga0495645_0056749 | 3300046543 | Bacteria | 2843 |
| 662 | Ga0495633_0148457 | 3300046558 | Unclassified | 1083 |
| 663 | Ga0495633_0280466 | 3300046558 | Bacteria | 758 |
| 664 | Ga0495656_0248450 | 3300046615 | Bacteria | 898 |
| 665 | Ga0495656_0688845 | 3300046615 | Bacteria | 550 |
| 666 | Ga0495634_0335269 | 3300046642 | Bacteria | 908 |
| 667 | Ga0495635_0438884 | 3300046663 | Bacteria | 864 |
| 668 | Ga0495599_0140783 | 3300046678 | Bacteria | 1497 |
| 669 | Ga0495599_0216914 | 3300046678 | Unclassified | 1172 |
| 670 | Ga0495646_0499508 | 3300046680 | Unclassified | 625 |
| 671 | Ga0495647_0044598 | 3300046681 | Bacteria | 1701 |
| 672 | Ga0495647_0206657 | 3300046681 | Unclassified | 863 |
| 673 | Ga0495647_0284674 | 3300046681 | Bacteria | 742 |
| 674 | Ga0495658_0040389 | 3300046683 | Unclassified | 2594 |
| 675 | Ga0495658_0096197 | 3300046683 | Unclassified | 1761 |
| 676 | Ga0495658_0163528 | 3300046683 | Bacteria | 1374 |
| 677 | Ga0495658_0275711 | 3300046683 | Bacteria | 1061 |
| 678 | Ga0495658_0486185 | 3300046683 | Bacteria | 789 |
| 679 | Ga0495669_0007102 | 3300046684 | Bacteria | 4691 |
| 680 | Ga0495669_0074307 | 3300046684 | Bacteria | 1554 |
| 681 | Ga0495669_0177199 | 3300046684 | Unclassified | 1015 |
| 682 | Ga0495613_0394148 | 3300046689 | Bacteria | 945 |
| 683 | Ga0495670_0315638 | 3300046691 | Unclassified | 839 |
| 684 | Ga0495600_0078259 | 3300046809 | Bacteria | 2160 |
| 685 | Ga0495581_0500155 | 3300047315 | Unclassified | 707 |
| 686 | Ga0495604_0874802 | 3300047317 | Unclassified | 563 |
| 687 | Ga0495674_0975457 | 3300047319 | Bacteria | 651 |
| 688 | Ga0495672_0413162 | 3300047320 | Bacteria | 615 |
| 689 | Ga0495680_0864358 | 3300047322 | Bacteria | 587 |
| 690 | Ga0495684_0921757 | 3300047471 | Unclassified | 561 |
| 691 | Ga0496101_0006384 | 3300048904 | Bacteria | 7587 |
| 692 | Ga0496101_0655154 | 3300048904 | Bacteria | 830 |
| 693 | Ga0496101_1102776 | 3300048904 | Unclassified | 623 |
| 694 | Ga0496102_0071174 | 3300048905 | Bacteria | 3193 |
| 695 | Ga0496102_0486300 | 3300048905 | Bacteria | 1156 |
| 696 | Ga0496102_1857583 | 3300048905 | Bacteria | 519 |
| 697 | Ga0496104_0111424 | 3300048907 | Bacteria | 2624 |
| 698 | Ga0496104_0154789 | 3300048907 | Bacteria | 2200 |
| 699 | Ga0496104_0193126 | 3300048907 | Bacteria | 1948 |
| 700 | Ga0496104_0241441 | 3300048907 | Bacteria | 1719 |
| 701 | Ga0496105_0114560 | 3300048908 | Bacteria | 2224 |
| 702 | Ga0496105_0202098 | 3300048908 | Bacteria | 1622 |
| 703 | Ga0496105_0562400 | 3300048908 | Bacteria | 889 |
| 704 | Ga0496105_0748066 | 3300048908 | Bacteria | 747 |
| 705 | Ga0496105_1346145 | 3300048908 | Unclassified | 519 |
| 706 | Ga0496106_0320006 | 3300048909 | Bacteria | 1245 |
| 707 | Ga0496106_0954131 | 3300048909 | Unclassified | 676 |
| 708 | Ga0496106_0984749 | 3300048909 | Unclassified | 664 |
| 709 | Ga0496107_0228327 | 3300048910 | Bacteria | 1385 |
| 710 | Ga0496107_0495879 | 3300048910 | Bacteria | 906 |
| 711 | Ga0496107_0576562 | 3300048910 | Bacteria | 832 |
| 712 | Ga0496107_1280440 | 3300048910 | Unclassified | 525 |
| 713 | Ga0496108_0023039 | 3300048911 | Bacteria | 5123 |
| 714 | Ga0496108_0788156 | 3300048911 | Bacteria | 820 |
| 715 | Ga0496108_1451490 | 3300048911 | Bacteria | 572 |
| 716 | Ga0496108_1513853 | 3300048911 | Unclassified | 558 |
| 717 | Ga0496109_0106622 | 3300048912 | Bacteria | 2603 |
| 718 | Ga0496109_0412495 | 3300048912 | Bacteria | 1276 |
| 719 | Ga0496109_1514171 | 3300048912 | Bacteria | 606 |
| 720 | Ga0496110_0799479 | 3300048913 | Bacteria | 847 |
| 721 | Ga0496110_1782646 | 3300048913 | Bacteria | 526 |
| 722 | Ga0496112_0050925 | 3300048915 | Bacteria | 4061 |
| 723 | Ga0496112_0118215 | 3300048915 | Bacteria | 2621 |
| 724 | Ga0496112_0974937 | 3300048915 | Bacteria | 768 |
| 725 | Ga0496112_1084914 | 3300048915 | Bacteria | 719 |
| 726 | Ga0496112_1728411 | 3300048915 | Unclassified | 538 |
| 727 | Ga0496112_1832169 | 3300048915 | Unclassified | 519 |
| 728 | Ga0496113_0032383 | 3300048916 | Bacteria | 3800 |
| 729 | Ga0496113_1497134 | 3300048916 | Unclassified | 521 |
| 730 | Ga0496114_0000233 | 3300048917 | Bacteria | 40546 |
| 731 | Ga0496114_0339497 | 3300048917 | Bacteria | 1328 |
| 732 | Ga0496114_1707900 | 3300048917 | Unclassified | 518 |
| 733 | Ga0496115_0039023 | 3300048918 | Unclassified | 3771 |
| 734 | Ga0501033_1001729 | 3300049570 | Unclassified | 558 |
| 735 | Ga0501036_0113960 | 3300049572 | Unclassified | 2285 |
| 736 | Ga0501038_1261748 | 3300049574 | Unclassified | 535 |
| 737 | Ga0501040_0109559 | 3300049576 | Bacteria | 1931 |
| 738 | Ga0501041_0804657 | 3300049577 | Unclassified | 603 |
| 739 | Ga0501048_0357454 | 3300049582 | Unclassified | 1042 |
| 740 | Ga0501072_0765996 | 3300049588 | Bacteria | 757 |
| 741 | Ga0501072_1081175 | 3300049588 | Unclassified | 624 |
| 742 | Ga0501073_0325887 | 3300049589 | Bacteria | 1060 |
| 743 | Ga0501074_0158801 | 3300049590 | Unclassified | 1615 |
| 744 | Ga0501075_0048565 | 3300049591 | Bacteria | 3189 |
| 745 | Ga0501076_1312294 | 3300049592 | Unclassified | 595 |
| 746 | Ga0501076_1448133 | 3300049592 | Bacteria | 564 |
| 747 | Ga0501077_0729247 | 3300049593 | Bacteria | 637 |
| 748 | Ga0501081_0838868 | 3300049743 | Unclassified | 692 |
| 749 | Ga0501083_1153495 | 3300049744 | Bacteria | 504 |
| 750 | Ga0501045_0050177 | 3300049824 | Bacteria | 3044 |
| 751 | nmdc:mga05p37_12782_c1 | 3300050507 | Bacteria | 10033 |
| 752 | nmdc:mga05p37_159826_c1 | 3300050507 | Bacteria | 2752 |
| 753 | nmdc:mga05p37_209765_c1 | 3300050507 | Bacteria | 2355 |
| 754 | nmdc:mga05p37_4258_c1 | 3300050507 | Bacteria | 16719 |
| 755 | nmdc:mga05p37_4313_c1 | 3300050507 | Bacteria | 16614 |
| 756 | nmdc:mga05p37_65425_c1 | 3300050507 | Unclassified | 4473 |
| 757 | nmdc:mga05p37_795253_c1 | 3300050507 | Bacteria | 1036 |
| 758 | nmdc:mga05p37_884224_c1 | 3300050507 | Bacteria | 966 |
| 759 | nmdc:mga09592_374685_c1 | 3300050508 | Bacteria | 1231 |
| 760 | nmdc:mga09592_475115_c1 | 3300050508 | Bacteria | 1077 |
| 761 | nmdc:mga09592_88186_c1 | 3300050508 | Bacteria | 2649 |
| 762 | nmdc:mga06r32_294603_c1 | 3300050510 | Bacteria | 1609 |
| 763 | nmdc:mga06r32_80473_c1 | 3300050510 | Bacteria | 3170 |
| 764 | nmdc:mga08y16_1265735_c1 | 3300050511 | Bacteria | 706 |
| 765 | nmdc:mga08y16_197841_c1 | 3300050511 | Bacteria | 2083 |
| 766 | nmdc:mga08y16_201982_c1 | 3300050511 | Bacteria | 2060 |
| 767 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 768 | nmdc:mga08y16_457449_c1 | 3300050511 | Unclassified | 1301 |
| 769 | nmdc:mga08y16_791116_c1 | 3300050511 | Bacteria | 942 |
| 770 | nmdc:mga0n895_1049307_c1 | 3300050512 | Bacteria | 794 |
| 771 | nmdc:mga0n895_1060144_c1 | 3300050512 | Bacteria | 789 |
| 772 | nmdc:mga0n895_121_c1 | 3300050512 | Bacteria | 46448 |
| 773 | nmdc:mga0n895_14813_c1 | 3300050512 | Bacteria | 7095 |
| 774 | nmdc:mga0n895_218051_c1 | 3300050512 | Bacteria | 1937 |
| 775 | nmdc:mga0n895_240784_c1 | 3300050512 | Bacteria | 1836 |
| 776 | nmdc:mga0n895_26137_c1 | 3300050512 | Bacteria | 5525 |
| 777 | nmdc:mga0n895_426174_c1 | 3300050512 | Bacteria | 1341 |
| 778 | nmdc:mga0n895_438852_c1 | 3300050512 | Bacteria | 1319 |
| 779 | nmdc:mga0n895_48914_c1 | 3300050512 | Bacteria | 4141 |
| 780 | nmdc:mga0n895_514927_c1 | 3300050512 | Bacteria | 1204 |
| 781 | nmdc:mga0n895_77005_c1 | 3300050512 | Bacteria | 3317 |
| 782 | nmdc:mga0rr50_107_c1 | 3300050513 | Bacteria | 46254 |
| 783 | nmdc:mga0rr50_130263_c1 | 3300050513 | Unclassified | 2013 |
| 784 | nmdc:mga0rr50_18927_c1 | 3300050513 | Bacteria | 4638 |
| 785 | nmdc:mga0rr50_32117_c1 | 3300050513 | Bacteria | 3737 |
| 786 | nmdc:mga0rr50_46055_c1 | 3300050513 | Unclassified | 3210 |
| 787 | nmdc:mga0rr50_673_c1 | 3300050513 | Bacteria | 18292 |
| 788 | nmdc:mga0rr50_809806_c1 | 3300050513 | Unclassified | 799 |
| 789 | nmdc:mga08x19_20121_c1 | 3300050514 | Bacteria | 4108 |
| 790 | nmdc:mga08x19_285618_c1 | 3300050514 | Unclassified | 1144 |
| 791 | nmdc:mga08x19_351166_c1 | 3300050514 | Bacteria | 1030 |
| 792 | nmdc:mga08x19_89438_c1 | 3300050514 | Bacteria | 2031 |
| 793 | nmdc:mga08x19_967_c1 | 3300050514 | Bacteria | 17964 |
| 794 | nmdc:mga0a205_1142858_c1 | 3300050515 | Bacteria | 626 |
| 795 | nmdc:mga0a205_1277055_c1 | 3300050515 | Bacteria | 582 |
| 796 | nmdc:mga0a205_131616_c1 | 3300050515 | Bacteria | 2402 |
| 797 | nmdc:mga0a205_139466_c1 | 3300050515 | Bacteria | 2325 |
| 798 | nmdc:mga0a205_196771_c1 | 3300050515 | Unclassified | 1907 |
| 799 | nmdc:mga0a205_35834_c1 | 3300050515 | Bacteria | 4766 |
| 800 | nmdc:mga0a205_528173_c1 | 3300050515 | Unclassified | 1036 |
| 801 | nmdc:mga0a205_599235_c1 | 3300050515 | Bacteria | 955 |
| 802 | nmdc:mga0a205_94698_c1 | 3300050515 | Bacteria | 2885 |
| 803 | Ga0495601_0146171 | 3300053077 | Bacteria | 1543 |
| 804 | Ga0495601_0240595 | 3300053077 | Unclassified | 1182 |
| 805 | Ga0495595_0010931 | 3300053084 | Bacteria | 3788 |
| 806 | Ga0495595_0115286 | 3300053084 | Unclassified | 1306 |
| 807 | Ga0495595_0739682 | 3300053084 | Unclassified | 504 |
| 808 | Ga0495619_0278926 | 3300053085 | Bacteria | 1158 |
| 809 | Ga0495619_0300223 | 3300053085 | Bacteria | 1112 |
| 810 | Ga0495619_0489034 | 3300053085 | Bacteria | 847 |
| 811 | Ga0495619_0522967 | 3300053085 | Unclassified | 815 |
| 812 | Ga0495619_0744230 | 3300053085 | Bacteria | 665 |
| 813 | Ga0500658_0445202 | 3300053134 | Bacteria | 590 |
| 814 | Ga0501082_0611277 | 3300060353 | Unclassified | 954 |
| 815 | Ga0530510_0413395 | 3300061734 | Unclassified | 1018 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0312203 | Ga0466967_0312203_951_1343 | 120 |
| 2 | 3300005334 | Ga0068869_100722886 | Ga0068869_1007228861 | 122 |
| 3 | 3300005440 | Ga0070705_101144018 | Ga0070705_1011440181 | 122 |
| 4 | 3300005444 | Ga0070694_100062300 | Ga0070694_1000623003 | 122 |
| 5 | 3300005458 | Ga0070681_11423507 | Ga0070681_114235072 | 122 |
| 6 | 3300005467 | Ga0070706_100208008 | Ga0070706_1002080083 | 122 |
| 7 | 3300005545 | Ga0070695_100035574 | Ga0070695_1000355743 | 122 |
| 8 | 3300005546 | Ga0070696_100555178 | Ga0070696_1005551782 | 122 |
| 9 | 3300005547 | Ga0070693_100299339 | Ga0070693_1002993392 | 122 |
| 10 | 3300005549 | Ga0070704_100662055 | Ga0070704_1006620551 | 122 |
| 11 | 3300005578 | Ga0068854_100917123 | Ga0068854_1009171232 | 122 |
| 12 | 3300005615 | Ga0070702_100473531 | Ga0070702_1004735313 | 122 |
| 13 | 3300005617 | Ga0068859_100007252 | Ga0068859_1000072526 | 122 |
| 14 | 3300005719 | Ga0068861_100014808 | Ga0068861_1000148083 | 122 |
| 15 | 3300005840 | Ga0068870_10927106 | Ga0068870_109271061 | 122 |
| 16 | 3300005844 | Ga0068862_100372530 | Ga0068862_1003725301 | 122 |
| 17 | 3300006028 | Ga0070717_10367399 | Ga0070717_103673992 | 122 |
| 18 | 3300006237 | Ga0097621_100006112 | Ga0097621_1000061123 | 122 |
| 19 | 3300006237 | Ga0097621_100012698 | Ga0097621_1000126988 | 122 |
| 20 | 3300006358 | Ga0068871_100007740 | Ga0068871_1000077405 | 122 |
| 21 | 3300006914 | Ga0075436_100386884 | Ga0075436_1003868842 | 122 |
| 22 | 3300006914 | Ga0075436_100923072 | Ga0075436_1009230722 | 122 |
| 23 | 3300006931 | Ga0097620_100007252 | Ga0097620_1000072529 | 122 |
| 24 | 3300007076 | Ga0075435_100242264 | Ga0075435_1002422642 | 122 |
| 25 | 3300009093 | Ga0105240_10612425 | Ga0105240_106124251 | 122 |
| 26 | 3300009147 | Ga0114129_10200874 | Ga0114129_102008743 | 122 |
| 27 | 3300009148 | Ga0105243_10388504 | Ga0105243_103885043 | 122 |
| 28 | 3300013296 | Ga0157374_10257291 | Ga0157374_102572911 | 122 |
| 29 | 3300013297 | Ga0157378_13024023 | Ga0157378_130240231 | 122 |
| 30 | 3300014969 | Ga0157376_10600664 | Ga0157376_106006643 | 122 |
| 31 | 3300014969 | Ga0157376_10733139 | Ga0157376_107331392 | 122 |
| 32 | 3300050507 | nmdc:mga05p37_159826_c1 | nmdc:mga05p37_159826_c1_655_1032 | 122 |
| 33 | 3300005330 | Ga0070690_100701936 | Ga0070690_1007019362 | 123 |
| 34 | 3300005334 | Ga0068869_100082933 | Ga0068869_1000829332 | 123 |
| 35 | 3300005335 | Ga0070666_10869830 | Ga0070666_108698301 | 123 |
| 36 | 3300005338 | Ga0068868_100119930 | Ga0068868_1001199302 | 123 |
| 37 | 3300005356 | Ga0070674_100072587 | Ga0070674_1000725873 | 123 |
| 38 | 3300005356 | Ga0070674_100121193 | Ga0070674_1001211933 | 123 |
| 39 | 3300005356 | Ga0070674_100575658 | Ga0070674_1005756581 | 123 |
| 40 | 3300005364 | Ga0070673_100167660 | Ga0070673_1001676602 | 123 |
| 41 | 3300005458 | Ga0070681_11774500 | Ga0070681_117745001 | 123 |
| 42 | 3300005459 | Ga0068867_100758830 | Ga0068867_1007588302 | 123 |
| 43 | 3300005467 | Ga0070706_101588395 | Ga0070706_1015883951 | 123 |
| 44 | 3300005471 | Ga0070698_101720080 | Ga0070698_1017200801 | 123 |
| 45 | 3300005535 | Ga0070684_101378596 | Ga0070684_1013785961 | 123 |
| 46 | 3300005543 | Ga0070672_100385756 | Ga0070672_1003857562 | 123 |
| 47 | 3300005543 | Ga0070672_100916554 | Ga0070672_1009165542 | 123 |
| 48 | 3300005548 | Ga0070665_100044139 | Ga0070665_1000441392 | 123 |
| 49 | 3300005718 | Ga0068866_10094100 | Ga0068866_100941001 | 123 |
| 50 | 3300005843 | Ga0068860_100807238 | Ga0068860_1008072382 | 123 |
| 51 | 3300006028 | Ga0070717_10482438 | Ga0070717_104824382 | 123 |
| 52 | 3300006237 | Ga0097621_100009489 | Ga0097621_1000094895 | 123 |
| 53 | 3300006237 | Ga0097621_100023804 | Ga0097621_1000238045 | 123 |
| 54 | 3300006358 | Ga0068871_100003046 | Ga0068871_1000030464 | 123 |
| 55 | 3300006358 | Ga0068871_100012348 | Ga0068871_1000123482 | 123 |
| 56 | 3300006881 | Ga0068865_100399449 | Ga0068865_1003994492 | 123 |
| 57 | 3300009098 | Ga0105245_10597083 | Ga0105245_105970833 | 123 |
| 58 | 3300009148 | Ga0105243_10465088 | Ga0105243_104650883 | 123 |
| 59 | 3300009176 | Ga0105242_10565662 | Ga0105242_105656622 | 123 |
| 60 | 3300009176 | Ga0105242_10640830 | Ga0105242_106408302 | 123 |
| 61 | 3300009176 | Ga0105242_11398436 | Ga0105242_113984362 | 123 |
| 62 | 3300009177 | Ga0105248_11244520 | Ga0105248_112445202 | 123 |
| 63 | 3300009177 | Ga0105248_12134615 | Ga0105248_121346151 | 123 |
| 64 | 3300009551 | Ga0105238_10508750 | Ga0105238_105087501 | 123 |
| 65 | 3300013306 | Ga0163162_10049261 | Ga0163162_100492615 | 123 |
| 66 | 3300013306 | Ga0163162_10999959 | Ga0163162_109999592 | 123 |
| 67 | 3300013306 | Ga0163162_11154335 | Ga0163162_111543352 | 123 |
| 68 | 3300014968 | Ga0157379_11793903 | Ga0157379_117939031 | 123 |
| 69 | 3300014969 | Ga0157376_10086880 | Ga0157376_100868803 | 123 |
| 70 | 3300025899 | Ga0207642_10581084 | Ga0207642_105810841 | 123 |
| 71 | 3300025903 | Ga0207680_10183012 | Ga0207680_101830122 | 123 |
| 72 | 3300025907 | Ga0207645_10067485 | Ga0207645_100674852 | 123 |
| 73 | 3300025928 | Ga0207700_11530832 | Ga0207700_115308322 | 123 |
| 74 | 3300025937 | Ga0207669_10099901 | Ga0207669_100999013 | 123 |
| 75 | 3300025937 | Ga0207669_10237005 | Ga0207669_102370053 | 123 |
| 76 | 3300025938 | Ga0207704_10578764 | Ga0207704_105787642 | 123 |
| 77 | 3300025940 | Ga0207691_10460108 | Ga0207691_104601083 | 123 |
| 78 | 3300025941 | Ga0207711_10684874 | Ga0207711_106848742 | 123 |
| 79 | 3300025942 | Ga0207689_10552672 | Ga0207689_105526722 | 123 |
| 80 | 3300025960 | Ga0207651_11486750 | Ga0207651_114867501 | 123 |
| 81 | 3300026035 | Ga0207703_10993421 | Ga0207703_109934213 | 123 |
| 82 | 3300026121 | Ga0207683_11393168 | Ga0207683_113931683 | 123 |
| 83 | 3300028379 | Ga0268266_10118962 | Ga0268266_101189622 | 123 |
| 84 | 3300028381 | Ga0268264_10762872 | Ga0268264_107628722 | 123 |
| 85 | 3300035111 | Ga0373923_0293796 | Ga0373923_0293796_305_682 | 123 |
| 86 | 3300035119 | Ga0373956_0166493 | Ga0373956_0166493_270_647 | 123 |
| 87 | 3300035120 | Ga0373957_0339783 | Ga0373957_0339783_11_388 | 123 |
| 88 | 3300035172 | Ga0373955_0106148 | Ga0373955_0106148_602_979 | 123 |
| 89 | 3300035692 | Ga0373935_1091961 | Ga0373935_1091961_134_511 | 123 |
| 90 | 3300036401 | Ga0373937_0629949 | Ga0373937_0629949_574_951 | 123 |
| 91 | 3300037068 | Ga0373925_1685848 | Ga0373925_1685848_106_483 | 123 |
| 92 | 3300046459 | Ga0495629_0255721 | Ga0495629_0255721_528_905 | 123 |
| 93 | 3300046472 | Ga0495580_0213366 | Ga0495580_0213366_580_957 | 123 |
| 94 | 3300046681 | Ga0495647_0206657 | Ga0495647_0206657_292_669 | 123 |
| 95 | 3300046683 | Ga0495658_0096197 | Ga0495658_0096197_907_1284 | 123 |
| 96 | 3300046683 | Ga0495658_0486185 | Ga0495658_0486185_340_717 | 123 |
| 97 | 3300046684 | Ga0495669_0007102 | Ga0495669_0007102_4270_4647 | 123 |
| 98 | 3300047322 | Ga0495680_0864358 | Ga0495680_0864358_33_410 | 123 |
| 99 | 3300048904 | Ga0496101_0006384 | Ga0496101_0006384_1776_2153 | 123 |
| 100 | 3300048904 | Ga0496101_1102776 | Ga0496101_1102776_64_441 | 123 |
| 101 | 3300048905 | Ga0496102_0071174 | Ga0496102_0071174_324_701 | 123 |
| 102 | 3300048907 | Ga0496104_0154789 | Ga0496104_0154789_1658_2035 | 123 |
| 103 | 3300048907 | Ga0496104_0241441 | Ga0496104_0241441_59_436 | 123 |
| 104 | 3300048908 | Ga0496105_0114560 | Ga0496105_0114560_654_1031 | 123 |
| 105 | 3300048908 | Ga0496105_0202098 | Ga0496105_0202098_565_942 | 123 |
| 106 | 3300048908 | Ga0496105_0748066 | Ga0496105_0748066_28_405 | 123 |
| 107 | 3300048908 | Ga0496105_1346145 | Ga0496105_1346145_41_418 | 123 |
| 108 | 3300048910 | Ga0496107_0576562 | Ga0496107_0576562_18_395 | 123 |
| 109 | 3300048911 | Ga0496108_0788156 | Ga0496108_0788156_92_469 | 123 |
| 110 | 3300048912 | Ga0496109_1514171 | Ga0496109_1514171_91_468 | 123 |
| 111 | 3300048917 | Ga0496114_0000233 | Ga0496114_0000233_18156_18533 | 123 |
| 112 | 3300049744 | Ga0501083_1153495 | Ga0501083_1153495_32_409 | 123 |
| 113 | 3300053084 | Ga0495595_0115286 | Ga0495595_0115286_529_906 | 123 |
| 114 | 3300053084 | Ga0495595_0739682 | Ga0495595_0739682_82_459 | 123 |
| 115 | 3300053085 | Ga0495619_0278926 | Ga0495619_0278926_477_854 | 123 |
| 116 | 3300005340 | Ga0070689_100967094 | Ga0070689_1009670941 | 124 |
| 117 | 3300005344 | Ga0070661_100211698 | Ga0070661_1002116982 | 124 |
| 118 | 3300005353 | Ga0070669_100093200 | Ga0070669_1000932003 | 124 |
| 119 | 3300005354 | Ga0070675_100394357 | Ga0070675_1003943573 | 124 |
| 120 | 3300005355 | Ga0070671_100361176 | Ga0070671_1003611762 | 124 |
| 121 | 3300005456 | Ga0070678_101175206 | Ga0070678_1011752062 | 124 |
| 122 | 3300005456 | Ga0070678_101779224 | Ga0070678_1017792242 | 124 |
| 123 | 3300005466 | Ga0070685_10109186 | Ga0070685_101091863 | 124 |
| 124 | 3300005543 | Ga0070672_100111115 | Ga0070672_1001111153 | 124 |
| 125 | 3300005841 | Ga0068863_101486205 | Ga0068863_1014862051 | 124 |
| 126 | 3300006163 | Ga0070715_10248955 | Ga0070715_102489552 | 124 |
| 127 | 3300006847 | Ga0075431_100092801 | Ga0075431_1000928012 | 124 |
| 128 | 3300006881 | Ga0068865_100153959 | Ga0068865_1001539592 | 124 |
| 129 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001413 | 124 |
| 130 | 3300009147 | Ga0114129_13016541 | Ga0114129_130165412 | 124 |
| 131 | 3300013308 | Ga0157375_11076476 | Ga0157375_110764763 | 124 |
| 132 | 3300014745 | Ga0157377_10724071 | Ga0157377_107240712 | 124 |
| 133 | 3300014968 | Ga0157379_10962878 | Ga0157379_109628781 | 124 |
| 134 | 3300025901 | Ga0207688_10839974 | Ga0207688_108399742 | 124 |
| 135 | 3300025923 | Ga0207681_10345390 | Ga0207681_103453902 | 124 |
| 136 | 3300025925 | Ga0207650_10297249 | Ga0207650_102972491 | 124 |
| 137 | 3300025926 | Ga0207659_10165352 | Ga0207659_101653523 | 124 |
| 138 | 3300025933 | Ga0207706_10294293 | Ga0207706_102942931 | 124 |
| 139 | 3300025937 | Ga0207669_10924318 | Ga0207669_109243182 | 124 |
| 140 | 3300025938 | Ga0207704_11130190 | Ga0207704_111301901 | 124 |
| 141 | 3300025940 | Ga0207691_10025756 | Ga0207691_100257565 | 124 |
| 142 | 3300025945 | Ga0207679_10212907 | Ga0207679_102129072 | 124 |
| 143 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002424 | 124 |
| 144 | 3300042436 | Ga0439435_0182494 | Ga0439435_0182494_165_545 | 124 |
| 145 | 3300049570 | Ga0501033_1001729 | Ga0501033_1001729_58_438 | 124 |
| 146 | 3300049574 | Ga0501038_1261748 | Ga0501038_1261748_38_418 | 124 |
| 147 | 3300049576 | Ga0501040_0109559 | Ga0501040_0109559_1423_1803 | 124 |
| 148 | 3300049582 | Ga0501048_0357454 | Ga0501048_0357454_260_640 | 124 |
| 149 | 3300049588 | Ga0501072_0765996 | Ga0501072_0765996_260_640 | 124 |
| 150 | 3300049588 | Ga0501072_1081175 | Ga0501072_1081175_190_570 | 124 |
| 151 | 3300049590 | Ga0501074_0158801 | Ga0501074_0158801_946_1326 | 124 |
| 152 | 3300049591 | Ga0501075_0048565 | Ga0501075_0048565_2207_2587 | 124 |
| 153 | 3300049592 | Ga0501076_1312294 | Ga0501076_1312294_36_416 | 124 |
| 154 | 3300049592 | Ga0501076_1448133 | Ga0501076_1448133_110_490 | 124 |
| 155 | 3300049593 | Ga0501077_0729247 | Ga0501077_0729247_245_625 | 124 |
| 156 | 3300049743 | Ga0501081_0838868 | Ga0501081_0838868_249_629 | 124 |
| 157 | 3300049824 | Ga0501045_0050177 | Ga0501045_0050177_1001_1381 | 124 |
| 158 | 3300050510 | nmdc:mga06r32_80473_c1 | nmdc:mga06r32_80473_c1_2078_2458 | 124 |
| 159 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_442599_442979 | 124 |
| 160 | 3300060353 | Ga0501082_0611277 | Ga0501082_0611277_469_849 | 124 |
| 161 | 3300061734 | Ga0530510_0413395 | Ga0530510_0413395_467_847 | 124 |
| 162 | 3300005457 | Ga0070662_100344256 | Ga0070662_1003442562 | 125 |
| 163 | 3300005842 | Ga0068858_100116716 | Ga0068858_1001167162 | 125 |
| 164 | 3300005843 | Ga0068860_100076396 | Ga0068860_1000763963 | 125 |
| 165 | 3300005843 | Ga0068860_100402509 | Ga0068860_1004025091 | 125 |
| 166 | 3300006931 | Ga0097620_101171163 | Ga0097620_1011711632 | 125 |
| 167 | 3300009101 | Ga0105247_10035108 | Ga0105247_100351082 | 125 |
| 168 | 3300014326 | Ga0157380_10143390 | Ga0157380_101433905 | 125 |
| 169 | 3300014326 | Ga0157380_10686266 | Ga0157380_106862661 | 125 |
| 170 | 3300014968 | Ga0157379_10025920 | Ga0157379_100259205 | 125 |
| 171 | 3300025899 | Ga0207642_10422692 | Ga0207642_104226922 | 125 |
| 172 | 3300025900 | Ga0207710_10178965 | Ga0207710_101789652 | 125 |
| 173 | 3300025921 | Ga0207652_10400588 | Ga0207652_104005882 | 125 |
| 174 | 3300025923 | Ga0207681_11129313 | Ga0207681_111293131 | 125 |
| 175 | 3300025935 | Ga0207709_10071590 | Ga0207709_100715903 | 125 |
| 176 | 3300025936 | Ga0207670_10576900 | Ga0207670_105769002 | 125 |
| 177 | 3300026035 | Ga0207703_10080790 | Ga0207703_100807902 | 125 |
| 178 | 3300026089 | Ga0207648_10267230 | Ga0207648_102672302 | 125 |
| 179 | 3300026121 | Ga0207683_10500067 | Ga0207683_105000672 | 125 |
| 180 | 3300028381 | Ga0268264_11567202 | Ga0268264_115672022 | 125 |
| 181 | 3300031235 | Ga0265330_10183302 | Ga0265330_101833022 | 125 |
| 182 | 3300031711 | Ga0265314_10262607 | Ga0265314_102626072 | 125 |
| 183 | 3300045051 | Ga0451576_0562465 | Ga0451576_0562465_98_475 | 125 |
| 184 | 3300048911 | Ga0496108_1513853 | Ga0496108_1513853_121_498 | 125 |
| 185 | 3300049589 | Ga0501073_0325887 | Ga0501073_0325887_140_523 | 125 |
| 186 | 3300050511 | nmdc:mga08y16_791116_c1 | nmdc:mga08y16_791116_c1_194_571 | 125 |
| 187 | 3300005344 | Ga0070661_100564304 | Ga0070661_1005643042 | 126 |
| 188 | 3300005444 | Ga0070694_100096741 | Ga0070694_1000967414 | 126 |
| 189 | 3300005445 | Ga0070708_100771718 | Ga0070708_1007717182 | 126 |
| 190 | 3300005467 | Ga0070706_101865449 | Ga0070706_1018654491 | 126 |
| 191 | 3300005468 | Ga0070707_100036870 | Ga0070707_1000368706 | 126 |
| 192 | 3300005468 | Ga0070707_100421753 | Ga0070707_1004217532 | 126 |
| 193 | 3300005536 | Ga0070697_100384029 | Ga0070697_1003840291 | 126 |
| 194 | 3300005545 | Ga0070695_100242718 | Ga0070695_1002427182 | 126 |
| 195 | 3300005549 | Ga0070704_100130483 | Ga0070704_1001304833 | 126 |
| 196 | 3300005549 | Ga0070704_100206782 | Ga0070704_1002067821 | 126 |
| 197 | 3300005614 | Ga0068856_100679517 | Ga0068856_1006795172 | 126 |
| 198 | 3300005719 | Ga0068861_100752572 | Ga0068861_1007525722 | 126 |
| 199 | 3300005843 | Ga0068860_100581434 | Ga0068860_1005814342 | 126 |
| 200 | 3300005844 | Ga0068862_100130187 | Ga0068862_1001301873 | 126 |
| 201 | 3300006058 | Ga0075432_10143502 | Ga0075432_101435022 | 126 |
| 202 | 3300006058 | Ga0075432_10265698 | Ga0075432_102656981 | 126 |
| 203 | 3300006847 | Ga0075431_100369325 | Ga0075431_1003693252 | 126 |
| 204 | 3300006852 | Ga0075433_10024699 | Ga0075433_100246993 | 126 |
| 205 | 3300006852 | Ga0075433_10108884 | Ga0075433_101088843 | 126 |
| 206 | 3300006852 | Ga0075433_10490583 | Ga0075433_104905832 | 126 |
| 207 | 3300006871 | Ga0075434_100102251 | Ga0075434_1001022512 | 126 |
| 208 | 3300006871 | Ga0075434_100500448 | Ga0075434_1005004481 | 126 |
| 209 | 3300006880 | Ga0075429_100551931 | Ga0075429_1005519313 | 126 |
| 210 | 3300006914 | Ga0075436_100035222 | Ga0075436_1000352223 | 126 |
| 211 | 3300007076 | Ga0075435_100025175 | Ga0075435_1000251755 | 126 |
| 212 | 3300007076 | Ga0075435_100315623 | Ga0075435_1003156233 | 126 |
| 213 | 3300009093 | Ga0105240_10040742 | Ga0105240_100407426 | 126 |
| 214 | 3300009093 | Ga0105240_11429199 | Ga0105240_114291992 | 126 |
| 215 | 3300009147 | Ga0114129_10014923 | Ga0114129_100149238 | 126 |
| 216 | 3300009147 | Ga0114129_10032236 | Ga0114129_100322363 | 126 |
| 217 | 3300009147 | Ga0114129_10163513 | Ga0114129_101635134 | 126 |
| 218 | 3300009147 | Ga0114129_10952269 | Ga0114129_109522692 | 126 |
| 219 | 3300013104 | Ga0157370_11042514 | Ga0157370_110425141 | 126 |
| 220 | 3300013307 | Ga0157372_11208997 | Ga0157372_112089972 | 126 |
| 221 | 3300025912 | Ga0207707_10080438 | Ga0207707_100804382 | 126 |
| 222 | 3300025922 | Ga0207646_10432425 | Ga0207646_104324251 | 126 |
| 223 | 3300025941 | Ga0207711_10286243 | Ga0207711_102862432 | 126 |
| 224 | 3300025945 | Ga0207679_10976976 | Ga0207679_109769761 | 126 |
| 225 | 3300026078 | Ga0207702_10604977 | Ga0207702_106049772 | 126 |
| 226 | 3300027907 | Ga0207428_10917606 | Ga0207428_109176062 | 126 |
| 227 | 3300028380 | Ga0268265_10187836 | Ga0268265_101878362 | 126 |
| 228 | 3300028381 | Ga0268264_10339737 | Ga0268264_103397372 | 126 |
| 229 | 3300031548 | Ga0307408_101910592 | Ga0307408_1019105921 | 126 |
| 230 | 3300031911 | Ga0307412_10794267 | Ga0307412_107942672 | 126 |
| 231 | 3300031911 | Ga0307412_11676121 | Ga0307412_116761212 | 126 |
| 232 | 3300031995 | Ga0307409_100402933 | Ga0307409_1004029332 | 126 |
| 233 | 3300032002 | Ga0307416_100438744 | Ga0307416_1004387442 | 126 |
| 234 | 3300044694 | Ga0466963_0580345 | Ga0466963_0580345_35_421 | 126 |
| 235 | 3300045051 | Ga0451576_0289395 | Ga0451576_0289395_397_777 | 126 |
| 236 | 3300045976 | Ga0466967_0304786 | Ga0466967_0304786_459_839 | 126 |
| 237 | 3300045976 | Ga0466967_1257198 | Ga0466967_1257198_49_435 | 126 |
| 238 | 3300049572 | Ga0501036_0113960 | Ga0501036_0113960_1803_2183 | 126 |
| 239 | 3300049577 | Ga0501041_0804657 | Ga0501041_0804657_12_392 | 126 |
| 240 | 3300050507 | nmdc:mga05p37_4313_c1 | nmdc:mga05p37_4313_c1_2868_3248 | 126 |
| 241 | 3300050507 | nmdc:mga05p37_884224_c1 | nmdc:mga05p37_884224_c1_295_675 | 126 |
| 242 | 3300050508 | nmdc:mga09592_88186_c1 | nmdc:mga09592_88186_c1_1842_2225 | 126 |
| 243 | 3300050510 | nmdc:mga06r32_294603_c1 | nmdc:mga06r32_294603_c1_134_517 | 126 |
| 244 | 3300050512 | nmdc:mga0n895_1060144_c1 | nmdc:mga0n895_1060144_c1_101_484 | 126 |
| 245 | 3300050512 | nmdc:mga0n895_14813_c1 | nmdc:mga0n895_14813_c1_1436_1867 | 126 |
| 246 | 3300050512 | nmdc:mga0n895_26137_c1 | nmdc:mga0n895_26137_c1_1415_1795 | 126 |
| 247 | 3300050513 | nmdc:mga0rr50_32117_c1 | nmdc:mga0rr50_32117_c1_2803_3183 | 126 |
| 248 | 3300050513 | nmdc:mga0rr50_46055_c1 | nmdc:mga0rr50_46055_c1_1680_2111 | 126 |
| 249 | 3300050514 | nmdc:mga08x19_89438_c1 | nmdc:mga08x19_89438_c1_1212_1592 | 126 |
| 250 | 3300050515 | nmdc:mga0a205_131616_c1 | nmdc:mga0a205_131616_c1_397_780 | 126 |
| 251 | 3300050515 | nmdc:mga0a205_139466_c1 | nmdc:mga0a205_139466_c1_148_528 | 126 |
| 252 | 3300050515 | nmdc:mga0a205_196771_c1 | nmdc:mga0a205_196771_c1_1109_1540 | 126 |
| 253 | 3300050515 | nmdc:mga0a205_94698_c1 | nmdc:mga0a205_94698_c1_123_503 | 126 |
| 254 | 3300005327 | Ga0070658_10012592 | Ga0070658_100125922 | 127 |
| 255 | 3300005329 | Ga0070683_102245138 | Ga0070683_1022451381 | 127 |
| 256 | 3300005331 | Ga0070670_100463438 | Ga0070670_1004634382 | 127 |
| 257 | 3300005333 | Ga0070677_10136872 | Ga0070677_101368722 | 127 |
| 258 | 3300005333 | Ga0070677_10314871 | Ga0070677_103148711 | 127 |
| 259 | 3300005334 | Ga0068869_100447990 | Ga0068869_1004479901 | 127 |
| 260 | 3300005334 | Ga0068869_100460686 | Ga0068869_1004606862 | 127 |
| 261 | 3300005338 | Ga0068868_100037394 | Ga0068868_1000373943 | 127 |
| 262 | 3300005338 | Ga0068868_100170374 | Ga0068868_1001703742 | 127 |
| 263 | 3300005338 | Ga0068868_100419711 | Ga0068868_1004197112 | 127 |
| 264 | 3300005339 | Ga0070660_100064261 | Ga0070660_1000642614 | 127 |
| 265 | 3300005340 | Ga0070689_100094020 | Ga0070689_1000940202 | 127 |
| 266 | 3300005343 | Ga0070687_100224423 | Ga0070687_1002244232 | 127 |
| 267 | 3300005343 | Ga0070687_100506445 | Ga0070687_1005064452 | 127 |
| 268 | 3300005347 | Ga0070668_100350158 | Ga0070668_1003501581 | 127 |
| 269 | 3300005353 | Ga0070669_100047404 | Ga0070669_1000474043 | 127 |
| 270 | 3300005354 | Ga0070675_100357175 | Ga0070675_1003571752 | 127 |
| 271 | 3300005354 | Ga0070675_100769245 | Ga0070675_1007692452 | 127 |
| 272 | 3300005355 | Ga0070671_100044941 | Ga0070671_1000449414 | 127 |
| 273 | 3300005355 | Ga0070671_100365478 | Ga0070671_1003654781 | 127 |
| 274 | 3300005356 | Ga0070674_100139155 | Ga0070674_1001391551 | 127 |
| 275 | 3300005364 | Ga0070673_100063214 | Ga0070673_1000632143 | 127 |
| 276 | 3300005364 | Ga0070673_100098118 | Ga0070673_1000981183 | 127 |
| 277 | 3300005364 | Ga0070673_100305577 | Ga0070673_1003055772 | 127 |
| 278 | 3300005364 | Ga0070673_101028703 | Ga0070673_1010287032 | 127 |
| 279 | 3300005365 | Ga0070688_100134780 | Ga0070688_1001347801 | 127 |
| 280 | 3300005365 | Ga0070688_100313434 | Ga0070688_1003134342 | 127 |
| 281 | 3300005367 | Ga0070667_100009819 | Ga0070667_1000098194 | 127 |
| 282 | 3300005367 | Ga0070667_100318647 | Ga0070667_1003186472 | 127 |
| 283 | 3300005434 | Ga0070709_10245755 | Ga0070709_102457552 | 127 |
| 284 | 3300005435 | Ga0070714_100044820 | Ga0070714_1000448204 | 127 |
| 285 | 3300005440 | Ga0070705_100483740 | Ga0070705_1004837402 | 127 |
| 286 | 3300005444 | Ga0070694_100705236 | Ga0070694_1007052361 | 127 |
| 287 | 3300005445 | Ga0070708_100164533 | Ga0070708_1001645332 | 127 |
| 288 | 3300005445 | Ga0070708_101925576 | Ga0070708_1019255762 | 127 |
| 289 | 3300005456 | Ga0070678_100612660 | Ga0070678_1006126602 | 127 |
| 290 | 3300005456 | Ga0070678_101499574 | Ga0070678_1014995742 | 127 |
| 291 | 3300005457 | Ga0070662_101194822 | Ga0070662_1011948222 | 127 |
| 292 | 3300005458 | Ga0070681_10474497 | Ga0070681_104744972 | 127 |
| 293 | 3300005459 | Ga0068867_100382326 | Ga0068867_1003823262 | 127 |
| 294 | 3300005459 | Ga0068867_101181283 | Ga0068867_1011812831 | 127 |
| 295 | 3300005467 | Ga0070706_100475305 | Ga0070706_1004753051 | 127 |
| 296 | 3300005468 | Ga0070707_100263363 | Ga0070707_1002633632 | 127 |
| 297 | 3300005468 | Ga0070707_100723988 | Ga0070707_1007239881 | 127 |
| 298 | 3300005471 | Ga0070698_100014460 | Ga0070698_1000144607 | 127 |
| 299 | 3300005471 | Ga0070698_101082948 | Ga0070698_1010829482 | 127 |
| 300 | 3300005518 | Ga0070699_100004418 | Ga0070699_1000044183 | 127 |
| 301 | 3300005518 | Ga0070699_100559274 | Ga0070699_1005592741 | 127 |
| 302 | 3300005518 | Ga0070699_101457645 | Ga0070699_1014576451 | 127 |
| 303 | 3300005536 | Ga0070697_100137743 | Ga0070697_1001377433 | 127 |
| 304 | 3300005536 | Ga0070697_100415161 | Ga0070697_1004151612 | 127 |
| 305 | 3300005536 | Ga0070697_100464079 | Ga0070697_1004640792 | 127 |
| 306 | 3300005543 | Ga0070672_100018842 | Ga0070672_1000188422 | 127 |
| 307 | 3300005544 | Ga0070686_101120361 | Ga0070686_1011203612 | 127 |
| 308 | 3300005546 | Ga0070696_100368348 | Ga0070696_1003683482 | 127 |
| 309 | 3300005548 | Ga0070665_100007922 | Ga0070665_1000079224 | 127 |
| 310 | 3300005548 | Ga0070665_100020938 | Ga0070665_1000209383 | 127 |
| 311 | 3300005548 | Ga0070665_100473760 | Ga0070665_1004737602 | 127 |
| 312 | 3300005549 | Ga0070704_100031805 | Ga0070704_1000318053 | 127 |
| 313 | 3300005549 | Ga0070704_100988370 | Ga0070704_1009883702 | 127 |
| 314 | 3300005563 | Ga0068855_100141000 | Ga0068855_1001410004 | 127 |
| 315 | 3300005564 | Ga0070664_100403298 | Ga0070664_1004032982 | 127 |
| 316 | 3300005616 | Ga0068852_101250882 | Ga0068852_1012508822 | 127 |
| 317 | 3300005616 | Ga0068852_102033183 | Ga0068852_1020331831 | 127 |
| 318 | 3300005617 | Ga0068859_100256114 | Ga0068859_1002561142 | 127 |
| 319 | 3300005617 | Ga0068859_100388259 | Ga0068859_1003882592 | 127 |
| 320 | 3300005617 | Ga0068859_100641225 | Ga0068859_1006412251 | 127 |
| 321 | 3300005617 | Ga0068859_101014369 | Ga0068859_1010143692 | 127 |
| 322 | 3300005617 | Ga0068859_101412808 | Ga0068859_1014128082 | 127 |
| 323 | 3300005617 | Ga0068859_101920156 | Ga0068859_1019201561 | 127 |
| 324 | 3300005617 | Ga0068859_102661461 | Ga0068859_1026614611 | 127 |
| 325 | 3300005618 | Ga0068864_100008563 | Ga0068864_1000085639 | 127 |
| 326 | 3300005618 | Ga0068864_100220254 | Ga0068864_1002202542 | 127 |
| 327 | 3300005618 | Ga0068864_102226010 | Ga0068864_1022260101 | 127 |
| 328 | 3300005718 | Ga0068866_10232523 | Ga0068866_102325233 | 127 |
| 329 | 3300005718 | Ga0068866_10322634 | Ga0068866_103226342 | 127 |
| 330 | 3300005718 | Ga0068866_10344498 | Ga0068866_103444982 | 127 |
| 331 | 3300005718 | Ga0068866_11003586 | Ga0068866_110035862 | 127 |
| 332 | 3300005719 | Ga0068861_100375462 | Ga0068861_1003754621 | 127 |
| 333 | 3300005719 | Ga0068861_100656303 | Ga0068861_1006563031 | 127 |
| 334 | 3300005841 | Ga0068863_100011271 | Ga0068863_10001127115 | 127 |
| 335 | 3300005841 | Ga0068863_100767668 | Ga0068863_1007676682 | 127 |
| 336 | 3300005842 | Ga0068858_100127832 | Ga0068858_1001278323 | 127 |
| 337 | 3300005842 | Ga0068858_100466665 | Ga0068858_1004666652 | 127 |
| 338 | 3300005842 | Ga0068858_100797066 | Ga0068858_1007970662 | 127 |
| 339 | 3300005842 | Ga0068858_102085652 | Ga0068858_1020856522 | 127 |
| 340 | 3300005843 | Ga0068860_100049142 | Ga0068860_1000491424 | 127 |
| 341 | 3300005843 | Ga0068860_100154553 | Ga0068860_1001545533 | 127 |
| 342 | 3300005843 | Ga0068860_101234856 | Ga0068860_1012348562 | 127 |
| 343 | 3300005937 | Ga0081455_10095237 | Ga0081455_100952371 | 127 |
| 344 | 3300005985 | Ga0081539_10012200 | Ga0081539_100122002 | 127 |
| 345 | 3300006028 | Ga0070717_10972207 | Ga0070717_109722072 | 127 |
| 346 | 3300006173 | Ga0070716_100911557 | Ga0070716_1009115572 | 127 |
| 347 | 3300006237 | Ga0097621_100027466 | Ga0097621_1000274664 | 127 |
| 348 | 3300006358 | Ga0068871_100002793 | Ga0068871_10000279311 | 127 |
| 349 | 3300006358 | Ga0068871_100438342 | Ga0068871_1004383422 | 127 |
| 350 | 3300006358 | Ga0068871_100506652 | Ga0068871_1005066522 | 127 |
| 351 | 3300006844 | Ga0075428_100117748 | Ga0075428_1001177483 | 127 |
| 352 | 3300006844 | Ga0075428_100148388 | Ga0075428_1001483882 | 127 |
| 353 | 3300006844 | Ga0075428_100455326 | Ga0075428_1004553262 | 127 |
| 354 | 3300006852 | Ga0075433_10098176 | Ga0075433_100981762 | 127 |
| 355 | 3300006852 | Ga0075433_10148238 | Ga0075433_101482382 | 127 |
| 356 | 3300006880 | Ga0075429_100433410 | Ga0075429_1004334102 | 127 |
| 357 | 3300006880 | Ga0075429_100575771 | Ga0075429_1005757712 | 127 |
| 358 | 3300006881 | Ga0068865_100005193 | Ga0068865_1000051935 | 127 |
| 359 | 3300006914 | Ga0075436_100082118 | Ga0075436_1000821181 | 127 |
| 360 | 3300006931 | Ga0097620_100256122 | Ga0097620_1002561222 | 127 |
| 361 | 3300006931 | Ga0097620_100388233 | Ga0097620_1003882331 | 127 |
| 362 | 3300006931 | Ga0097620_100641198 | Ga0097620_1006411982 | 127 |
| 363 | 3300006931 | Ga0097620_101014319 | Ga0097620_1010143192 | 127 |
| 364 | 3300006931 | Ga0097620_101412800 | Ga0097620_1014128002 | 127 |
| 365 | 3300006931 | Ga0097620_101919824 | Ga0097620_1019198242 | 127 |
| 366 | 3300006931 | Ga0097620_102659845 | Ga0097620_1026598451 | 127 |
| 367 | 3300007076 | Ga0075435_100021273 | Ga0075435_1000212735 | 127 |
| 368 | 3300007076 | Ga0075435_100260423 | Ga0075435_1002604233 | 127 |
| 369 | 3300007076 | Ga0075435_102060320 | Ga0075435_1020603201 | 127 |
| 370 | 3300009011 | Ga0105251_10337275 | Ga0105251_103372752 | 127 |
| 371 | 3300009093 | Ga0105240_10007971 | Ga0105240_1000797113 | 127 |
| 372 | 3300009093 | Ga0105240_10162808 | Ga0105240_101628083 | 127 |
| 373 | 3300009094 | Ga0111539_10001163 | Ga0111539_1000116330 | 127 |
| 374 | 3300009094 | Ga0111539_10041743 | Ga0111539_100417436 | 127 |
| 375 | 3300009094 | Ga0111539_10877699 | Ga0111539_108776993 | 127 |
| 376 | 3300009094 | Ga0111539_11553529 | Ga0111539_115535292 | 127 |
| 377 | 3300009094 | Ga0111539_12621075 | Ga0111539_126210751 | 127 |
| 378 | 3300009098 | Ga0105245_10277601 | Ga0105245_102776013 | 127 |
| 379 | 3300009098 | Ga0105245_10295177 | Ga0105245_102951772 | 127 |
| 380 | 3300009098 | Ga0105245_10360859 | Ga0105245_103608592 | 127 |
| 381 | 3300009098 | Ga0105245_11323948 | Ga0105245_113239482 | 127 |
| 382 | 3300009098 | Ga0105245_12112189 | Ga0105245_121121891 | 127 |
| 383 | 3300009101 | Ga0105247_10060281 | Ga0105247_100602814 | 127 |
| 384 | 3300009147 | Ga0114129_10001441 | Ga0114129_1000144115 | 127 |
| 385 | 3300009147 | Ga0114129_10008836 | Ga0114129_1000883614 | 127 |
| 386 | 3300009147 | Ga0114129_10054047 | Ga0114129_100540474 | 127 |
| 387 | 3300009147 | Ga0114129_10296085 | Ga0114129_102960854 | 127 |
| 388 | 3300009147 | Ga0114129_10594551 | Ga0114129_105945512 | 127 |
| 389 | 3300009147 | Ga0114129_10893496 | Ga0114129_108934962 | 127 |
| 390 | 3300009147 | Ga0114129_12478354 | Ga0114129_124783541 | 127 |
| 391 | 3300009147 | Ga0114129_12964982 | Ga0114129_129649821 | 127 |
| 392 | 3300009148 | Ga0105243_10146032 | Ga0105243_101460323 | 127 |
| 393 | 3300009176 | Ga0105242_10007403 | Ga0105242_100074036 | 127 |
| 394 | 3300009176 | Ga0105242_10009179 | Ga0105242_100091796 | 127 |
| 395 | 3300009176 | Ga0105242_10089248 | Ga0105242_100892483 | 127 |
| 396 | 3300009176 | Ga0105242_10585879 | Ga0105242_105858792 | 127 |
| 397 | 3300009176 | Ga0105242_10905622 | Ga0105242_109056222 | 127 |
| 398 | 3300009177 | Ga0105248_10040761 | Ga0105248_100407615 | 127 |
| 399 | 3300009177 | Ga0105248_10048968 | Ga0105248_100489682 | 127 |
| 400 | 3300009177 | Ga0105248_10069671 | Ga0105248_100696714 | 127 |
| 401 | 3300009177 | Ga0105248_10080366 | Ga0105248_100803664 | 127 |
| 402 | 3300009177 | Ga0105248_10302070 | Ga0105248_103020703 | 127 |
| 403 | 3300009177 | Ga0105248_11357468 | Ga0105248_113574682 | 127 |
| 404 | 3300009545 | Ga0105237_10199846 | Ga0105237_101998462 | 127 |
| 405 | 3300009551 | Ga0105238_11551387 | Ga0105238_115513872 | 127 |
| 406 | 3300009553 | Ga0105249_12157448 | Ga0105249_121574481 | 127 |
| 407 | 3300011119 | Ga0105246_10322115 | Ga0105246_103221152 | 127 |
| 408 | 3300011119 | Ga0105246_10384715 | Ga0105246_103847152 | 127 |
| 409 | 3300012478 | Ga0157328_1018368 | Ga0157328_10183682 | 127 |
| 410 | 3300013296 | Ga0157374_10040325 | Ga0157374_100403253 | 127 |
| 411 | 3300013296 | Ga0157374_11185322 | Ga0157374_111853222 | 127 |
| 412 | 3300013297 | Ga0157378_10090322 | Ga0157378_100903223 | 127 |
| 413 | 3300013297 | Ga0157378_10131912 | Ga0157378_101319122 | 127 |
| 414 | 3300013297 | Ga0157378_11735819 | Ga0157378_117358192 | 127 |
| 415 | 3300013306 | Ga0163162_10155039 | Ga0163162_101550393 | 127 |
| 416 | 3300013306 | Ga0163162_11573505 | Ga0163162_115735052 | 127 |
| 417 | 3300013306 | Ga0163162_13473214 | Ga0163162_134732141 | 127 |
| 418 | 3300013308 | Ga0157375_10032644 | Ga0157375_100326441 | 127 |
| 419 | 3300013308 | Ga0157375_10142643 | Ga0157375_101426431 | 127 |
| 420 | 3300013308 | Ga0157375_10756113 | Ga0157375_107561133 | 127 |
| 421 | 3300013308 | Ga0157375_10797951 | Ga0157375_107979512 | 127 |
| 422 | 3300013308 | Ga0157375_11447046 | Ga0157375_114470462 | 127 |
| 423 | 3300014325 | Ga0163163_10178821 | Ga0163163_101788212 | 127 |
| 424 | 3300014325 | Ga0163163_10523579 | Ga0163163_105235792 | 127 |
| 425 | 3300014326 | Ga0157380_11308939 | Ga0157380_113089392 | 127 |
| 426 | 3300014326 | Ga0157380_11343240 | Ga0157380_113432401 | 127 |
| 427 | 3300014745 | Ga0157377_10034898 | Ga0157377_100348984 | 127 |
| 428 | 3300014745 | Ga0157377_10365622 | Ga0157377_103656222 | 127 |
| 429 | 3300014968 | Ga0157379_10010988 | Ga0157379_100109884 | 127 |
| 430 | 3300014968 | Ga0157379_11296613 | Ga0157379_112966132 | 127 |
| 431 | 3300014969 | Ga0157376_10012899 | Ga0157376_100128991 | 127 |
| 432 | 3300014969 | Ga0157376_10111594 | Ga0157376_101115942 | 127 |
| 433 | 3300014969 | Ga0157376_10424767 | Ga0157376_104247672 | 127 |
| 434 | 3300014969 | Ga0157376_10525221 | Ga0157376_105252212 | 127 |
| 435 | 3300017792 | Ga0163161_10221081 | Ga0163161_102210812 | 127 |
| 436 | 3300017792 | Ga0163161_11436934 | Ga0163161_114369342 | 127 |
| 437 | 3300025321 | Ga0207656_10204214 | Ga0207656_102042143 | 127 |
| 438 | 3300025899 | Ga0207642_10177406 | Ga0207642_101774062 | 127 |
| 439 | 3300025899 | Ga0207642_10258513 | Ga0207642_102585132 | 127 |
| 440 | 3300025899 | Ga0207642_10370264 | Ga0207642_103702642 | 127 |
| 441 | 3300025900 | Ga0207710_10036542 | Ga0207710_100365423 | 127 |
| 442 | 3300025903 | Ga0207680_10101420 | Ga0207680_101014201 | 127 |
| 443 | 3300025903 | Ga0207680_10159962 | Ga0207680_101599622 | 127 |
| 444 | 3300025903 | Ga0207680_10386207 | Ga0207680_103862072 | 127 |
| 445 | 3300025905 | Ga0207685_10592085 | Ga0207685_105920852 | 127 |
| 446 | 3300025906 | Ga0207699_10504311 | Ga0207699_105043112 | 127 |
| 447 | 3300025907 | Ga0207645_10256823 | Ga0207645_102568232 | 127 |
| 448 | 3300025909 | Ga0207705_10088924 | Ga0207705_100889242 | 127 |
| 449 | 3300025910 | Ga0207684_10283973 | Ga0207684_102839732 | 127 |
| 450 | 3300025910 | Ga0207684_10369012 | Ga0207684_103690122 | 127 |
| 451 | 3300025912 | Ga0207707_10391360 | Ga0207707_103913602 | 127 |
| 452 | 3300025913 | Ga0207695_10063368 | Ga0207695_100633683 | 127 |
| 453 | 3300025913 | Ga0207695_10570565 | Ga0207695_105705652 | 127 |
| 454 | 3300025914 | Ga0207671_10168089 | Ga0207671_101680892 | 127 |
| 455 | 3300025917 | Ga0207660_10142932 | Ga0207660_101429322 | 127 |
| 456 | 3300025917 | Ga0207660_11246153 | Ga0207660_112461531 | 127 |
| 457 | 3300025918 | Ga0207662_10057610 | Ga0207662_100576104 | 127 |
| 458 | 3300025919 | Ga0207657_10006081 | Ga0207657_1000608113 | 127 |
| 459 | 3300025919 | Ga0207657_10601530 | Ga0207657_106015303 | 127 |
| 460 | 3300025921 | Ga0207652_10048088 | Ga0207652_100480883 | 127 |
| 461 | 3300025922 | Ga0207646_10333229 | Ga0207646_103332292 | 127 |
| 462 | 3300025922 | Ga0207646_10511335 | Ga0207646_105113352 | 127 |
| 463 | 3300025923 | Ga0207681_10089928 | Ga0207681_100899283 | 127 |
| 464 | 3300025923 | Ga0207681_10939831 | Ga0207681_109398312 | 127 |
| 465 | 3300025925 | Ga0207650_10765489 | Ga0207650_107654892 | 127 |
| 466 | 3300025926 | Ga0207659_10396980 | Ga0207659_103969801 | 127 |
| 467 | 3300025927 | Ga0207687_10088125 | Ga0207687_100881253 | 127 |
| 468 | 3300025927 | Ga0207687_10745116 | Ga0207687_107451162 | 127 |
| 469 | 3300025927 | Ga0207687_10812495 | Ga0207687_108124952 | 127 |
| 470 | 3300025929 | Ga0207664_10182318 | Ga0207664_101823182 | 127 |
| 471 | 3300025931 | Ga0207644_10006773 | Ga0207644_100067733 | 127 |
| 472 | 3300025933 | Ga0207706_10654566 | Ga0207706_106545662 | 127 |
| 473 | 3300025933 | Ga0207706_10790302 | Ga0207706_107903022 | 127 |
| 474 | 3300025934 | Ga0207686_10057789 | Ga0207686_100577893 | 127 |
| 475 | 3300025934 | Ga0207686_10087097 | Ga0207686_100870973 | 127 |
| 476 | 3300025936 | Ga0207670_10750858 | Ga0207670_107508582 | 127 |
| 477 | 3300025937 | Ga0207669_10138763 | Ga0207669_101387633 | 127 |
| 478 | 3300025937 | Ga0207669_10290965 | Ga0207669_102909652 | 127 |
| 479 | 3300025938 | Ga0207704_10075233 | Ga0207704_100752332 | 127 |
| 480 | 3300025938 | Ga0207704_10717944 | Ga0207704_107179441 | 127 |
| 481 | 3300025940 | Ga0207691_10019546 | Ga0207691_100195463 | 127 |
| 482 | 3300025940 | Ga0207691_10424004 | Ga0207691_104240043 | 127 |
| 483 | 3300025940 | Ga0207691_10523565 | Ga0207691_105235652 | 127 |
| 484 | 3300025941 | Ga0207711_10026730 | Ga0207711_100267304 | 127 |
| 485 | 3300025941 | Ga0207711_10032038 | Ga0207711_100320385 | 127 |
| 486 | 3300025941 | Ga0207711_10094262 | Ga0207711_100942623 | 127 |
| 487 | 3300025941 | Ga0207711_10128602 | Ga0207711_101286022 | 127 |
| 488 | 3300025942 | Ga0207689_10230024 | Ga0207689_102300242 | 127 |
| 489 | 3300025942 | Ga0207689_10383580 | Ga0207689_103835802 | 127 |
| 490 | 3300025942 | Ga0207689_10653785 | Ga0207689_106537852 | 127 |
| 491 | 3300025944 | Ga0207661_10972814 | Ga0207661_109728142 | 127 |
| 492 | 3300025945 | Ga0207679_10071806 | Ga0207679_100718063 | 127 |
| 493 | 3300025949 | Ga0207667_10336673 | Ga0207667_103366732 | 127 |
| 494 | 3300025960 | Ga0207651_10056250 | Ga0207651_100562502 | 127 |
| 495 | 3300025960 | Ga0207651_10260993 | Ga0207651_102609932 | 127 |
| 496 | 3300025960 | Ga0207651_10399417 | Ga0207651_103994171 | 127 |
| 497 | 3300025960 | Ga0207651_10921709 | Ga0207651_109217092 | 127 |
| 498 | 3300025961 | Ga0207712_10415008 | Ga0207712_104150082 | 127 |
| 499 | 3300025972 | Ga0207668_10241805 | Ga0207668_102418052 | 127 |
| 500 | 3300025981 | Ga0207640_11470412 | Ga0207640_114704121 | 127 |
| 501 | 3300025986 | Ga0207658_10047007 | Ga0207658_100470072 | 127 |
| 502 | 3300025986 | Ga0207658_10047326 | Ga0207658_100473264 | 127 |
| 503 | 3300026023 | Ga0207677_10026731 | Ga0207677_100267313 | 127 |
| 504 | 3300026023 | Ga0207677_10139859 | Ga0207677_101398593 | 127 |
| 505 | 3300026023 | Ga0207677_10309145 | Ga0207677_103091452 | 127 |
| 506 | 3300026023 | Ga0207677_10391125 | Ga0207677_103911252 | 127 |
| 507 | 3300026023 | Ga0207677_10672825 | Ga0207677_106728252 | 127 |
| 508 | 3300026023 | Ga0207677_11517129 | Ga0207677_115171292 | 127 |
| 509 | 3300026035 | Ga0207703_10650301 | Ga0207703_106503012 | 127 |
| 510 | 3300026035 | Ga0207703_10733969 | Ga0207703_107339692 | 127 |
| 511 | 3300026035 | Ga0207703_10805945 | Ga0207703_108059452 | 127 |
| 512 | 3300026075 | Ga0207708_10912844 | Ga0207708_109128441 | 127 |
| 513 | 3300026088 | Ga0207641_10001439 | Ga0207641_1000143914 | 127 |
| 514 | 3300026088 | Ga0207641_10860684 | Ga0207641_108606842 | 127 |
| 515 | 3300026088 | Ga0207641_12058910 | Ga0207641_120589101 | 127 |
| 516 | 3300026089 | Ga0207648_10045180 | Ga0207648_100451805 | 127 |
| 517 | 3300026089 | Ga0207648_10303051 | Ga0207648_103030513 | 127 |
| 518 | 3300026089 | Ga0207648_11849341 | Ga0207648_118493412 | 127 |
| 519 | 3300026095 | Ga0207676_10064447 | Ga0207676_100644471 | 127 |
| 520 | 3300026095 | Ga0207676_10181317 | Ga0207676_101813172 | 127 |
| 521 | 3300026118 | Ga0207675_100387325 | Ga0207675_1003873253 | 127 |
| 522 | 3300026118 | Ga0207675_100621867 | Ga0207675_1006218672 | 127 |
| 523 | 3300026118 | Ga0207675_102098936 | Ga0207675_1020989361 | 127 |
| 524 | 3300026121 | Ga0207683_10106566 | Ga0207683_101065665 | 127 |
| 525 | 3300026121 | Ga0207683_10713573 | Ga0207683_107135733 | 127 |
| 526 | 3300026121 | Ga0207683_11105561 | Ga0207683_111055611 | 127 |
| 527 | 3300026142 | Ga0207698_10911727 | Ga0207698_109117272 | 127 |
| 528 | 3300026142 | Ga0207698_11602920 | Ga0207698_116029202 | 127 |
| 529 | 3300027907 | Ga0207428_10037252 | Ga0207428_100372525 | 127 |
| 530 | 3300028379 | Ga0268266_10019305 | Ga0268266_100193053 | 127 |
| 531 | 3300028379 | Ga0268266_10701308 | Ga0268266_107013082 | 127 |
| 532 | 3300028380 | Ga0268265_10112247 | Ga0268265_101122473 | 127 |
| 533 | 3300028380 | Ga0268265_10978488 | Ga0268265_109784882 | 127 |
| 534 | 3300028380 | Ga0268265_11596331 | Ga0268265_115963312 | 127 |
| 535 | 3300028381 | Ga0268264_10153392 | Ga0268264_101533923 | 127 |
| 536 | 3300028381 | Ga0268264_10429873 | Ga0268264_104298731 | 127 |
| 537 | 3300028381 | Ga0268264_10697811 | Ga0268264_106978112 | 127 |
| 538 | 3300028381 | Ga0268264_11544979 | Ga0268264_115449792 | 127 |
| 539 | 3300031548 | Ga0307408_101282512 | Ga0307408_1012825123 | 127 |
| 540 | 3300031548 | Ga0307408_101326310 | Ga0307408_1013263102 | 127 |
| 541 | 3300031901 | Ga0307406_11396297 | Ga0307406_113962972 | 127 |
| 542 | 3300035085 | Ga0373929_0088576 | Ga0373929_0088576_212_598 | 127 |
| 543 | 3300035086 | Ga0373934_0287715 | Ga0373934_0287715_188_574 | 127 |
| 544 | 3300035112 | Ga0373932_0142400 | Ga0373932_0142400_243_629 | 127 |
| 545 | 3300035112 | Ga0373932_0438474 | Ga0373932_0438474_31_417 | 127 |
| 546 | 3300035115 | Ga0373941_0144295 | Ga0373941_0144295_271_657 | 127 |
| 547 | 3300035116 | Ga0373945_0044414 | Ga0373945_0044414_245_631 | 127 |
| 548 | 3300035117 | Ga0373953_0126978 | Ga0373953_0126978_146_562 | 127 |
| 549 | 3300035170 | Ga0373943_0342927 | Ga0373943_0342927_458_844 | 127 |
| 550 | 3300035171 | Ga0373946_0179247 | Ga0373946_0179247_345_731 | 127 |
| 551 | 3300035172 | Ga0373955_0044020 | Ga0373955_0044020_1548_1934 | 127 |
| 552 | 3300035172 | Ga0373955_0096801 | Ga0373955_0096801_357_773 | 127 |
| 553 | 3300035691 | Ga0373931_0076384 | Ga0373931_0076384_147_533 | 127 |
| 554 | 3300035692 | Ga0373935_0993189 | Ga0373935_0993189_87_473 | 127 |
| 555 | 3300035724 | Ga0373933_0182731 | Ga0373933_0182731_546_962 | 127 |
| 556 | 3300035725 | Ga0373947_0088685 | Ga0373947_0088685_1410_1796 | 127 |
| 557 | 3300036401 | Ga0373937_0151733 | Ga0373937_0151733_272_658 | 127 |
| 558 | 3300036401 | Ga0373937_0472667 | Ga0373937_0472667_153_539 | 127 |
| 559 | 3300036401 | Ga0373937_0562246 | Ga0373937_0562246_685_1071 | 127 |
| 560 | 3300036401 | Ga0373937_0762680 | Ga0373937_0762680_355_741 | 127 |
| 561 | 3300036401 | Ga0373937_0801211 | Ga0373937_0801211_273_659 | 127 |
| 562 | 3300037068 | Ga0373925_1365082 | Ga0373925_1365082_51_437 | 127 |
| 563 | 3300037466 | Ga0395898_1248308 | Ga0395898_1248308_111_497 | 127 |
| 564 | 3300045051 | Ga0451576_0042753 | Ga0451576_0042753_117_503 | 127 |
| 565 | 3300046454 | Ga0495592_0770343 | Ga0495592_0770343_92_478 | 127 |
| 566 | 3300046455 | Ga0495603_0147776 | Ga0495603_0147776_960_1346 | 127 |
| 567 | 3300046459 | Ga0495629_0482684 | Ga0495629_0482684_315_701 | 127 |
| 568 | 3300046462 | Ga0495651_0191693 | Ga0495651_0191693_403_819 | 127 |
| 569 | 3300046462 | Ga0495651_0330708 | Ga0495651_0330708_509_895 | 127 |
| 570 | 3300046463 | Ga0495653_0146527 | Ga0495653_0146527_388_774 | 127 |
| 571 | 3300046463 | Ga0495653_0630818 | Ga0495653_0630818_33_419 | 127 |
| 572 | 3300046475 | Ga0495639_0128359 | Ga0495639_0128359_809_1195 | 127 |
| 573 | 3300046499 | Ga0495594_0254331 | Ga0495594_0254331_235_621 | 127 |
| 574 | 3300046499 | Ga0495594_0784483 | Ga0495594_0784483_103_495 | 127 |
| 575 | 3300046516 | Ga0495628_0071470 | Ga0495628_0071470_2234_2620 | 127 |
| 576 | 3300046517 | Ga0495630_0251315 | Ga0495630_0251315_341_727 | 127 |
| 577 | 3300046517 | Ga0495630_1398987 | Ga0495630_1398987_23_409 | 127 |
| 578 | 3300046523 | Ga0495644_0355806 | Ga0495644_0355806_136_522 | 127 |
| 579 | 3300046528 | Ga0495642_0260238 | Ga0495642_0260238_95_481 | 127 |
| 580 | 3300046533 | Ga0495640_0213548 | Ga0495640_0213548_188_574 | 127 |
| 581 | 3300046535 | Ga0495586_0128973 | Ga0495586_0128973_896_1282 | 127 |
| 582 | 3300046536 | Ga0495587_0195115 | Ga0495587_0195115_203_619 | 127 |
| 583 | 3300046543 | Ga0495645_0056749 | Ga0495645_0056749_1989_2405 | 127 |
| 584 | 3300046558 | Ga0495633_0280466 | Ga0495633_0280466_339_725 | 127 |
| 585 | 3300046615 | Ga0495656_0248450 | Ga0495656_0248450_37_423 | 127 |
| 586 | 3300046615 | Ga0495656_0688845 | Ga0495656_0688845_83_475 | 127 |
| 587 | 3300046642 | Ga0495634_0335269 | Ga0495634_0335269_485_871 | 127 |
| 588 | 3300046663 | Ga0495635_0438884 | Ga0495635_0438884_86_472 | 127 |
| 589 | 3300046678 | Ga0495599_0140783 | Ga0495599_0140783_399_815 | 127 |
| 590 | 3300046678 | Ga0495599_0216914 | Ga0495599_0216914_482_868 | 127 |
| 591 | 3300046680 | Ga0495646_0499508 | Ga0495646_0499508_192_578 | 127 |
| 592 | 3300046681 | Ga0495647_0044598 | Ga0495647_0044598_709_1095 | 127 |
| 593 | 3300046681 | Ga0495647_0284674 | Ga0495647_0284674_104_550 | 127 |
| 594 | 3300046683 | Ga0495658_0040389 | Ga0495658_0040389_379_765 | 127 |
| 595 | 3300046683 | Ga0495658_0163528 | Ga0495658_0163528_486_872 | 127 |
| 596 | 3300046683 | Ga0495658_0275711 | Ga0495658_0275711_139_525 | 127 |
| 597 | 3300046684 | Ga0495669_0074307 | Ga0495669_0074307_243_629 | 127 |
| 598 | 3300046689 | Ga0495613_0394148 | Ga0495613_0394148_159_545 | 127 |
| 599 | 3300046691 | Ga0495670_0315638 | Ga0495670_0315638_407_793 | 127 |
| 600 | 3300046809 | Ga0495600_0078259 | Ga0495600_0078259_368_784 | 127 |
| 601 | 3300047315 | Ga0495581_0500155 | Ga0495581_0500155_36_422 | 127 |
| 602 | 3300047317 | Ga0495604_0874802 | Ga0495604_0874802_99_485 | 127 |
| 603 | 3300047319 | Ga0495674_0975457 | Ga0495674_0975457_26_412 | 127 |
| 604 | 3300047320 | Ga0495672_0413162 | Ga0495672_0413162_19_405 | 127 |
| 605 | 3300047471 | Ga0495684_0921757 | Ga0495684_0921757_83_469 | 127 |
| 606 | 3300048905 | Ga0496102_0486300 | Ga0496102_0486300_534_920 | 127 |
| 607 | 3300048905 | Ga0496102_1857583 | Ga0496102_1857583_19_405 | 127 |
| 608 | 3300048907 | Ga0496104_0111424 | Ga0496104_0111424_2068_2457 | 127 |
| 609 | 3300048907 | Ga0496104_0193126 | Ga0496104_0193126_705_1091 | 127 |
| 610 | 3300048908 | Ga0496105_0562400 | Ga0496105_0562400_187_573 | 127 |
| 611 | 3300048909 | Ga0496106_0320006 | Ga0496106_0320006_469_855 | 127 |
| 612 | 3300048910 | Ga0496107_0495879 | Ga0496107_0495879_306_692 | 127 |
| 613 | 3300048910 | Ga0496107_1280440 | Ga0496107_1280440_117_503 | 127 |
| 614 | 3300048911 | Ga0496108_0023039 | Ga0496108_0023039_2210_2599 | 127 |
| 615 | 3300048911 | Ga0496108_1451490 | Ga0496108_1451490_36_422 | 127 |
| 616 | 3300048912 | Ga0496109_0106622 | Ga0496109_0106622_2050_2436 | 127 |
| 617 | 3300048912 | Ga0496109_0412495 | Ga0496109_0412495_227_616 | 127 |
| 618 | 3300048913 | Ga0496110_0799479 | Ga0496110_0799479_198_584 | 127 |
| 619 | 3300048915 | Ga0496112_0050925 | Ga0496112_0050925_2690_3079 | 127 |
| 620 | 3300048915 | Ga0496112_1084914 | Ga0496112_1084914_212_598 | 127 |
| 621 | 3300048915 | Ga0496112_1728411 | Ga0496112_1728411_92_481 | 127 |
| 622 | 3300048915 | Ga0496112_1832169 | Ga0496112_1832169_105_491 | 127 |
| 623 | 3300048916 | Ga0496113_0032383 | Ga0496113_0032383_2389_2778 | 127 |
| 624 | 3300048916 | Ga0496113_1497134 | Ga0496113_1497134_117_503 | 127 |
| 625 | 3300048917 | Ga0496114_0339497 | Ga0496114_0339497_840_1226 | 127 |
| 626 | 3300048917 | Ga0496114_1707900 | Ga0496114_1707900_97_483 | 127 |
| 627 | 3300048918 | Ga0496115_0039023 | Ga0496115_0039023_15_401 | 127 |
| 628 | 3300050507 | nmdc:mga05p37_12782_c1 | nmdc:mga05p37_12782_c1_187_573 | 127 |
| 629 | 3300050507 | nmdc:mga05p37_65425_c1 | nmdc:mga05p37_65425_c1_2501_2887 | 127 |
| 630 | 3300050507 | nmdc:mga05p37_795253_c1 | nmdc:mga05p37_795253_c1_488_883 | 127 |
| 631 | 3300050508 | nmdc:mga09592_374685_c1 | nmdc:mga09592_374685_c1_494_928 | 127 |
| 632 | 3300050508 | nmdc:mga09592_475115_c1 | nmdc:mga09592_475115_c1_412_798 | 127 |
| 633 | 3300050511 | nmdc:mga08y16_1265735_c1 | nmdc:mga08y16_1265735_c1_213_599 | 127 |
| 634 | 3300050511 | nmdc:mga08y16_197841_c1 | nmdc:mga08y16_197841_c1_211_645 | 127 |
| 635 | 3300050511 | nmdc:mga08y16_201982_c1 | nmdc:mga08y16_201982_c1_1318_1704 | 127 |
| 636 | 3300050511 | nmdc:mga08y16_457449_c1 | nmdc:mga08y16_457449_c1_549_935 | 127 |
| 637 | 3300050512 | nmdc:mga0n895_240784_c1 | nmdc:mga0n895_240784_c1_509_895 | 127 |
| 638 | 3300050512 | nmdc:mga0n895_514927_c1 | nmdc:mga0n895_514927_c1_52_438 | 127 |
| 639 | 3300050513 | nmdc:mga0rr50_130263_c1 | nmdc:mga0rr50_130263_c1_351_746 | 127 |
| 640 | 3300050513 | nmdc:mga0rr50_809806_c1 | nmdc:mga0rr50_809806_c1_336_722 | 127 |
| 641 | 3300050514 | nmdc:mga08x19_285618_c1 | nmdc:mga08x19_285618_c1_404_799 | 127 |
| 642 | 3300050515 | nmdc:mga0a205_1142858_c1 | nmdc:mga0a205_1142858_c1_176_580 | 127 |
| 643 | 3300050515 | nmdc:mga0a205_528173_c1 | nmdc:mga0a205_528173_c1_497_901 | 127 |
| 644 | 3300050515 | nmdc:mga0a205_599235_c1 | nmdc:mga0a205_599235_c1_167_553 | 127 |
| 645 | 3300053077 | Ga0495601_0146171 | Ga0495601_0146171_305_691 | 127 |
| 646 | 3300053077 | Ga0495601_0240595 | Ga0495601_0240595_236_622 | 127 |
| 647 | 3300053084 | Ga0495595_0010931 | Ga0495595_0010931_2177_2593 | 127 |
| 648 | 3300053085 | Ga0495619_0300223 | Ga0495619_0300223_67_453 | 127 |
| 649 | 3300053085 | Ga0495619_0489034 | Ga0495619_0489034_155_544 | 127 |
| 650 | 3300053085 | Ga0495619_0522967 | Ga0495619_0522967_140_526 | 127 |
| 651 | 3300053085 | Ga0495619_0744230 | Ga0495619_0744230_92_478 | 127 |
| 652 | 3300053134 | Ga0500658_0445202 | Ga0500658_0445202_171_557 | 127 |
| 653 | 3300005293 | Ga0065715_10443799 | Ga0065715_104437992 | 128 |
| 654 | 3300005295 | Ga0065707_10768756 | Ga0065707_107687561 | 128 |
| 655 | 3300005333 | Ga0070677_10223646 | Ga0070677_102236462 | 128 |
| 656 | 3300005345 | Ga0070692_10593538 | Ga0070692_105935381 | 128 |
| 657 | 3300005353 | Ga0070669_100046718 | Ga0070669_1000467183 | 128 |
| 658 | 3300005353 | Ga0070669_100205521 | Ga0070669_1002055211 | 128 |
| 659 | 3300005354 | Ga0070675_100004928 | Ga0070675_1000049287 | 128 |
| 660 | 3300005354 | Ga0070675_100083888 | Ga0070675_1000838882 | 128 |
| 661 | 3300005356 | Ga0070674_100183991 | Ga0070674_1001839912 | 128 |
| 662 | 3300005356 | Ga0070674_100490309 | Ga0070674_1004903092 | 128 |
| 663 | 3300005364 | Ga0070673_100811122 | Ga0070673_1008111222 | 128 |
| 664 | 3300005434 | Ga0070709_10080261 | Ga0070709_100802614 | 128 |
| 665 | 3300005441 | Ga0070700_100122822 | Ga0070700_1001228222 | 128 |
| 666 | 3300005441 | Ga0070700_100856071 | Ga0070700_1008560712 | 128 |
| 667 | 3300005445 | Ga0070708_100554904 | Ga0070708_1005549042 | 128 |
| 668 | 3300005457 | Ga0070662_100723809 | Ga0070662_1007238092 | 128 |
| 669 | 3300005457 | Ga0070662_101188238 | Ga0070662_1011882381 | 128 |
| 670 | 3300005459 | Ga0068867_100046159 | Ga0068867_1000461594 | 128 |
| 671 | 3300005468 | Ga0070707_100061815 | Ga0070707_1000618154 | 128 |
| 672 | 3300005471 | Ga0070698_100246029 | Ga0070698_1002460293 | 128 |
| 673 | 3300005518 | Ga0070699_100127022 | Ga0070699_1001270222 | 128 |
| 674 | 3300005536 | Ga0070697_100030072 | Ga0070697_1000300723 | 128 |
| 675 | 3300005543 | Ga0070672_100628876 | Ga0070672_1006288762 | 128 |
| 676 | 3300005544 | Ga0070686_100477557 | Ga0070686_1004775571 | 128 |
| 677 | 3300005546 | Ga0070696_100054449 | Ga0070696_1000544493 | 128 |
| 678 | 3300005546 | Ga0070696_100334602 | Ga0070696_1003346022 | 128 |
| 679 | 3300005549 | Ga0070704_100701266 | Ga0070704_1007012661 | 128 |
| 680 | 3300005617 | Ga0068859_100341004 | Ga0068859_1003410041 | 128 |
| 681 | 3300005617 | Ga0068859_101892345 | Ga0068859_1018923451 | 128 |
| 682 | 3300005718 | Ga0068866_10223482 | Ga0068866_102234822 | 128 |
| 683 | 3300005842 | Ga0068858_100245466 | Ga0068858_1002454662 | 128 |
| 684 | 3300005844 | Ga0068862_100043489 | Ga0068862_1000434896 | 128 |
| 685 | 3300005844 | Ga0068862_100571967 | Ga0068862_1005719672 | 128 |
| 686 | 3300005937 | Ga0081455_10033163 | Ga0081455_100331634 | 128 |
| 687 | 3300006358 | Ga0068871_100561590 | Ga0068871_1005615901 | 128 |
| 688 | 3300006852 | Ga0075433_10078981 | Ga0075433_100789813 | 128 |
| 689 | 3300006871 | Ga0075434_100000776 | Ga0075434_1000007761 | 128 |
| 690 | 3300006871 | Ga0075434_100133145 | Ga0075434_1001331454 | 128 |
| 691 | 3300006871 | Ga0075434_100529729 | Ga0075434_1005297292 | 128 |
| 692 | 3300006871 | Ga0075434_100568177 | Ga0075434_1005681772 | 128 |
| 693 | 3300006871 | Ga0075434_101288614 | Ga0075434_1012886142 | 128 |
| 694 | 3300006914 | Ga0075436_100001718 | Ga0075436_1000017187 | 128 |
| 695 | 3300006914 | Ga0075436_100068074 | Ga0075436_1000680743 | 128 |
| 696 | 3300006914 | Ga0075436_100186902 | Ga0075436_1001869023 | 128 |
| 697 | 3300006931 | Ga0097620_100340988 | Ga0097620_1003409881 | 128 |
| 698 | 3300006931 | Ga0097620_101892456 | Ga0097620_1018924562 | 128 |
| 699 | 3300007076 | Ga0075435_100000189 | Ga0075435_10000018916 | 128 |
| 700 | 3300007076 | Ga0075435_100004108 | Ga0075435_1000041085 | 128 |
| 701 | 3300007076 | Ga0075435_100069738 | Ga0075435_1000697382 | 128 |
| 702 | 3300009098 | Ga0105245_10970075 | Ga0105245_109700751 | 128 |
| 703 | 3300009098 | Ga0105245_11327211 | Ga0105245_113272112 | 128 |
| 704 | 3300009147 | Ga0114129_10000304 | Ga0114129_100003049 | 128 |
| 705 | 3300009147 | Ga0114129_10021549 | Ga0114129_100215495 | 128 |
| 706 | 3300009148 | Ga0105243_10296654 | Ga0105243_102966542 | 128 |
| 707 | 3300009174 | Ga0105241_10115966 | Ga0105241_101159662 | 128 |
| 708 | 3300009176 | Ga0105242_10893161 | Ga0105242_108931612 | 128 |
| 709 | 3300009177 | Ga0105248_10099960 | Ga0105248_100999603 | 128 |
| 710 | 3300009177 | Ga0105248_12260191 | Ga0105248_122601912 | 128 |
| 711 | 3300009553 | Ga0105249_10058904 | Ga0105249_100589043 | 128 |
| 712 | 3300009553 | Ga0105249_10843395 | Ga0105249_108433952 | 128 |
| 713 | 3300009553 | Ga0105249_10892409 | Ga0105249_108924092 | 128 |
| 714 | 3300010375 | Ga0105239_10760707 | Ga0105239_107607073 | 128 |
| 715 | 3300011119 | Ga0105246_11232811 | Ga0105246_112328112 | 128 |
| 716 | 3300013296 | Ga0157374_10619609 | Ga0157374_106196092 | 128 |
| 717 | 3300013306 | Ga0163162_12545413 | Ga0163162_125454132 | 128 |
| 718 | 3300014326 | Ga0157380_10507128 | Ga0157380_105071282 | 128 |
| 719 | 3300014326 | Ga0157380_10715163 | Ga0157380_107151632 | 128 |
| 720 | 3300014968 | Ga0157379_11184895 | Ga0157379_111848952 | 128 |
| 721 | 3300025893 | Ga0207682_10173766 | Ga0207682_101737662 | 128 |
| 722 | 3300025901 | Ga0207688_10264745 | Ga0207688_102647452 | 128 |
| 723 | 3300025906 | Ga0207699_10059499 | Ga0207699_100594992 | 128 |
| 724 | 3300025910 | Ga0207684_10433462 | Ga0207684_104334622 | 128 |
| 725 | 3300025913 | Ga0207695_10062269 | Ga0207695_100622694 | 128 |
| 726 | 3300025918 | Ga0207662_10158413 | Ga0207662_101584132 | 128 |
| 727 | 3300025922 | Ga0207646_10711523 | Ga0207646_107115233 | 128 |
| 728 | 3300025922 | Ga0207646_11314866 | Ga0207646_113148662 | 128 |
| 729 | 3300025923 | Ga0207681_11641385 | Ga0207681_116413851 | 128 |
| 730 | 3300025924 | Ga0207694_10220033 | Ga0207694_102200332 | 128 |
| 731 | 3300025926 | Ga0207659_10000637 | Ga0207659_1000063716 | 128 |
| 732 | 3300025926 | Ga0207659_10300931 | Ga0207659_103009312 | 128 |
| 733 | 3300025931 | Ga0207644_10467038 | Ga0207644_104670382 | 128 |
| 734 | 3300025933 | Ga0207706_10077394 | Ga0207706_100773942 | 128 |
| 735 | 3300025933 | Ga0207706_10170600 | Ga0207706_101706003 | 128 |
| 736 | 3300025933 | Ga0207706_10477703 | Ga0207706_104777032 | 128 |
| 737 | 3300025934 | Ga0207686_10489239 | Ga0207686_104892392 | 128 |
| 738 | 3300025934 | Ga0207686_10739682 | Ga0207686_107396822 | 128 |
| 739 | 3300025935 | Ga0207709_10391646 | Ga0207709_103916461 | 128 |
| 740 | 3300025937 | Ga0207669_10565564 | Ga0207669_105655642 | 128 |
| 741 | 3300025937 | Ga0207669_11052373 | Ga0207669_110523732 | 128 |
| 742 | 3300025940 | Ga0207691_10773407 | Ga0207691_107734072 | 128 |
| 743 | 3300025941 | Ga0207711_10045130 | Ga0207711_100451304 | 128 |
| 744 | 3300025960 | Ga0207651_10785291 | Ga0207651_107852911 | 128 |
| 745 | 3300025960 | Ga0207651_11536133 | Ga0207651_115361331 | 128 |
| 746 | 3300025961 | Ga0207712_10554786 | Ga0207712_105547863 | 128 |
| 747 | 3300025961 | Ga0207712_10710531 | Ga0207712_107105312 | 128 |
| 748 | 3300025961 | Ga0207712_12073488 | Ga0207712_120734882 | 128 |
| 749 | 3300025972 | Ga0207668_10657224 | Ga0207668_106572242 | 128 |
| 750 | 3300025972 | Ga0207668_10695391 | Ga0207668_106953912 | 128 |
| 751 | 3300025981 | Ga0207640_10032202 | Ga0207640_100322024 | 128 |
| 752 | 3300025981 | Ga0207640_10310768 | Ga0207640_103107682 | 128 |
| 753 | 3300026035 | Ga0207703_10213043 | Ga0207703_102130432 | 128 |
| 754 | 3300026035 | Ga0207703_12215109 | Ga0207703_122151092 | 128 |
| 755 | 3300026041 | Ga0207639_10313539 | Ga0207639_103135392 | 128 |
| 756 | 3300026075 | Ga0207708_10014526 | Ga0207708_100145262 | 128 |
| 757 | 3300026089 | Ga0207648_10044459 | Ga0207648_100444593 | 128 |
| 758 | 3300026118 | Ga0207675_100048362 | Ga0207675_1000483625 | 128 |
| 759 | 3300026118 | Ga0207675_100275600 | Ga0207675_1002756003 | 128 |
| 760 | 3300026118 | Ga0207675_102204307 | Ga0207675_1022043072 | 128 |
| 761 | 3300026121 | Ga0207683_10138777 | Ga0207683_101387773 | 128 |
| 762 | 3300028380 | Ga0268265_10168612 | Ga0268265_101686122 | 128 |
| 763 | 3300028380 | Ga0268265_10460791 | Ga0268265_104607912 | 128 |
| 764 | 3300028381 | Ga0268264_11069935 | Ga0268264_110699353 | 128 |
| 765 | 3300028381 | Ga0268264_11256535 | Ga0268264_112565352 | 128 |
| 766 | 3300031903 | Ga0307407_11321949 | Ga0307407_113219491 | 128 |
| 767 | 3300034816 | Ga0373930_0000245 | Ga0373930_0000245_950_1342 | 128 |
| 768 | 3300034817 | Ga0373948_0028959 | Ga0373948_0028959_499_891 | 128 |
| 769 | 3300034818 | Ga0373950_0002004 | Ga0373950_0002004_2160_2552 | 128 |
| 770 | 3300034820 | Ga0373959_0000405 | Ga0373959_0000405_871_1263 | 128 |
| 771 | 3300034957 | Ga0373938_0005187 | Ga0373938_0005187_284_676 | 128 |
| 772 | 3300035084 | Ga0373928_0002313 | Ga0373928_0002313_545_937 | 128 |
| 773 | 3300035085 | Ga0373929_0014335 | Ga0373929_0014335_303_695 | 128 |
| 774 | 3300035088 | Ga0373940_0021100 | Ga0373940_0021100_1048_1440 | 128 |
| 775 | 3300035090 | Ga0373949_0003515 | Ga0373949_0003515_2078_2470 | 128 |
| 776 | 3300035091 | Ga0373951_0000437 | Ga0373951_0000437_171_563 | 128 |
| 777 | 3300035092 | Ga0373952_0019680 | Ga0373952_0019680_848_1240 | 128 |
| 778 | 3300035112 | Ga0373932_0014002 | Ga0373932_0014002_950_1342 | 128 |
| 779 | 3300035114 | Ga0373939_0001301 | Ga0373939_0001301_1869_2261 | 128 |
| 780 | 3300035115 | Ga0373941_0013444 | Ga0373941_0013444_1078_1473 | 128 |
| 781 | 3300035115 | Ga0373941_0015421 | Ga0373941_0015421_1514_1906 | 128 |
| 782 | 3300035121 | Ga0373960_0004257 | Ga0373960_0004257_2276_2668 | 128 |
| 783 | 3300035170 | Ga0373943_0486564 | Ga0373943_0486564_314_706 | 128 |
| 784 | 3300035207 | Ga0373942_0018432 | Ga0373942_0018432_670_1062 | 128 |
| 785 | 3300035207 | Ga0373942_0048593 | Ga0373942_0048593_754_1149 | 128 |
| 786 | 3300035241 | Ga0373961_0005744 | Ga0373961_0005744_785_1177 | 128 |
| 787 | 3300035242 | Ga0373962_0036497 | Ga0373962_0036497_653_1045 | 128 |
| 788 | 3300035724 | Ga0373933_0437136 | Ga0373933_0437136_121_516 | 128 |
| 789 | 3300044694 | Ga0466963_0203622 | Ga0466963_0203622_297_686 | 128 |
| 790 | 3300046558 | Ga0495633_0148457 | Ga0495633_0148457_229_624 | 128 |
| 791 | 3300046684 | Ga0495669_0177199 | Ga0495669_0177199_212_604 | 128 |
| 792 | 3300048904 | Ga0496101_0655154 | Ga0496101_0655154_69_461 | 128 |
| 793 | 3300048909 | Ga0496106_0954131 | Ga0496106_0954131_79_471 | 128 |
| 794 | 3300048909 | Ga0496106_0984749 | Ga0496106_0984749_19_417 | 128 |
| 795 | 3300048910 | Ga0496107_0228327 | Ga0496107_0228327_183_575 | 128 |
| 796 | 3300048913 | Ga0496110_1782646 | Ga0496110_1782646_39_437 | 128 |
| 797 | 3300048915 | Ga0496112_0118215 | Ga0496112_0118215_1288_1686 | 128 |
| 798 | 3300048915 | Ga0496112_0974937 | Ga0496112_0974937_277_669 | 128 |
| 799 | 3300050507 | nmdc:mga05p37_209765_c1 | nmdc:mga05p37_209765_c1_1297_1689 | 128 |
| 800 | 3300050507 | nmdc:mga05p37_4258_c1 | nmdc:mga05p37_4258_c1_14526_14924 | 128 |
| 801 | 3300050512 | nmdc:mga0n895_1049307_c1 | nmdc:mga0n895_1049307_c1_20_412 | 128 |
| 802 | 3300050512 | nmdc:mga0n895_121_c1 | nmdc:mga0n895_121_c1_24865_25257 | 128 |
| 803 | 3300050512 | nmdc:mga0n895_218051_c1 | nmdc:mga0n895_218051_c1_560_952 | 128 |
| 804 | 3300050512 | nmdc:mga0n895_426174_c1 | nmdc:mga0n895_426174_c1_103_495 | 128 |
| 805 | 3300050512 | nmdc:mga0n895_438852_c1 | nmdc:mga0n895_438852_c1_881_1279 | 128 |
| 806 | 3300050512 | nmdc:mga0n895_48914_c1 | nmdc:mga0n895_48914_c1_695_1087 | 128 |
| 807 | 3300050512 | nmdc:mga0n895_77005_c1 | nmdc:mga0n895_77005_c1_1871_2269 | 128 |
| 808 | 3300050513 | nmdc:mga0rr50_107_c1 | nmdc:mga0rr50_107_c1_24865_25257 | 128 |
| 809 | 3300050513 | nmdc:mga0rr50_18927_c1 | nmdc:mga0rr50_18927_c1_696_1088 | 128 |
| 810 | 3300050513 | nmdc:mga0rr50_673_c1 | nmdc:mga0rr50_673_c1_5460_5852 | 128 |
| 811 | 3300050514 | nmdc:mga08x19_20121_c1 | nmdc:mga08x19_20121_c1_2866_3258 | 128 |
| 812 | 3300050514 | nmdc:mga08x19_351166_c1 | nmdc:mga08x19_351166_c1_625_1017 | 128 |
| 813 | 3300050514 | nmdc:mga08x19_967_c1 | nmdc:mga08x19_967_c1_6453_6845 | 128 |
| 814 | 3300050515 | nmdc:mga0a205_1277055_c1 | nmdc:mga0a205_1277055_c1_106_498 | 128 |
| 815 | 3300050515 | nmdc:mga0a205_35834_c1 | nmdc:mga0a205_35834_c1_2609_3007 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3crn-assembly1.cif.gz_B | crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 | 0.9015 | 5 | 125 |
| 1zy2-assembly1.cif.gz_A | crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus | 0.8981 | 8 | 124 |
| 3dgf-assembly1.cif.gz_C | structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism | 0.8926 | 6 | 118 |
| 6rh1-assembly1.cif.gz_C | revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 | 0.891 | 6 | 118 |
| 2rdm-assembly1.cif.gz_A | crystal structure of response regulator receiver protein from sinorhizobium medicae wsm419 | 0.8866 | 5 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1NCE1_621_722_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9289 | 6 | 70 | 3.40.50.2300 |
| af_Q2G2G2_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9189 | 8 | 70 | 3.40.50.2300 |
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9043 | 8 | 83 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9037 | 8 | 83 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8991 | 5 | 83 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2VT48-F1-model_v4 | Response regulatory domain-containing protein | 0.9847 | 9 | 124 |
GO:0000160
|
| AF-A0A2V8GDY5-F1-model_v4 | Response regulator | 0.9751 | 10 | 118 |
GO:0000160
|
| AF-A0A3N5NGM7-F1-model_v4 | Response regulator | 0.9499 | 1 | 121 |
GO:0000160
|
| AF-A0A2V8BL56-F1-model_v4 | Response regulatory domain-containing protein | 0.9458 | 16 | 128 |
GO:0000160
|
| AF-A0A2V8BL56-F1-model_v4 | Response regulatory domain-containing protein | 0.9375 | 16 | 128 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar