F482020

General Info

Members Datasets Scaffolds Average Seq Length
815 406 1630 123

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0217235|Ga0436362_0217235_93_461
Length 122
Sequence MHLNHDPDAPPAPPIDFDKFLAVDVRVGTIVAAEPFAEARKPSLKLRIDFGPGVGVKQSSAQIAQYDVAALVGRQVAAVVNFPPRQIGRFMSEVLTLGFPDENGAVVLFSPDRKVPDGARLF

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
187 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
188 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
247 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
248 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
252 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
253 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
259 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
260 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
375 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
379 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
380 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
381 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
382 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
385 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
391 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
392 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
395 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
396 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
397 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
398 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
399 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
400 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
401 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
402 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
405 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.48
Nodule 0.25
Rhizoplane 3.44
Rhizosphere 70.31
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0217235 3300039453 Bacteria 613
2 SwRhRL2b_contig_2144200 2162886007 Bacteria 7630
3 JGI25150J39212_1000368 3300002774 Bacteria 21777
4 Ga0006759J45824_1076213 3300003163 Bacteria 741
5 JGI25151J46595_10070633 3300003187 Bacteria 1059
6 JGI25153J46596_10000512 3300003215 Bacteria 24447
7 Ga0006777J48905_1008095 3300003308 Bacteria 774
8 Ga0007416J51690_1070775 3300003577 Bacteria 865
9 Ga0007429J51699_1004743 3300003579 Bacteria 1257
10 Ga0007429J51699_1114894 3300003579 Bacteria 832
11 Ga0055529_1018251 3300003763 Bacteria 878
12 Ga0055537_1002263 3300003773 Bacteria 6621
13 Ga0055537_1004290 3300003773 Bacteria 4107
14 Ga0055536_1006517 3300003781 Bacteria 5427
15 Ga0055536_1007944 3300003781 Bacteria 4651
16 Ga0055530_10000013 3300003791 Bacteria 153390
17 Ga0055530_10050136 3300003791 Bacteria 974
18 Ga0055531_10000792 3300003794 Bacteria 26275
19 Ga0055531_10006790 3300003794 Bacteria 6389
20 Ga0055531_10010629 3300003794 Bacteria 4549
21 Ga0065165_1004494 3300005262 Bacteria 8580
22 Ga0065165_1072659 3300005262 Bacteria 910
23 Ga0065704_10070230 3300005289 Bacteria 55750
24 Ga0065712_10452270 3300005290 Bacteria 685
25 Ga0065712_10679218 3300005290 Bacteria 555
26 Ga0070676_10046758 3300005328 Bacteria 2525
27 Ga0070690_100061564 3300005330 Bacteria 2418
28 Ga0068869_101432346 3300005334 Bacteria 612
29 Ga0070666_10067868 3300005335 Bacteria 2422
30 Ga0070666_10472965 3300005335 Bacteria 907
31 Ga0070680_100175739 3300005336 Bacteria 1803
32 Ga0070680_100195803 3300005336 Bacteria 1704
33 Ga0070682_100090750 3300005337 Bacteria 1999
34 Ga0068868_100049983 3300005338 Bacteria 3283
35 Ga0070660_101092502 3300005339 Bacteria 675
36 Ga0070691_10106883 3300005341 Bacteria 1396
37 Ga0070687_100854571 3300005343 Bacteria 649
38 Ga0070661_100615352 3300005344 Bacteria 879
39 Ga0070668_100024056 3300005347 Bacteria 4613
40 Ga0070668_100390240 3300005347 Bacteria 1187
41 Ga0070668_100473182 3300005347 Bacteria 1081
42 Ga0070668_100903627 3300005347 Bacteria 789
43 Ga0070669_100001396 3300005353 Bacteria 17436
44 Ga0070669_100011083 3300005353 Bacteria 6399
45 Ga0070669_100442699 3300005353 Bacteria 1070
46 Ga0070671_100029627 3300005355 Bacteria 4514
47 Ga0070671_100045828 3300005355 Bacteria 3636
48 Ga0070674_100187164 3300005356 Bacteria 1590
49 Ga0070674_100607304 3300005356 Bacteria 925
50 Ga0070673_100911838 3300005364 Bacteria 815
51 Ga0070667_100001289 3300005367 Bacteria 22650
52 Ga0070667_100019541 3300005367 Bacteria 5621
53 Ga0070667_100069757 3300005367 Bacteria 2991
54 Ga0070667_100897979 3300005367 Bacteria 825
55 Ga0070709_10001423 3300005434 Bacteria 12946
56 Ga0070709_10208027 3300005434 Bacteria 1389
57 Ga0070714_100014682 3300005435 Bacteria 6294
58 Ga0070714_100127032 3300005435 Bacteria 2275
59 Ga0070714_100208010 3300005435 Bacteria 1792
60 Ga0070714_100449290 3300005435 Bacteria 1224
61 Ga0070713_100005847 3300005436 Bacteria 8457
62 Ga0070713_100007642 3300005436 Bacteria 7608
63 Ga0070713_100063091 3300005436 Bacteria 3105
64 Ga0070713_100070335 3300005436 Bacteria 2954
65 Ga0070710_10002139 3300005437 Bacteria 9367
66 Ga0070710_10034735 3300005437 Bacteria 2745
67 Ga0070711_100018016 3300005439 Bacteria 4503
68 Ga0070711_100036221 3300005439 Bacteria 3305
69 Ga0070711_100623857 3300005439 Bacteria 901
70 Ga0070705_100079104 3300005440 Bacteria 2013
71 Ga0070700_100004668 3300005441 Bacteria 7180
72 Ga0070663_100006533 3300005455 Bacteria 7022
73 Ga0070663_100261983 3300005455 Bacteria 1372
74 Ga0070663_102106566 3300005455 Bacteria 508
75 Ga0070678_100085495 3300005456 Bacteria 2404
76 Ga0070678_101377533 3300005456 Bacteria 658
77 Ga0070681_10498576 3300005458 Bacteria 1131
78 Ga0070706_100003670 3300005467 Bacteria 15027
79 Ga0070707_100019597 3300005468 Bacteria 6374
80 Ga0070707_100673140 3300005468 Bacteria 997
81 Ga0070698_100008160 3300005471 Bacteria 11322
82 Ga0070699_100001192 3300005518 Bacteria 24008
83 Ga0070699_100777744 3300005518 Bacteria 876
84 Ga0070699_100827470 3300005518 Bacteria 847
85 Ga0070679_100752268 3300005530 Bacteria 917
86 Ga0070679_101786375 3300005530 Bacteria 563
87 Ga0070697_100235244 3300005536 Unclassified 1563
88 Ga0070697_100728931 3300005536 Bacteria 875
89 Ga0068853_100306409 3300005539 Bacteria 1469
90 Ga0068853_100439152 3300005539 Bacteria 1226
91 Ga0068853_100443121 3300005539 Bacteria 1221
92 Ga0068853_100629588 3300005539 Bacteria 1020
93 Ga0070695_100003309 3300005545 Bacteria 9420
94 Ga0070696_100013131 3300005546 Bacteria 5557
95 Ga0070696_100364406 3300005546 Bacteria 1122
96 Ga0070693_100286104 3300005547 Bacteria 1106
97 Ga0070693_100555303 3300005547 Bacteria 822
98 Ga0070665_100000107 3300005548 Bacteria 156048
99 Ga0070665_100061489 3300005548 Bacteria 3765
100 Ga0070665_100352307 3300005548 Bacteria 1478
101 Ga0070665_100523629 3300005548 Bacteria 1197
102 Ga0070665_102201547 3300005548 Bacteria 555
103 Ga0070704_100046524 3300005549 Bacteria 3026
104 Ga0068855_100067138 3300005563 Bacteria 4180
105 Ga0068855_100381920 3300005563 Bacteria 1546
106 Ga0068855_100850588 3300005563 Bacteria 967
107 Ga0070664_100604535 3300005564 Bacteria 1017
108 Ga0068857_100057015 3300005577 Bacteria 3467
109 Ga0068857_100493001 3300005577 Bacteria 1149
110 Ga0068857_101205282 3300005577 Bacteria 733
111 Ga0068856_100341046 3300005614 Bacteria 1517
112 Ga0068856_101438266 3300005614 Bacteria 704
113 Ga0070702_101305134 3300005615 Bacteria 589
114 Ga0068852_100252052 3300005616 Bacteria 1691
115 Ga0068852_100319614 3300005616 Bacteria 1507
116 Ga0068859_100132951 3300005617 Bacteria 2560
117 Ga0068859_100810810 3300005617 Bacteria 1023
118 Ga0068859_100915497 3300005617 Bacteria 961
119 Ga0068859_101161340 3300005617 Bacteria 850
120 Ga0068864_100153684 3300005618 Bacteria 2087
121 Ga0068861_100062658 3300005719 Bacteria 2857
122 Ga0068861_100105602 3300005719 Bacteria 2249
123 Ga0068861_100743177 3300005719 Bacteria 916
124 Ga0068863_100369401 3300005841 Bacteria 1400
125 Ga0068863_100418005 3300005841 Bacteria 1313
126 Ga0068863_100508869 3300005841 Bacteria 1186
127 Ga0068858_100000191 3300005842 Bacteria 65267
128 Ga0068858_100193011 3300005842 Bacteria 1924
129 Ga0068858_100218585 3300005842 Bacteria 1804
130 Ga0068858_100586328 3300005842 Bacteria 1081
131 Ga0068858_100685177 3300005842 Bacteria 997
132 Ga0068858_101741671 3300005842 Bacteria 615
133 Ga0068860_100004803 3300005843 Bacteria 13760
134 Ga0068860_100086315 3300005843 Bacteria 2986
135 Ga0068860_100453064 3300005843 Bacteria 1276
136 Ga0068860_101078900 3300005843 Bacteria 822
137 Ga0068860_102693611 3300005843 Bacteria 516
138 Ga0068862_100008499 3300005844 Bacteria 8492
139 Ga0068862_100140692 3300005844 Bacteria 2141
140 Ga0068862_100255458 3300005844 Bacteria 1598
141 Ga0068862_100313131 3300005844 Bacteria 1447
142 Ga0068862_101516253 3300005844 Bacteria 676
143 Ga0081455_10000028 3300005937 Bacteria 155778
144 Ga0081540_1146814 3300005983 Bacteria 937
145 Ga0081539_10004186 3300005985 Bacteria 16343
146 Ga0070717_10109011 3300006028 Bacteria 2360
147 Ga0070717_10215566 3300006028 Bacteria 1686
148 Ga0075365_10010971 3300006038 Bacteria 5308
149 Ga0075363_100099126 3300006048 Bacteria 1611
150 Ga0070715_10101757 3300006163 Bacteria 1341
151 Ga0070716_100007382 3300006173 Bacteria 5407
152 Ga0070716_100160910 3300006173 Bacteria 1454
153 Ga0070716_101238386 3300006173 Bacteria 601
154 Ga0070716_101635204 3300006173 Bacteria 530
155 Ga0070712_100069079 3300006175 Bacteria 2519
156 Ga0070712_100086611 3300006175 Bacteria 2283
157 Ga0070712_100181203 3300006175 Bacteria 1641
158 Ga0075362_10366830 3300006177 Bacteria 723
159 Ga0075367_10419691 3300006178 Bacteria 847
160 Ga0075369_10079358 3300006186 Bacteria 1454
161 Ga0097621_100581405 3300006237 Bacteria 1022
162 Ga0097621_100698468 3300006237 Bacteria 934
163 Ga0075370_10616697 3300006353 Bacteria 658
164 Ga0075370_10987169 3300006353 Bacteria 516
165 Ga0068871_100909268 3300006358 Bacteria 816
166 Ga0068871_100963154 3300006358 Bacteria 793
167 Ga0068871_101045841 3300006358 Bacteria 762
168 Ga0075428_100118734 3300006844 Bacteria 2880
169 Ga0075428_100629506 3300006844 Bacteria 1145
170 Ga0075428_100761957 3300006844 Bacteria 1030
171 Ga0075430_100023915 3300006846 Bacteria 5202
172 Ga0075431_100045525 3300006847 Bacteria 4523
173 Ga0075433_10880284 3300006852 Bacteria 781
174 Ga0075433_11097806 3300006852 Bacteria 692
175 Ga0075429_100178803 3300006880 Bacteria 1859
176 Ga0068865_100799318 3300006881 Bacteria 814
177 Ga0097620_100132952 3300006931 Bacteria 2560
178 Ga0097620_100810798 3300006931 Bacteria 1023
179 Ga0097620_100915335 3300006931 Bacteria 961
180 Ga0079104_1004974 3300006946 Bacteria 5469
181 Ga0105251_10002928 3300009011 Bacteria 12798
182 Ga0105240_10071684 3300009093 Bacteria 4284
183 Ga0105240_10266334 3300009093 Bacteria 1975
184 Ga0105240_10313742 3300009093 Bacteria 1789
185 Ga0105240_10344568 3300009093 Bacteria 1692
186 Ga0105240_10866579 3300009093 Bacteria 974
187 Ga0105240_12066597 3300009093 Bacteria 592
188 Ga0105240_12595983 3300009093 Bacteria 523
189 Ga0105245_10038965 3300009098 Bacteria 4229
190 Ga0105247_10042030 3300009101 Bacteria 2797
191 Ga0105247_10091810 3300009101 Bacteria 1929
192 Ga0105243_10221031 3300009148 Bacteria 1674
193 Ga0105241_10511434 3300009174 Bacteria 1072
194 Ga0105241_10977529 3300009174 Unclassified 791
195 Ga0105241_11380320 3300009174 Bacteria 674
196 Ga0105242_10235724 3300009176 Bacteria 1642
197 Ga0105242_10940489 3300009176 Bacteria 867
198 Ga0105242_12430828 3300009176 Bacteria 572
199 Ga0105248_10009594 3300009177 Bacteria 10655
200 Ga0105248_10128534 3300009177 Bacteria 2858
201 Ga0105248_10840293 3300009177 Bacteria 1036
202 Ga0105248_12128578 3300009177 Bacteria 638
203 Ga0105237_10042034 3300009545 Bacteria 4609
204 Ga0105237_10126238 3300009545 Bacteria 2553
205 Ga0105237_10174659 3300009545 Bacteria 2149
206 Ga0105237_10184617 3300009545 Bacteria 2086
207 Ga0105237_10257587 3300009545 Bacteria 1747
208 Ga0105237_10532929 3300009545 Bacteria 1181
209 Ga0105237_10684654 3300009545 Bacteria 1032
210 Ga0105238_10028484 3300009551 Bacteria 5691
211 Ga0105238_10051155 3300009551 Bacteria 4156
212 Ga0105238_10074351 3300009551 Bacteria 3391
213 Ga0105238_10184388 3300009551 Bacteria 2064
214 Ga0105238_10247466 3300009551 Bacteria 1760
215 Ga0105238_10563976 3300009551 Bacteria 1144
216 Ga0105238_10595445 3300009551 Bacteria 1113
217 Ga0105238_12399678 3300009551 Bacteria 563
218 Ga0105249_10016560 3300009553 Bacteria 6542
219 Ga0105249_10035426 3300009553 Bacteria 4527
220 Ga0105249_11263752 3300009553 Bacteria 810
221 Ga0105249_12913368 3300009553 Bacteria 549
222 Ga0105239_10057650 3300010375 Bacteria 4261
223 Ga0105239_10297273 3300010375 Bacteria 1818
224 Ga0105239_10492090 3300010375 Bacteria 1394
225 Ga0105239_11243597 3300010375 Bacteria 858
226 Ga0105246_10159677 3300011119 Bacteria 1716
227 Ga0105246_11116964 3300011119 Bacteria 721
228 Ga0157370_10437857 3300013104 Bacteria 1202
229 Ga0157369_10221063 3300013105 Bacteria 1983
230 Ga0157374_10217701 3300013296 Bacteria 1873
231 Ga0157374_10425174 3300013296 Bacteria 1327
232 Ga0163162_10311412 3300013306 Bacteria 1707
233 Ga0157372_10244458 3300013307 Bacteria 2082
234 Ga0163163_10073713 3300014325 Bacteria 3405
235 Ga0157380_10008850 3300014326 Bacteria 7193
236 Ga0157380_10269866 3300014326 Bacteria 1550
237 Ga0157379_10062199 3300014968 Bacteria 3339
238 Ga0157379_10377527 3300014968 Bacteria 1300
239 Ga0157379_10959339 3300014968 Bacteria 814
240 Ga0157376_10546009 3300014969 Bacteria 1146
241 Ga0163161_10022467 3300017792 Bacteria 4443
242 Ga0163161_10249882 3300017792 Bacteria 1382
243 Ga0163161_10542000 3300017792 Bacteria 952
244 Ga0206353_10448061 3300020082 Bacteria 769
245 Ga0154015_1344946 3300020610 Bacteria 582
246 Ga0213873_10013896 3300021358 Bacteria 1775
247 Ga0213872_10000119 3300021361 Bacteria 73666
248 Ga0213872_10000660 3300021361 Bacteria 26162
249 Ga0213872_10002314 3300021361 Bacteria 11358
250 Ga0213872_10003898 3300021361 Bacteria 8099
251 Ga0213872_10032146 3300021361 Bacteria 2405
252 Ga0213872_10061338 3300021361 Bacteria 1700
253 Ga0213872_10095690 3300021361 Bacteria 1326
254 Ga0213872_10156638 3300021361 Bacteria 992
255 Ga0213874_10145920 3300021377 Unclassified 822
256 Ga0213876_10008226 3300021384 Bacteria 5644
257 Ga0213876_10161123 3300021384 Bacteria 1193
258 Ga0213871_10014922 3300021441 Bacteria 1850
259 Ga0209437_101642 3300025233 Bacteria 5074
260 Ga0207425_1000461 3300025245 Bacteria 26109
261 Ga0207425_1088317 3300025245 Bacteria 509
262 Ga0209677_101787 3300025253 Bacteria 8887
263 Ga0209148_1008207 3300025254 Bacteria 2111
264 Ga0209148_1022875 3300025254 Bacteria 1000
265 Ga0209129_1000327 3300025258 Bacteria 41506
266 Ga0209233_1000044 3300025261 Bacteria 489783
267 Ga0209233_1003858 3300025261 Bacteria 5219
268 Ga0209565_1000052 3300025263 Bacteria 212056
269 Ga0209565_1028698 3300025263 Bacteria 1097
270 Ga0209455_1009381 3300025272 Bacteria 2575
271 Ga0209455_1010385 3300025272 Bacteria 2370
272 Ga0209673_1015739 3300025273 Bacteria 2857
273 Ga0209675_1000025 3300025291 Bacteria 294102
274 Ga0209676_1000221 3300025292 Bacteria 124715
275 Ga0209676_1000228 3300025292 Bacteria 123024
276 Ga0209676_1002468 3300025292 Bacteria 13057
277 Ga0209676_1078273 3300025292 Bacteria 761
278 Ga0209025_1001791 3300025294 Bacteria 25501
279 Ga0209025_1035515 3300025294 Bacteria 2251
280 Ga0209564_1009372 3300025295 Bacteria 4670
281 Ga0209564_1013638 3300025295 Bacteria 3432
282 Ga0209758_1000002 3300025297 Bacteria 1400310
283 Ga0209758_1000005 3300025297 Bacteria 1368918
284 Ga0209758_1000017 3300025297 Bacteria 754393
285 Ga0209758_1016463 3300025297 Bacteria 3754
286 Ga0209758_1028594 3300025297 Bacteria 2352
287 Ga0209050_1000001 3300025298 Bacteria 3563507
288 Ga0209050_1000042 3300025298 Bacteria 402842
289 Ga0209050_1000071 3300025298 Bacteria 295478
290 Ga0209050_1001886 3300025298 Bacteria 20130
291 Ga0209050_1015417 3300025298 Bacteria 3212
292 Ga0209050_1029003 3300025298 Bacteria 1781
293 Ga0207426_1011633 3300025302 Bacteria 3341
294 Ga0207426_1105283 3300025302 Bacteria 721
295 Ga0209051_1000297 3300025303 Bacteria 79062
296 Ga0209257_1000027 3300025304 Bacteria 703541
297 Ga0209257_1000135 3300025304 Bacteria 205668
298 Ga0209257_1000229 3300025304 Bacteria 133121
299 Ga0209257_1001829 3300025304 Bacteria 23270
300 Ga0209257_1001894 3300025304 Bacteria 22612
301 Ga0209257_1003342 3300025304 Bacteria 13875
302 Ga0207713_1004263 3300025735 Bacteria 9336
303 Ga0207713_1033482 3300025735 Bacteria 2244
304 Ga0207692_10043937 3300025898 Bacteria 2227
305 Ga0207692_10083142 3300025898 Bacteria 1717
306 Ga0207710_10684554 3300025900 Bacteria 538
307 Ga0207680_10071427 3300025903 Bacteria 2152
308 Ga0207680_10138961 3300025903 Bacteria 1609
309 Ga0207680_10203491 3300025903 Bacteria 1350
310 Ga0207685_10028613 3300025905 Bacteria 1964
311 Ga0207685_10655604 3300025905 Bacteria 568
312 Ga0207699_10010077 3300025906 Bacteria 4728
313 Ga0207699_10065501 3300025906 Bacteria 2203
314 Ga0207699_11266092 3300025906 Bacteria 546
315 Ga0207705_11032903 3300025909 Bacteria 634
316 Ga0207707_10002658 3300025912 Bacteria 15980
317 Ga0207707_10071401 3300025912 Bacteria 3025
318 Ga0207707_10144774 3300025912 Bacteria 2077
319 Ga0207695_10538634 3300025913 Bacteria 1049
320 Ga0207695_11670869 3300025913 Bacteria 518
321 Ga0207671_10067180 3300025914 Bacteria 2670
322 Ga0207671_10168284 3300025914 Bacteria 1701
323 Ga0207671_10475594 3300025914 Bacteria 996
324 Ga0207671_10509367 3300025914 Bacteria 959
325 Ga0207671_11461016 3300025914 Bacteria 529
326 Ga0207693_10098570 3300025915 Bacteria 2292
327 Ga0207693_10109179 3300025915 Bacteria 2170
328 Ga0207693_10117782 3300025915 Bacteria 2085
329 Ga0207693_10126768 3300025915 Bacteria 2006
330 Ga0207693_10200851 3300025915 Bacteria 1568
331 Ga0207663_10011331 3300025916 Bacteria 4786
332 Ga0207663_10036387 3300025916 Bacteria 2961
333 Ga0207660_10244669 3300025917 Bacteria 1414
334 Ga0207657_10209412 3300025919 Bacteria 1565
335 Ga0207657_10834300 3300025919 Bacteria 712
336 Ga0207652_10280822 3300025921 Bacteria 1502
337 Ga0207681_10000336 3300025923 Bacteria 33758
338 Ga0207681_10001866 3300025923 Bacteria 13505
339 Ga0207694_10015844 3300025924 Bacteria 5686
340 Ga0207694_10046214 3300025924 Bacteria 3365
341 Ga0207694_10293096 3300025924 Bacteria 1338
342 Ga0207694_10547196 3300025924 Bacteria 971
343 Ga0207694_10782955 3300025924 Bacteria 806
344 Ga0207694_11403348 3300025924 Bacteria 590
345 Ga0207650_10045454 3300025925 Bacteria 3230
346 Ga0207687_10012572 3300025927 Bacteria 5529
347 Ga0207700_10022828 3300025928 Bacteria 4299
348 Ga0207700_10027564 3300025928 Bacteria 3981
349 Ga0207700_10030799 3300025928 Bacteria 3804
350 Ga0207700_10256606 3300025928 Bacteria 1495
351 Ga0207664_10045578 3300025929 Bacteria 3439
352 Ga0207664_10119582 3300025929 Bacteria 2203
353 Ga0207664_10131807 3300025929 Bacteria 2105
354 Ga0207644_10001624 3300025931 Bacteria 14492
355 Ga0207644_10296244 3300025931 Bacteria 1302
356 Ga0207644_10712744 3300025931 Bacteria 837
357 Ga0207665_10000976 3300025939 Bacteria 19353
358 Ga0207665_10160349 3300025939 Bacteria 1617
359 Ga0207665_10976579 3300025939 Bacteria 673
360 Ga0207711_10028200 3300025941 Bacteria 4723
361 Ga0207711_10314840 3300025941 Bacteria 1445
362 Ga0207711_10700835 3300025941 Bacteria 944
363 Ga0207661_10258099 3300025944 Bacteria 1551
364 Ga0207661_10475759 3300025944 Bacteria 1140
365 Ga0207661_10934771 3300025944 Bacteria 799
366 Ga0207679_10751363 3300025945 Bacteria 887
367 Ga0207667_10634414 3300025949 Bacteria 1075
368 Ga0207712_10008807 3300025961 Bacteria 6379
369 Ga0207712_10067851 3300025961 Bacteria 2554
370 Ga0207712_10207620 3300025961 Bacteria 1558
371 Ga0207712_11536900 3300025961 Bacteria 596
372 Ga0207668_10010776 3300025972 Bacteria 5536
373 Ga0207668_10013861 3300025972 Bacteria 4978
374 Ga0207668_10184044 3300025972 Bacteria 1650
375 Ga0207668_10592281 3300025972 Bacteria 965
376 Ga0207668_10818030 3300025972 Bacteria 825
377 Ga0207640_10085705 3300025981 Bacteria 2167
378 Ga0207640_10183096 3300025981 Bacteria 1572
379 Ga0207658_10001483 3300025986 Bacteria 18220
380 Ga0207658_10034488 3300025986 Bacteria 3617
381 Ga0207658_10123356 3300025986 Bacteria 2069
382 Ga0207658_10771279 3300025986 Bacteria 872
383 Ga0207677_10248166 3300026023 Bacteria 1444
384 Ga0207703_10007705 3300026035 Bacteria 8526
385 Ga0207703_10188703 3300026035 Bacteria 1824
386 Ga0207703_10592531 3300026035 Bacteria 1048
387 Ga0207703_12265253 3300026035 Bacteria 519
388 Ga0207639_10075641 3300026041 Bacteria 2648
389 Ga0207639_10211713 3300026041 Bacteria 1669
390 Ga0207639_10388792 3300026041 Bacteria 1254
391 Ga0207639_10446323 3300026041 Bacteria 1174
392 Ga0207639_10560160 3300026041 Bacteria 1050
393 Ga0207678_10014682 3300026067 Bacteria 6891
394 Ga0207678_10176765 3300026067 Bacteria 1823
395 Ga0207702_10920852 3300026078 Bacteria 866
396 Ga0207702_12063245 3300026078 Bacteria 560
397 Ga0207641_10000078 3300026088 Bacteria 143842
398 Ga0207641_10494114 3300026088 Bacteria 1187
399 Ga0207676_10000420 3300026095 Bacteria 35827
400 Ga0207676_10128799 3300026095 Bacteria 2148
401 Ga0207676_10295353 3300026095 Bacteria 1477
402 Ga0207674_10072137 3300026116 Bacteria 3469
403 Ga0207674_10504362 3300026116 Bacteria 1169
404 Ga0207675_100190919 3300026118 Bacteria 1965
405 Ga0207698_10467043 3300026142 Bacteria 1221
406 Ga0207698_11112089 3300026142 Bacteria 803
407 Ga0209281_1010983 3300027111 Bacteria 2045
408 Ga0268266_10000462 3300028379 Bacteria 59105
409 Ga0268266_10177980 3300028379 Bacteria 1935
410 Ga0268266_10197593 3300028379 Bacteria 1839
411 Ga0268266_10228388 3300028379 Bacteria 1713
412 Ga0268265_10624763 3300028380 Bacteria 1032
413 Ga0268265_11506436 3300028380 Bacteria 676
414 Ga0268264_10000380 3300028381 Bacteria 64910
415 Ga0268264_10013595 3300028381 Bacteria 6700
416 Ga0268264_10064855 3300028381 Unclassified 3075
417 Ga0268264_11092426 3300028381 Bacteria 806
418 Ga0268264_11893108 3300028381 Bacteria 606
419 Ga0265337_1026672 3300028556 Bacteria 1748
420 Ga0265326_10006199 3300028558 Bacteria 3730
421 Ga0265319_1019753 3300028563 Bacteria 2509
422 Ga0265334_10096688 3300028573 Bacteria 1072
423 Ga0265318_10062097 3300028577 Bacteria 1391
424 Ga0265323_10002721 3300028653 Bacteria 7967
425 Ga0265336_10000661 3300028666 Bacteria 18756
426 Ga0307517_10111281 3300028786 Bacteria 2082
427 Ga0307517_10332500 3300028786 Bacteria 834
428 Ga0265338_10004433 3300028800 Bacteria 18963
429 Ga0265324_10003042 3300029957 Bacteria 8197
430 Ga0307511_10078058 3300030521 Bacteria 2351
431 Ga0314311_1103907 3300030733 Bacteria 1668
432 Ga0265330_10067230 3300031235 Bacteria 1553
433 Ga0265328_10302791 3300031239 Bacteria 617
434 Ga0265340_10017095 3300031247 Bacteria 3751
435 Ga0265339_10002135 3300031249 Bacteria 14404
436 Ga0265316_10018719 3300031344 Bacteria 5946
437 Ga0307513_10040717 3300031456 Bacteria 5135
438 Ga0265313_10005700 3300031595 Bacteria 9082
439 Ga0265342_10006876 3300031712 Bacteria 8406
440 Ga0316576_10009408 3300031727 Bacteria 6303
441 Ga0307413_10379862 3300031824 Bacteria 1100
442 Ga0307413_12198305 3300031824 Bacteria 500
443 Ga0307410_10599532 3300031852 Bacteria 919
444 Ga0307410_11527634 3300031852 Bacteria 589
445 Ga0307406_10130544 3300031901 Bacteria 1763
446 Ga0307406_10379585 3300031901 Bacteria 1114
447 Ga0307406_10814546 3300031901 Bacteria 789
448 Ga0307416_100924604 3300032002 Bacteria 973
449 Ga0307416_103599957 3300032002 Bacteria 518
450 Ga0307414_10018906 3300032004 Bacteria 4257
451 Ga0307414_10370884 3300032004 Bacteria 1234
452 Ga0307414_10686162 3300032004 Bacteria 926
453 Ga0307414_11039439 3300032004 Bacteria 755
454 Ga0307411_10242061 3300032005 Bacteria 1413
455 Ga0307411_10814350 3300032005 Bacteria 823
456 Ga0307411_10930565 3300032005 Bacteria 774
457 Ga0307510_10001188 3300033180 Bacteria 28138
458 Ga0307510_10009411 3300033180 Bacteria 11641
459 Ga0316596_1024383 3300033541 Bacteria 1553
460 Ga0373923_0099251 3300035111 Bacteria 1282
461 Ga0373936_0034305 3300035113 Bacteria 2015
462 Ga0373936_0038214 3300035113 Bacteria 1918
463 Ga0373945_0157692 3300035116 Bacteria 923
464 Ga0373954_0044080 3300035118 Bacteria 2081
465 Ga0373956_0010743 3300035119 Bacteria 3760
466 Ga0373943_0031224 3300035170 Bacteria 2526
467 Ga0373946_0330395 3300035171 Bacteria 759
468 Ga0373955_0078991 3300035172 Bacteria 1855
469 Ga0373924_0389448 3300035410 Bacteria 622
470 Ga0373931_0676333 3300035691 Bacteria 680
471 Ga0373935_0036452 3300035692 Bacteria 3075
472 Ga0373935_0101394 3300035692 Bacteria 1898
473 Ga0373935_0410667 3300035692 Bacteria 973
474 Ga0373927_0071440 3300035695 Bacteria 2246
475 Ga0373927_0141393 3300035695 Bacteria 1574
476 Ga0373927_0744352 3300035695 Bacteria 647
477 Ga0373933_0018114 3300035724 Bacteria 3957
478 Ga0373947_0263042 3300035725 Bacteria 1143
479 Ga0373937_0183822 3300036401 Bacteria 1963
480 Ga0373937_0214072 3300036401 Bacteria 1813
481 Ga0372808_033289 3300036459 Bacteria 739
482 Ga0373925_0089108 3300037068 Bacteria 2356
483 Ga0373925_0116422 3300037068 Bacteria 2070
484 Ga0373925_0152205 3300037068 Bacteria 1817
485 Ga0395899_0038201 3300037312 Bacteria 3597
486 Ga0395900_0074422 3300037418 Bacteria 3492
487 Ga0395900_0111866 3300037418 Bacteria 2804
488 Ga0395898_0087501 3300037466 Bacteria 3001
489 Ga0395905_0127369 3300037471 Bacteria 2394
490 Ga0395905_0818640 3300037471 Bacteria 834
491 Ga0436364_0701650 3300037853 Bacteria 8124
492 Ga0395901_0008255 3300038443 Bacteria 10523
493 Ga0395901_1059370 3300038443 Bacteria 783
494 Ga0395901_1847133 3300038443 Bacteria 553
495 Ga0400486_12864 3300038742 Bacteria 1962
496 Ga0436365_0815982 3300039437 Bacteria 1305
497 Ga0436365_1095754 3300039437 Bacteria 43052
498 Ga0436365_1707348 3300039437 Bacteria 3485
499 Ga0436360_0458992 3300039438 Bacteria 1121
500 Ga0436360_0630509 3300039438 Bacteria 1511
501 Ga0436360_0813945 3300039438 Bacteria 4345
502 Ga0436360_1300343 3300039438 Bacteria 977
503 Ga0436361_0033458 3300039447 Bacteria 563
504 Ga0436361_0067631 3300039447 Bacteria 62801
505 Ga0436361_0080624 3300039447 Bacteria 1826
506 Ga0436361_0120999 3300039447 Bacteria 7582
507 Ga0436361_0193989 3300039447 Bacteria 823
508 Ga0436361_0229583 3300039447 Bacteria 1092
509 Ga0436361_0241172 3300039447 Bacteria 1970
510 Ga0436361_0419875 3300039447 Bacteria 3848
511 Ga0436361_0430273 3300039447 Bacteria 992
512 Ga0436361_0543398 3300039447 Bacteria 1054
513 Ga0436361_0659391 3300039447 Bacteria 5192
514 Ga0436361_0660497 3300039447 Bacteria 1569
515 Ga0436361_0670518 3300039447 Bacteria 3422
516 Ga0436361_0867004 3300039447 Bacteria 10526
517 Ga0436361_0969043 3300039447 Bacteria 1038
518 Ga0436361_1115532 3300039447 Bacteria 2477
519 Ga0436361_1168992 3300039447 Bacteria 1260
520 Ga0436361_1181218 3300039447 Bacteria 870
521 Ga0436361_1193675 3300039447 Bacteria 723
522 Ga0436363_0004057 3300039450 Bacteria 904
523 Ga0436363_0243146 3300039450 Bacteria 1481
524 Ga0436363_0368964 3300039450 Bacteria 4916
525 Ga0436363_0592501 3300039450 Bacteria 656
526 Ga0436363_0641523 3300039450 Bacteria 1051
527 Ga0436363_1385665 3300039450 Bacteria 1133
528 Ga0436362_0143304 3300039453 Bacteria 5230
529 Ga0436362_0616710 3300039453 Bacteria 568
530 Ga0439461_0000157 3300041410 Bacteria 9230
531 Ga0439466_0099166 3300041411 Bacteria 909
532 Ga0439465_0001520 3300041413 Bacteria 7534
533 Ga0451793_1167052 3300041452 Bacteria 887
534 Ga0451800_0210168 3300041459 Bacteria 612
535 Ga0451806_017109 3300041462 Bacteria 1268
536 Ga0451807_1376495 3300041486 Bacteria 1447
537 Ga0451833_0151526 3300041491 Bacteria 874
538 Ga0451845_0678984 3300041501 Bacteria 1274
539 Ga0451847_0607255 3300041503 Bacteria 1021
540 Ga0451843_0743624 3300041509 Bacteria 1257
541 Ga0451853_0787389 3300041512 Bacteria 1484
542 Ga0451853_2451500 3300041512 Bacteria 988
543 Ga0439431_0000015 3300041997 Bacteria 27396
544 Ga0439442_001146 3300042002 Bacteria 5297
545 Ga0439445_0000834 3300042004 Bacteria 6512
546 Ga0439432_000156 3300042006 Bacteria 23244
547 Ga0439452_029791 3300042010 Bacteria 1351
548 Ga0439462_0000128 3300042015 Bacteria 11958
549 Ga0439434_0001220 3300042435 Bacteria 7404
550 Ga0451577_0948068 3300042876 Bacteria 774
551 Ga0466966_0740239 3300044684 Bacteria 593
552 Ga0466963_0511134 3300044694 Bacteria 848
553 Ga0466964_0087797 3300044706 Bacteria 1348
554 Ga0466959_0165881 3300045049 Bacteria 1551
555 Ga0466959_0405516 3300045049 Bacteria 926
556 Ga0466959_1177486 3300045049 Bacteria 509
557 Ga0466958_0984210 3300045836 Bacteria 550
558 Ga0466967_0302347 3300045976 Bacteria 1539
559 Ga0466967_0328329 3300045976 Bacteria 1477
560 Ga0466967_0379381 3300045976 Bacteria 1372
561 Ga0466967_1859959 3300045976 Bacteria 599
562 Ga0495603_0693965 3300046455 Bacteria 582
563 Ga0495629_0052144 3300046459 Bacteria 2863
564 Ga0495638_0226492 3300046460 Bacteria 1042
565 Ga0495653_0304560 3300046463 Bacteria 1038
566 Ga0495650_0002418 3300046471 Bacteria 15184
567 Ga0495650_0188459 3300046471 Bacteria 722
568 Ga0495580_0002795 3300046472 Bacteria 15019
569 Ga0495582_0268381 3300046473 Bacteria 979
570 Ga0495582_0469021 3300046473 Bacteria 727
571 Ga0495664_0079627 3300046477 Bacteria 1963
572 Ga0495664_0163724 3300046477 Bacteria 1349
573 Ga0495664_0177960 3300046477 Bacteria 1290
574 Ga0495583_0042528 3300046506 Bacteria 2121
575 Ga0495606_0050886 3300046507 Bacteria 2706
576 Ga0495606_0057434 3300046507 Bacteria 2506
577 Ga0495610_0001298 3300046512 Bacteria 22266
578 Ga0495610_0004939 3300046512 Bacteria 9667
579 Ga0495618_0243287 3300046514 Bacteria 1130
580 Ga0495620_0039396 3300046515 Bacteria 2088
581 Ga0495630_0342175 3300046517 Bacteria 1144
582 Ga0495632_0000989 3300046519 Bacteria 24804
583 Ga0495632_0005897 3300046519 Bacteria 7997
584 Ga0495632_0233036 3300046519 Unclassified 830
585 Ga0495643_0000217 3300046522 Bacteria 88279
586 Ga0495643_0059132 3300046522 Bacteria 2038
587 Ga0495643_0239338 3300046522 Bacteria 852
588 Ga0495648_0123539 3300046524 Bacteria 1387
589 Ga0495663_0000020 3300046525 Bacteria 124560
590 Ga0495666_0304448 3300046526 Bacteria 720
591 Ga0495642_0180344 3300046528 Bacteria 919
592 Ga0495654_0035543 3300046530 Bacteria 2508
593 Ga0495665_0033419 3300046531 Bacteria 2751
594 Ga0495640_0032013 3300046533 Bacteria 3749
595 Ga0495597_0176609 3300046542 Bacteria 865
596 Ga0495645_0068373 3300046543 Bacteria 2564
597 Ga0495633_0002856 3300046558 Bacteria 11862
598 Ga0495633_0006780 3300046558 Bacteria 6722
599 Ga0495667_0337242 3300046559 Bacteria 953
600 Ga0495668_0072625 3300046616 Bacteria 1890
601 Ga0495625_0028456 3300046660 Bacteria 4191
602 Ga0495625_0198397 3300046660 Bacteria 1326
603 Ga0495625_0474738 3300046660 Bacteria 769
604 Ga0495635_0026497 3300046663 Bacteria 4033
605 Ga0495599_0325152 3300046678 Bacteria 925
606 Ga0495647_0345779 3300046681 Bacteria 676
607 Ga0495658_0006493 3300046683 Bacteria 5745
608 Ga0495613_0753613 3300046689 Bacteria 638
609 Ga0495624_0335536 3300046690 Bacteria 910
610 Ga0495670_0000033 3300046691 Bacteria 81716
611 Ga0495670_0032461 3300046691 Bacteria 2597
612 Ga0495670_0044328 3300046691 Bacteria 2221
613 Ga0495670_0334791 3300046691 Bacteria 813
614 Ga0495581_0736715 3300047315 Bacteria 567
615 Ga0495674_0158783 3300047319 Bacteria 1893
616 Ga0495676_0153977 3300047321 Bacteria 1633
617 Ga0495683_0221725 3300047323 Bacteria 843
618 Ga0495677_0042316 3300047445 Bacteria 1668
619 Ga0495681_0001886 3300047470 Bacteria 15394
620 Ga0495684_0037420 3300047471 Bacteria 3721
621 Ga0495686_0000182 3300047472 Bacteria 119682
622 Ga0495686_0001777 3300047472 Bacteria 21960
623 Ga0495686_0002610 3300047472 Bacteria 16704
624 Ga0495686_0156238 3300047472 Bacteria 1336
625 Ga0495686_0157289 3300047472 Bacteria 1330
626 Ga0495593_0182816 3300047673 Bacteria 1056
627 Ga0495593_0208084 3300047673 Bacteria 982
628 Ga0495593_0602236 3300047673 Bacteria 552
629 Ga0496100_0028246 3300048903 Bacteria 3458
630 Ga0496100_0068809 3300048903 Bacteria 2356
631 Ga0496100_0198944 3300048903 Bacteria 1459
632 Ga0496100_0435705 3300048903 Bacteria 1003
633 Ga0496101_0077983 3300048904 Bacteria 2442
634 Ga0496101_0617338 3300048904 Bacteria 857
635 Ga0496102_0001012 3300048905 Bacteria 26288
636 Ga0496102_0150581 3300048905 Bacteria 2186
637 Ga0496102_0969020 3300048905 Bacteria 771
638 Ga0496103_0000246 3300048906 Bacteria 52692
639 Ga0496103_0227163 3300048906 Bacteria 1200
640 Ga0496103_0639758 3300048906 Bacteria 676
641 Ga0496103_0818047 3300048906 Bacteria 587
642 Ga0496104_0000227 3300048907 Bacteria 49451
643 Ga0496105_0000158 3300048908 Bacteria 44955
644 Ga0496106_0521103 3300048909 Bacteria 954
645 Ga0496107_0112102 3300048910 Bacteria 2005
646 Ga0496107_0229831 3300048910 Bacteria 1380
647 Ga0496108_0002299 3300048911 Bacteria 15309
648 Ga0496108_0350757 3300048911 Bacteria 1288
649 Ga0496112_0002829 3300048915 Bacteria 14089
650 Ga0496112_0380285 3300048915 Bacteria 1353
651 Ga0496113_0000325 3300048916 Bacteria 22755
652 Ga0496115_1021277 3300048918 Bacteria 631
653 Ga0496116_0021850 3300048919 Bacteria 4813
654 Ga0496116_0034688 3300048919 Bacteria 3555
655 Ga0496116_0078456 3300048919 Bacteria 2059
656 Ga0496116_0331149 3300048919 Bacteria 707
657 Ga0496116_0400782 3300048919 Bacteria 607
658 Ga0496117_0005510 3300048920 Bacteria 13257
659 Ga0496117_0030787 3300048920 Bacteria 4109
660 Ga0496117_0073876 3300048920 Bacteria 2273
661 Ga0496117_0525765 3300048920 Bacteria 568
662 Ga0496117_0611950 3300048920 Bacteria 508
663 Ga0496118_0002103 3300048921 Bacteria 27954
664 Ga0496118_0020790 3300048921 Bacteria 5809
665 Ga0496118_0048902 3300048921 Bacteria 3261
666 Ga0496118_0055157 3300048921 Bacteria 3002
667 Ga0496118_0084326 3300048921 Bacteria 2217
668 Ga0496118_0106434 3300048921 Bacteria 1876
669 Ga0496118_0322036 3300048921 Bacteria 838
670 Ga0496119_0000040 3300048922 Bacteria 208180
671 Ga0496119_0015177 3300048922 Bacteria 5960
672 Ga0496119_0020742 3300048922 Bacteria 4775
673 Ga0496119_0026083 3300048922 Bacteria 4062
674 Ga0496119_0171639 3300048922 Bacteria 1145
675 Ga0496119_0174071 3300048922 Bacteria 1134
676 Ga0496120_0000731 3300048923 Bacteria 48124
677 Ga0496120_0016388 3300048923 Bacteria 4843
678 Ga0496120_0147763 3300048923 Bacteria 1185
679 Ga0496120_0187439 3300048923 Bacteria 1011
680 Ga0496121_0000123 3300048924 Bacteria 172448
681 Ga0496121_0004891 3300048924 Bacteria 17582
682 Ga0496121_0007534 3300048924 Bacteria 13124
683 Ga0496121_0039007 3300048924 Bacteria 4194
684 Ga0496121_0072125 3300048924 Bacteria 2773
685 Ga0496121_0091767 3300048924 Bacteria 2370
686 Ga0496121_0095250 3300048924 Bacteria 2314
687 Ga0496122_0002442 3300048925 Bacteria 26362
688 Ga0496122_0003506 3300048925 Bacteria 20608
689 Ga0496122_0141145 3300048925 Bacteria 1507
690 Ga0496123_0001478 3300048926 Bacteria 32621
691 Ga0496123_0004521 3300048926 Bacteria 14538
692 Ga0496123_0294850 3300048926 Bacteria 777
693 Ga0496124_0004810 3300048927 Bacteria 15546
694 Ga0496124_0026551 3300048927 Bacteria 5219
695 Ga0496124_0069946 3300048927 Bacteria 2912
696 Ga0496124_0179411 3300048927 Bacteria 1631
697 Ga0496124_0314881 3300048927 Bacteria 1123
698 Ga0496124_0419387 3300048927 Bacteria 923
699 Ga0496125_0000205 3300048928 Bacteria 124391
700 Ga0496125_0006420 3300048928 Bacteria 12709
701 Ga0496125_0009566 3300048928 Bacteria 9931
702 Ga0496125_0017019 3300048928 Bacteria 6950
703 Ga0496125_0051422 3300048928 Bacteria 3398
704 Ga0496125_0060959 3300048928 Bacteria 3029
705 Ga0496125_0147758 3300048928 Bacteria 1621
706 Ga0496125_0148995 3300048928 Bacteria 1611
707 Ga0496125_0260140 3300048928 Bacteria 1088
708 Ga0496125_0270452 3300048928 Bacteria 1059
709 Ga0496125_0333183 3300048928 Bacteria 914
710 Ga0496125_0380740 3300048928 Bacteria 832
711 Ga0496125_0428620 3300048928 Bacteria 764
712 Ga0496126_0000044 3300048929 Bacteria 335904
713 Ga0496126_0046438 3300048929 Bacteria 3983
714 Ga0496126_0071283 3300048929 Bacteria 3093
715 Ga0496126_0081674 3300048929 Bacteria 2857
716 Ga0496126_0280298 3300048929 Bacteria 1381
717 Ga0496126_0295856 3300048929 Bacteria 1337
718 Ga0496126_0363117 3300048929 Bacteria 1182
719 Ga0496126_0839145 3300048929 Bacteria 702
720 Ga0501033_0096538 3300049570 Bacteria 2160
721 Ga0501034_0074018 3300049571 Bacteria 3415
722 Ga0501036_0207523 3300049572 Bacteria 1647
723 Ga0501039_0052158 3300049575 Bacteria 3165
724 Ga0501040_1440739 3300049576 Bacteria 500
725 Ga0501041_0068976 3300049577 Bacteria 2168
726 Ga0501042_0233453 3300049578 Bacteria 1327
727 Ga0501042_0378532 3300049578 Bacteria 1025
728 Ga0501043_1202228 3300049579 Bacteria 532
729 Ga0501046_0350514 3300049580 Bacteria 1072
730 Ga0501047_0044436 3300049581 Bacteria 4292
731 Ga0501047_0257298 3300049581 Bacteria 1594
732 Ga0501047_0846180 3300049581 Bacteria 729
733 Ga0501048_0000652 3300049582 Bacteria 24980
734 Ga0501070_0012367 3300049586 Bacteria 7199
735 Ga0501074_0393242 3300049590 Bacteria 983
736 Ga0501075_0151211 3300049591 Bacteria 1769
737 Ga0501077_0210483 3300049593 Bacteria 1235
738 Ga0501224_010896 3300049664 Bacteria 1335
739 Ga0501079_0056414 3300049741 Bacteria 3031
740 Ga0501080_0591613 3300049742 Bacteria 985
741 Ga0501081_0043910 3300049743 Bacteria 3067
742 Ga0501081_0104227 3300049743 Bacteria 2008
743 Ga0501083_0890265 3300049744 Bacteria 579
744 Ga0501035_0629207 3300049822 Bacteria 872
745 Ga0501044_0463473 3300049823 Bacteria 1172
746 Ga0501044_1021603 3300049823 Bacteria 698
747 Ga0501045_0533993 3300049824 Bacteria 870
748 nmdc:mga0yw44_152970_c1 3300050492 Bacteria 1506
749 nmdc:mga0yw44_7389_c1 3300050492 Bacteria 5402
750 nmdc:mga07m45_852321_c1 3300050496 Bacteria 522
751 nmdc:mga07m45_895112_c1 3300050496 Bacteria 508
752 nmdc:mga05p37_1186373_c1 3300050507 Bacteria 790
753 nmdc:mga09592_59967_c1 3300050508 Bacteria 3217
754 nmdc:mga0qj67_11371_c1 3300050509 Bacteria 6669
755 nmdc:mga0qj67_676320_c1 3300050509 Bacteria 822
756 nmdc:mga06r32_142172_c1 3300050510 Bacteria 2377
757 nmdc:mga0sz30_75519_c1 3300050516 Bacteria 1454
758 Ga0495601_0067983 3300053077 Bacteria 2270
759 Ga0495601_0227859 3300053077 Bacteria 1217
760 Ga0495612_0033254 3300053078 Bacteria 2086
761 Ga0495612_0253370 3300053078 Bacteria 783
762 Ga0495655_0298167 3300053083 Bacteria 553
763 Ga0495619_0393005 3300053085 Bacteria 958
764 Ga0495619_0679261 3300053085 Bacteria 701
765 Ga0500578_0197257 3300053086 Bacteria 1233
766 Ga0500643_002186 3300053087 Bacteria 10330
767 Ga0500644_0141251 3300053088 Bacteria 957
768 Ga0500644_0160254 3300053088 Bacteria 909
769 Ga0500646_0055461 3300053090 Bacteria 1154
770 Ga0500647_0225328 3300053091 Bacteria 837
771 Ga0500647_0280580 3300053091 Bacteria 720
772 Ga0500647_0340996 3300053091 Bacteria 627
773 Ga0500583_0245709 3300053092 Bacteria 884
774 Ga0500583_0320631 3300053092 Bacteria 755
775 Ga0500651_0018767 3300053093 Bacteria 4284
776 Ga0500651_0687012 3300053093 Unclassified 548
777 Ga0500641_0013594 3300053096 Bacteria 2992
778 Ga0500556_0004926 3300053104 Bacteria 3781
779 Ga0500556_0136344 3300053104 Bacteria 963
780 Ga0500562_022490 3300053108 Bacteria 1643
781 Ga0500562_063979 3300053108 Bacteria 990
782 Ga0500591_037645 3300053115 Bacteria 2316
783 Ga0500592_058894 3300053116 Bacteria 627
784 Ga0500594_0006551 3300053118 Bacteria 2620
785 Ga0500594_0318946 3300053118 Bacteria 522
786 Ga0500595_001175 3300053119 Bacteria 14475
787 Ga0500595_103422 3300053119 Bacteria 814
788 Ga0500608_000128 3300053122 Bacteria 30980
789 Ga0500658_0302080 3300053134 Unclassified 736
790 Ga0500559_0008678 3300053136 Bacteria 4441
791 Ga0500559_0148768 3300053136 Bacteria 1098
792 Ga0500564_001139 3300053138 Bacteria 8860
793 Ga0500568_0001898 3300053139 Bacteria 12852
794 Ga0500573_0159684 3300053140 Bacteria 1228
795 Ga0500573_0217348 3300053140 Bacteria 1005
796 Ga0500603_010373 3300053150 Bacteria 2103
797 Ga0500604_0055717 3300053151 Bacteria 1230
798 Ga0500616_0010388 3300053153 Bacteria 5573
799 Ga0500616_0061287 3300053153 Bacteria 1948
800 Ga0500622_0040507 3300053156 Bacteria 2425
801 Ga0500627_0000031 3300053158 Bacteria 90831
802 Ga0500627_0081936 3300053158 Bacteria 1439
803 Ga0500639_110383 3300053163 Bacteria 1339
804 Ga0500636_0179420 3300053177 Bacteria 1138
805 Ga0500567_002483 3300053723 Bacteria 7930
806 Ga0500611_123954 3300053727 Bacteria 691
807 Ga0500625_000051 3300053729 Bacteria 24610
808 Ga0500645_000234 3300053730 Bacteria 41931
809 Ga0500645_054265 3300053730 Bacteria 1166
810 Ga0500601_004546 3300053737 Bacteria 1513
811 Ga0501084_1119772 3300054114 Bacteria 661
812 Ga0500661_005233 3300055283 Bacteria 2427
813 Ga0500661_111799 3300055283 Bacteria 524
814 Ga0590077_066733 3300059426 Bacteria 819
815 Ga0530510_0345981 3300061734 Bacteria 1116
816 Ga0436362_0217235
817 SwRhRL2b_contig_2144200
818 JGI25150J39212_1000368
819 Ga0006759J45824_1076213
820 JGI25151J46595_10070633
821 JGI25153J46596_10000512
822 Ga0006777J48905_1008095
823 Ga0007416J51690_1070775
824 Ga0007429J51699_1004743
825 Ga0007429J51699_1114894
826 Ga0055529_1018251
827 Ga0055537_1002263
828 Ga0055537_1004290
829 Ga0055536_1006517
830 Ga0055536_1007944
831 Ga0055530_10000013
832 Ga0055530_10050136
833 Ga0055531_10000792
834 Ga0055531_10006790
835 Ga0055531_10010629
836 Ga0065165_1004494
837 Ga0065165_1072659
838 Ga0065704_10070230
839 Ga0065712_10452270
840 Ga0065712_10679218
841 Ga0070676_10046758
842 Ga0070690_100061564
843 Ga0068869_101432346
844 Ga0070666_10067868
845 Ga0070666_10472965
846 Ga0070680_100175739
847 Ga0070680_100195803
848 Ga0070682_100090750
849 Ga0068868_100049983
850 Ga0070660_101092502
851 Ga0070691_10106883
852 Ga0070687_100854571
853 Ga0070661_100615352
854 Ga0070668_100024056
855 Ga0070668_100390240
856 Ga0070668_100473182
857 Ga0070668_100903627
858 Ga0070669_100001396
859 Ga0070669_100011083
860 Ga0070669_100442699
861 Ga0070671_100029627
862 Ga0070671_100045828
863 Ga0070674_100187164
864 Ga0070674_100607304
865 Ga0070673_100911838
866 Ga0070667_100001289
867 Ga0070667_100019541
868 Ga0070667_100069757
869 Ga0070667_100897979
870 Ga0070709_10001423
871 Ga0070709_10208027
872 Ga0070714_100014682
873 Ga0070714_100127032
874 Ga0070714_100208010
875 Ga0070714_100449290
876 Ga0070713_100005847
877 Ga0070713_100007642
878 Ga0070713_100063091
879 Ga0070713_100070335
880 Ga0070710_10002139
881 Ga0070710_10034735
882 Ga0070711_100018016
883 Ga0070711_100036221
884 Ga0070711_100623857
885 Ga0070705_100079104
886 Ga0070700_100004668
887 Ga0070663_100006533
888 Ga0070663_100261983
889 Ga0070663_102106566
890 Ga0070678_100085495
891 Ga0070678_101377533
892 Ga0070681_10498576
893 Ga0070706_100003670
894 Ga0070707_100019597
895 Ga0070707_100673140
896 Ga0070698_100008160
897 Ga0070699_100001192
898 Ga0070699_100777744
899 Ga0070699_100827470
900 Ga0070679_100752268
901 Ga0070679_101786375
902 Ga0070697_100235244
903 Ga0070697_100728931
904 Ga0068853_100306409
905 Ga0068853_100439152
906 Ga0068853_100443121
907 Ga0068853_100629588
908 Ga0070695_100003309
909 Ga0070696_100013131
910 Ga0070696_100364406
911 Ga0070693_100286104
912 Ga0070693_100555303
913 Ga0070665_100000107
914 Ga0070665_100061489
915 Ga0070665_100352307
916 Ga0070665_100523629
917 Ga0070665_102201547
918 Ga0070704_100046524
919 Ga0068855_100067138
920 Ga0068855_100381920
921 Ga0068855_100850588
922 Ga0070664_100604535
923 Ga0068857_100057015
924 Ga0068857_100493001
925 Ga0068857_101205282
926 Ga0068856_100341046
927 Ga0068856_101438266
928 Ga0070702_101305134
929 Ga0068852_100252052
930 Ga0068852_100319614
931 Ga0068859_100132951
932 Ga0068859_100810810
933 Ga0068859_100915497
934 Ga0068859_101161340
935 Ga0068864_100153684
936 Ga0068861_100062658
937 Ga0068861_100105602
938 Ga0068861_100743177
939 Ga0068863_100369401
940 Ga0068863_100418005
941 Ga0068863_100508869
942 Ga0068858_100000191
943 Ga0068858_100193011
944 Ga0068858_100218585
945 Ga0068858_100586328
946 Ga0068858_100685177
947 Ga0068858_101741671
948 Ga0068860_100004803
949 Ga0068860_100086315
950 Ga0068860_100453064
951 Ga0068860_101078900
952 Ga0068860_102693611
953 Ga0068862_100008499
954 Ga0068862_100140692
955 Ga0068862_100255458
956 Ga0068862_100313131
957 Ga0068862_101516253
958 Ga0081455_10000028
959 Ga0081540_1146814
960 Ga0081539_10004186
961 Ga0070717_10109011
962 Ga0070717_10215566
963 Ga0075365_10010971
964 Ga0075363_100099126
965 Ga0070715_10101757
966 Ga0070716_100007382
967 Ga0070716_100160910
968 Ga0070716_101238386
969 Ga0070716_101635204
970 Ga0070712_100069079
971 Ga0070712_100086611
972 Ga0070712_100181203
973 Ga0075362_10366830
974 Ga0075367_10419691
975 Ga0075369_10079358
976 Ga0097621_100581405
977 Ga0097621_100698468
978 Ga0075370_10616697
979 Ga0075370_10987169
980 Ga0068871_100909268
981 Ga0068871_100963154
982 Ga0068871_101045841
983 Ga0075428_100118734
984 Ga0075428_100629506
985 Ga0075428_100761957
986 Ga0075430_100023915
987 Ga0075431_100045525
988 Ga0075433_10880284
989 Ga0075433_11097806
990 Ga0075429_100178803
991 Ga0068865_100799318
992 Ga0097620_100132952
993 Ga0097620_100810798
994 Ga0097620_100915335
995 Ga0079104_1004974
996 Ga0105251_10002928
997 Ga0105240_10071684
998 Ga0105240_10266334
999 Ga0105240_10313742
1000 Ga0105240_10344568
1001 Ga0105240_10866579
1002 Ga0105240_12066597
1003 Ga0105240_12595983
1004 Ga0105245_10038965
1005 Ga0105247_10042030
1006 Ga0105247_10091810
1007 Ga0105243_10221031
1008 Ga0105241_10511434
1009 Ga0105241_10977529
1010 Ga0105241_11380320
1011 Ga0105242_10235724
1012 Ga0105242_10940489
1013 Ga0105242_12430828
1014 Ga0105248_10009594
1015 Ga0105248_10128534
1016 Ga0105248_10840293
1017 Ga0105248_12128578
1018 Ga0105237_10042034
1019 Ga0105237_10126238
1020 Ga0105237_10174659
1021 Ga0105237_10184617
1022 Ga0105237_10257587
1023 Ga0105237_10532929
1024 Ga0105237_10684654
1025 Ga0105238_10028484
1026 Ga0105238_10051155
1027 Ga0105238_10074351
1028 Ga0105238_10184388
1029 Ga0105238_10247466
1030 Ga0105238_10563976
1031 Ga0105238_10595445
1032 Ga0105238_12399678
1033 Ga0105249_10016560
1034 Ga0105249_10035426
1035 Ga0105249_11263752
1036 Ga0105249_12913368
1037 Ga0105239_10057650
1038 Ga0105239_10297273
1039 Ga0105239_10492090
1040 Ga0105239_11243597
1041 Ga0105246_10159677
1042 Ga0105246_11116964
1043 Ga0157370_10437857
1044 Ga0157369_10221063
1045 Ga0157374_10217701
1046 Ga0157374_10425174
1047 Ga0163162_10311412
1048 Ga0157372_10244458
1049 Ga0163163_10073713
1050 Ga0157380_10008850
1051 Ga0157380_10269866
1052 Ga0157379_10062199
1053 Ga0157379_10377527
1054 Ga0157379_10959339
1055 Ga0157376_10546009
1056 Ga0163161_10022467
1057 Ga0163161_10249882
1058 Ga0163161_10542000
1059 Ga0206353_10448061
1060 Ga0154015_1344946
1061 Ga0213873_10013896
1062 Ga0213872_10000119
1063 Ga0213872_10000660
1064 Ga0213872_10002314
1065 Ga0213872_10003898
1066 Ga0213872_10032146
1067 Ga0213872_10061338
1068 Ga0213872_10095690
1069 Ga0213872_10156638
1070 Ga0213874_10145920
1071 Ga0213876_10008226
1072 Ga0213876_10161123
1073 Ga0213871_10014922
1074 Ga0209437_101642
1075 Ga0207425_1000461
1076 Ga0207425_1088317
1077 Ga0209677_101787
1078 Ga0209148_1008207
1079 Ga0209148_1022875
1080 Ga0209129_1000327
1081 Ga0209233_1000044
1082 Ga0209233_1003858
1083 Ga0209565_1000052
1084 Ga0209565_1028698
1085 Ga0209455_1009381
1086 Ga0209455_1010385
1087 Ga0209673_1015739
1088 Ga0209675_1000025
1089 Ga0209676_1000221
1090 Ga0209676_1000228
1091 Ga0209676_1002468
1092 Ga0209676_1078273
1093 Ga0209025_1001791
1094 Ga0209025_1035515
1095 Ga0209564_1009372
1096 Ga0209564_1013638
1097 Ga0209758_1000002
1098 Ga0209758_1000005
1099 Ga0209758_1000017
1100 Ga0209758_1016463
1101 Ga0209758_1028594
1102 Ga0209050_1000001
1103 Ga0209050_1000042
1104 Ga0209050_1000071
1105 Ga0209050_1001886
1106 Ga0209050_1015417
1107 Ga0209050_1029003
1108 Ga0207426_1011633
1109 Ga0207426_1105283
1110 Ga0209051_1000297
1111 Ga0209257_1000027
1112 Ga0209257_1000135
1113 Ga0209257_1000229
1114 Ga0209257_1001829
1115 Ga0209257_1001894
1116 Ga0209257_1003342
1117 Ga0207713_1004263
1118 Ga0207713_1033482
1119 Ga0207692_10043937
1120 Ga0207692_10083142
1121 Ga0207710_10684554
1122 Ga0207680_10071427
1123 Ga0207680_10138961
1124 Ga0207680_10203491
1125 Ga0207685_10028613
1126 Ga0207685_10655604
1127 Ga0207699_10010077
1128 Ga0207699_10065501
1129 Ga0207699_11266092
1130 Ga0207705_11032903
1131 Ga0207707_10002658
1132 Ga0207707_10071401
1133 Ga0207707_10144774
1134 Ga0207695_10538634
1135 Ga0207695_11670869
1136 Ga0207671_10067180
1137 Ga0207671_10168284
1138 Ga0207671_10475594
1139 Ga0207671_10509367
1140 Ga0207671_11461016
1141 Ga0207693_10098570
1142 Ga0207693_10109179
1143 Ga0207693_10117782
1144 Ga0207693_10126768
1145 Ga0207693_10200851
1146 Ga0207663_10011331
1147 Ga0207663_10036387
1148 Ga0207660_10244669
1149 Ga0207657_10209412
1150 Ga0207657_10834300
1151 Ga0207652_10280822
1152 Ga0207681_10000336
1153 Ga0207681_10001866
1154 Ga0207694_10015844
1155 Ga0207694_10046214
1156 Ga0207694_10293096
1157 Ga0207694_10547196
1158 Ga0207694_10782955
1159 Ga0207694_11403348
1160 Ga0207650_10045454
1161 Ga0207687_10012572
1162 Ga0207700_10022828
1163 Ga0207700_10027564
1164 Ga0207700_10030799
1165 Ga0207700_10256606
1166 Ga0207664_10045578
1167 Ga0207664_10119582
1168 Ga0207664_10131807
1169 Ga0207644_10001624
1170 Ga0207644_10296244
1171 Ga0207644_10712744
1172 Ga0207665_10000976
1173 Ga0207665_10160349
1174 Ga0207665_10976579
1175 Ga0207711_10028200
1176 Ga0207711_10314840
1177 Ga0207711_10700835
1178 Ga0207661_10258099
1179 Ga0207661_10475759
1180 Ga0207661_10934771
1181 Ga0207679_10751363
1182 Ga0207667_10634414
1183 Ga0207712_10008807
1184 Ga0207712_10067851
1185 Ga0207712_10207620
1186 Ga0207712_11536900
1187 Ga0207668_10010776
1188 Ga0207668_10013861
1189 Ga0207668_10184044
1190 Ga0207668_10592281
1191 Ga0207668_10818030
1192 Ga0207640_10085705
1193 Ga0207640_10183096
1194 Ga0207658_10001483
1195 Ga0207658_10034488
1196 Ga0207658_10123356
1197 Ga0207658_10771279
1198 Ga0207677_10248166
1199 Ga0207703_10007705
1200 Ga0207703_10188703
1201 Ga0207703_10592531
1202 Ga0207703_12265253
1203 Ga0207639_10075641
1204 Ga0207639_10211713
1205 Ga0207639_10388792
1206 Ga0207639_10446323
1207 Ga0207639_10560160
1208 Ga0207678_10014682
1209 Ga0207678_10176765
1210 Ga0207702_10920852
1211 Ga0207702_12063245
1212 Ga0207641_10000078
1213 Ga0207641_10494114
1214 Ga0207676_10000420
1215 Ga0207676_10128799
1216 Ga0207676_10295353
1217 Ga0207674_10072137
1218 Ga0207674_10504362
1219 Ga0207675_100190919
1220 Ga0207698_10467043
1221 Ga0207698_11112089
1222 Ga0209281_1010983
1223 Ga0268266_10000462
1224 Ga0268266_10177980
1225 Ga0268266_10197593
1226 Ga0268266_10228388
1227 Ga0268265_10624763
1228 Ga0268265_11506436
1229 Ga0268264_10000380
1230 Ga0268264_10013595
1231 Ga0268264_10064855
1232 Ga0268264_11092426
1233 Ga0268264_11893108
1234 Ga0265337_1026672
1235 Ga0265326_10006199
1236 Ga0265319_1019753
1237 Ga0265334_10096688
1238 Ga0265318_10062097
1239 Ga0265323_10002721
1240 Ga0265336_10000661
1241 Ga0307517_10111281
1242 Ga0307517_10332500
1243 Ga0265338_10004433
1244 Ga0265324_10003042
1245 Ga0307511_10078058
1246 Ga0314311_1103907
1247 Ga0265330_10067230
1248 Ga0265328_10302791
1249 Ga0265340_10017095
1250 Ga0265339_10002135
1251 Ga0265316_10018719
1252 Ga0307513_10040717
1253 Ga0265313_10005700
1254 Ga0265342_10006876
1255 Ga0316576_10009408
1256 Ga0307413_10379862
1257 Ga0307413_12198305
1258 Ga0307410_10599532
1259 Ga0307410_11527634
1260 Ga0307406_10130544
1261 Ga0307406_10379585
1262 Ga0307406_10814546
1263 Ga0307416_100924604
1264 Ga0307416_103599957
1265 Ga0307414_10018906
1266 Ga0307414_10370884
1267 Ga0307414_10686162
1268 Ga0307414_11039439
1269 Ga0307411_10242061
1270 Ga0307411_10814350
1271 Ga0307411_10930565
1272 Ga0307510_10001188
1273 Ga0307510_10009411
1274 Ga0316596_1024383
1275 Ga0373923_0099251
1276 Ga0373936_0034305
1277 Ga0373936_0038214
1278 Ga0373945_0157692
1279 Ga0373954_0044080
1280 Ga0373956_0010743
1281 Ga0373943_0031224
1282 Ga0373946_0330395
1283 Ga0373955_0078991
1284 Ga0373924_0389448
1285 Ga0373931_0676333
1286 Ga0373935_0036452
1287 Ga0373935_0101394
1288 Ga0373935_0410667
1289 Ga0373927_0071440
1290 Ga0373927_0141393
1291 Ga0373927_0744352
1292 Ga0373933_0018114
1293 Ga0373947_0263042
1294 Ga0373937_0183822
1295 Ga0373937_0214072
1296 Ga0372808_033289
1297 Ga0373925_0089108
1298 Ga0373925_0116422
1299 Ga0373925_0152205
1300 Ga0395899_0038201
1301 Ga0395900_0074422
1302 Ga0395900_0111866
1303 Ga0395898_0087501
1304 Ga0395905_0127369
1305 Ga0395905_0818640
1306 Ga0436364_0701650
1307 Ga0395901_0008255
1308 Ga0395901_1059370
1309 Ga0395901_1847133
1310 Ga0400486_12864
1311 Ga0436365_0815982
1312 Ga0436365_1095754
1313 Ga0436365_1707348
1314 Ga0436360_0458992
1315 Ga0436360_0630509
1316 Ga0436360_0813945
1317 Ga0436360_1300343
1318 Ga0436361_0033458
1319 Ga0436361_0067631
1320 Ga0436361_0080624
1321 Ga0436361_0120999
1322 Ga0436361_0193989
1323 Ga0436361_0229583
1324 Ga0436361_0241172
1325 Ga0436361_0419875
1326 Ga0436361_0430273
1327 Ga0436361_0543398
1328 Ga0436361_0659391
1329 Ga0436361_0660497
1330 Ga0436361_0670518
1331 Ga0436361_0867004
1332 Ga0436361_0969043
1333 Ga0436361_1115532
1334 Ga0436361_1168992
1335 Ga0436361_1181218
1336 Ga0436361_1193675
1337 Ga0436363_0004057
1338 Ga0436363_0243146
1339 Ga0436363_0368964
1340 Ga0436363_0592501
1341 Ga0436363_0641523
1342 Ga0436363_1385665
1343 Ga0436362_0143304
1344 Ga0436362_0616710
1345 Ga0439461_0000157
1346 Ga0439466_0099166
1347 Ga0439465_0001520
1348 Ga0451793_1167052
1349 Ga0451800_0210168
1350 Ga0451806_017109
1351 Ga0451807_1376495
1352 Ga0451833_0151526
1353 Ga0451845_0678984
1354 Ga0451847_0607255
1355 Ga0451843_0743624
1356 Ga0451853_0787389
1357 Ga0451853_2451500
1358 Ga0439431_0000015
1359 Ga0439442_001146
1360 Ga0439445_0000834
1361 Ga0439432_000156
1362 Ga0439452_029791
1363 Ga0439462_0000128
1364 Ga0439434_0001220
1365 Ga0451577_0948068
1366 Ga0466966_0740239
1367 Ga0466963_0511134
1368 Ga0466964_0087797
1369 Ga0466959_0165881
1370 Ga0466959_0405516
1371 Ga0466959_1177486
1372 Ga0466958_0984210
1373 Ga0466967_0302347
1374 Ga0466967_0328329
1375 Ga0466967_0379381
1376 Ga0466967_1859959
1377 Ga0495603_0693965
1378 Ga0495629_0052144
1379 Ga0495638_0226492
1380 Ga0495653_0304560
1381 Ga0495650_0002418
1382 Ga0495650_0188459
1383 Ga0495580_0002795
1384 Ga0495582_0268381
1385 Ga0495582_0469021
1386 Ga0495664_0079627
1387 Ga0495664_0163724
1388 Ga0495664_0177960
1389 Ga0495583_0042528
1390 Ga0495606_0050886
1391 Ga0495606_0057434
1392 Ga0495610_0001298
1393 Ga0495610_0004939
1394 Ga0495618_0243287
1395 Ga0495620_0039396
1396 Ga0495630_0342175
1397 Ga0495632_0000989
1398 Ga0495632_0005897
1399 Ga0495632_0233036
1400 Ga0495643_0000217
1401 Ga0495643_0059132
1402 Ga0495643_0239338
1403 Ga0495648_0123539
1404 Ga0495663_0000020
1405 Ga0495666_0304448
1406 Ga0495642_0180344
1407 Ga0495654_0035543
1408 Ga0495665_0033419
1409 Ga0495640_0032013
1410 Ga0495597_0176609
1411 Ga0495645_0068373
1412 Ga0495633_0002856
1413 Ga0495633_0006780
1414 Ga0495667_0337242
1415 Ga0495668_0072625
1416 Ga0495625_0028456
1417 Ga0495625_0198397
1418 Ga0495625_0474738
1419 Ga0495635_0026497
1420 Ga0495599_0325152
1421 Ga0495647_0345779
1422 Ga0495658_0006493
1423 Ga0495613_0753613
1424 Ga0495624_0335536
1425 Ga0495670_0000033
1426 Ga0495670_0032461
1427 Ga0495670_0044328
1428 Ga0495670_0334791
1429 Ga0495581_0736715
1430 Ga0495674_0158783
1431 Ga0495676_0153977
1432 Ga0495683_0221725
1433 Ga0495677_0042316
1434 Ga0495681_0001886
1435 Ga0495684_0037420
1436 Ga0495686_0000182
1437 Ga0495686_0001777
1438 Ga0495686_0002610
1439 Ga0495686_0156238
1440 Ga0495686_0157289
1441 Ga0495593_0182816
1442 Ga0495593_0208084
1443 Ga0495593_0602236
1444 Ga0496100_0028246
1445 Ga0496100_0068809
1446 Ga0496100_0198944
1447 Ga0496100_0435705
1448 Ga0496101_0077983
1449 Ga0496101_0617338
1450 Ga0496102_0001012
1451 Ga0496102_0150581
1452 Ga0496102_0969020
1453 Ga0496103_0000246
1454 Ga0496103_0227163
1455 Ga0496103_0639758
1456 Ga0496103_0818047
1457 Ga0496104_0000227
1458 Ga0496105_0000158
1459 Ga0496106_0521103
1460 Ga0496107_0112102
1461 Ga0496107_0229831
1462 Ga0496108_0002299
1463 Ga0496108_0350757
1464 Ga0496112_0002829
1465 Ga0496112_0380285
1466 Ga0496113_0000325
1467 Ga0496115_1021277
1468 Ga0496116_0021850
1469 Ga0496116_0034688
1470 Ga0496116_0078456
1471 Ga0496116_0331149
1472 Ga0496116_0400782
1473 Ga0496117_0005510
1474 Ga0496117_0030787
1475 Ga0496117_0073876
1476 Ga0496117_0525765
1477 Ga0496117_0611950
1478 Ga0496118_0002103
1479 Ga0496118_0020790
1480 Ga0496118_0048902
1481 Ga0496118_0055157
1482 Ga0496118_0084326
1483 Ga0496118_0106434
1484 Ga0496118_0322036
1485 Ga0496119_0000040
1486 Ga0496119_0015177
1487 Ga0496119_0020742
1488 Ga0496119_0026083
1489 Ga0496119_0171639
1490 Ga0496119_0174071
1491 Ga0496120_0000731
1492 Ga0496120_0016388
1493 Ga0496120_0147763
1494 Ga0496120_0187439
1495 Ga0496121_0000123
1496 Ga0496121_0004891
1497 Ga0496121_0007534
1498 Ga0496121_0039007
1499 Ga0496121_0072125
1500 Ga0496121_0091767
1501 Ga0496121_0095250
1502 Ga0496122_0002442
1503 Ga0496122_0003506
1504 Ga0496122_0141145
1505 Ga0496123_0001478
1506 Ga0496123_0004521
1507 Ga0496123_0294850
1508 Ga0496124_0004810
1509 Ga0496124_0026551
1510 Ga0496124_0069946
1511 Ga0496124_0179411
1512 Ga0496124_0314881
1513 Ga0496124_0419387
1514 Ga0496125_0000205
1515 Ga0496125_0006420
1516 Ga0496125_0009566
1517 Ga0496125_0017019
1518 Ga0496125_0051422
1519 Ga0496125_0060959
1520 Ga0496125_0147758
1521 Ga0496125_0148995
1522 Ga0496125_0260140
1523 Ga0496125_0270452
1524 Ga0496125_0333183
1525 Ga0496125_0380740
1526 Ga0496125_0428620
1527 Ga0496126_0000044
1528 Ga0496126_0046438
1529 Ga0496126_0071283
1530 Ga0496126_0081674
1531 Ga0496126_0280298
1532 Ga0496126_0295856
1533 Ga0496126_0363117
1534 Ga0496126_0839145
1535 Ga0501033_0096538
1536 Ga0501034_0074018
1537 Ga0501036_0207523
1538 Ga0501039_0052158
1539 Ga0501040_1440739
1540 Ga0501041_0068976
1541 Ga0501042_0233453
1542 Ga0501042_0378532
1543 Ga0501043_1202228
1544 Ga0501046_0350514
1545 Ga0501047_0044436
1546 Ga0501047_0257298
1547 Ga0501047_0846180
1548 Ga0501048_0000652
1549 Ga0501070_0012367
1550 Ga0501074_0393242
1551 Ga0501075_0151211
1552 Ga0501077_0210483
1553 Ga0501224_010896
1554 Ga0501079_0056414
1555 Ga0501080_0591613
1556 Ga0501081_0043910
1557 Ga0501081_0104227
1558 Ga0501083_0890265
1559 Ga0501035_0629207
1560 Ga0501044_0463473
1561 Ga0501044_1021603
1562 Ga0501045_0533993
1563 nmdc:mga0yw44_152970_c1
1564 nmdc:mga0yw44_7389_c1
1565 nmdc:mga07m45_852321_c1
1566 nmdc:mga07m45_895112_c1
1567 nmdc:mga05p37_1186373_c1
1568 nmdc:mga09592_59967_c1
1569 nmdc:mga0qj67_11371_c1
1570 nmdc:mga0qj67_676320_c1
1571 nmdc:mga06r32_142172_c1
1572 nmdc:mga0sz30_75519_c1
1573 Ga0495601_0067983
1574 Ga0495601_0227859
1575 Ga0495612_0033254
1576 Ga0495612_0253370
1577 Ga0495655_0298167
1578 Ga0495619_0393005
1579 Ga0495619_0679261
1580 Ga0500578_0197257
1581 Ga0500643_002186
1582 Ga0500644_0141251
1583 Ga0500644_0160254
1584 Ga0500646_0055461
1585 Ga0500647_0225328
1586 Ga0500647_0280580
1587 Ga0500647_0340996
1588 Ga0500583_0245709
1589 Ga0500583_0320631
1590 Ga0500651_0018767
1591 Ga0500651_0687012
1592 Ga0500641_0013594
1593 Ga0500556_0004926
1594 Ga0500556_0136344
1595 Ga0500562_022490
1596 Ga0500562_063979
1597 Ga0500591_037645
1598 Ga0500592_058894
1599 Ga0500594_0006551
1600 Ga0500594_0318946
1601 Ga0500595_001175
1602 Ga0500595_103422
1603 Ga0500608_000128
1604 Ga0500658_0302080
1605 Ga0500559_0008678
1606 Ga0500559_0148768
1607 Ga0500564_001139
1608 Ga0500568_0001898
1609 Ga0500573_0159684
1610 Ga0500573_0217348
1611 Ga0500603_010373
1612 Ga0500604_0055717
1613 Ga0500616_0010388
1614 Ga0500616_0061287
1615 Ga0500622_0040507
1616 Ga0500627_0000031
1617 Ga0500627_0081936
1618 Ga0500639_110383
1619 Ga0500636_0179420
1620 Ga0500567_002483
1621 Ga0500611_123954
1622 Ga0500625_000051
1623 Ga0500645_000234
1624 Ga0500645_054265
1625 Ga0500601_004546
1626 Ga0501084_1119772
1627 Ga0500661_005233
1628 Ga0500661_111799
1629 Ga0590077_066733
1630 Ga0530510_0345981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

25

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9818 12 123
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9732 12 123
2q2h-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9643 13 123
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.9582 14 123
2q2h-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9555 13 123
ID Description Score Start End Superfamily
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9568 14 123 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9483 14 123 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9474 12 123 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.939 12 123 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9269 10 123 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V5CWR8-F1-model_v4 deleted 0.9971 2 123
AF-A0A521LCG2-F1-model_v4 tRNA-binding protein 0.9927 41 123 GO:0000049
AF-C6XQR0-F1-model_v4 Export-related chaperone CsaA 0.9924 1 123 GO:0000049
AF-A0A6A5LB44-F1-model_v4 deleted 0.9916 13 123
AF-A0A356R983-F1-model_v4 tRNA-binding protein 0.9905 24 123 GO:0000049

Map