F482045

General Info

Members Datasets Scaffolds Average Seq Length
816 605 1632 274

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10017261|Ga0075367_100172614
Length 292
Sequence MTDITMETGTTSFRPGTSDKEIEAAALKAIKRRKQTVLFWQIAILVAALGLWELSSDFGWIDPFFYSSPSGVVQRLYEWSTEGTTEGSLWYHLGVTMEEALIGFFTGSIAGVVVGVGLGRNPMLSDIFSVYIKAINSIPRVVLAPIFIMIMGLGLASKVALAFVMVFFVVFANAFQGVREADRDMIANARILGASDWQVTRTVIIPSAMSWIFASLHVSFGFAIIGAIVGEFVGARFGIGQLISIAKGTFDSAGMFAAIVLVMIVTLAAEFVMTLVENRLAKWRPQQSLDTH

Samples

Sample ID Description Type Environment
1 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
72 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
169 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
170 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
171 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
292 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
293 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
299 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
300 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
301 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
302 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
307 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
308 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
309 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
310 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
311 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
312 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
315 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
316 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
317 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
318 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
319 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
323 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
324 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
325 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
326 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
327 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
328 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
329 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
330 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
331 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
332 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
333 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
334 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
335 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
336 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
337 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
338 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
339 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
340 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
341 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
342 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
343 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
344 2519899620 Rhizobium sp. Pop5 Isolate Nodule
345 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
346 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
347 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
348 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
349 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
350 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
351 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
352 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
353 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
354 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
355 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
356 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
357 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
358 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
359 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
360 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
361 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
362 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
363 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
364 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
365 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
366 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
367 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
368 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
369 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
370 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
371 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
372 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
373 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
374 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
375 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
376 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
377 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
378 2718217882 Rhizobium sp. N741 Isolate Nodule
379 2718217927 Rhizobium sp. N324 Isolate Nodule
380 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
381 2718218009 Rhizobium sp. N561 Isolate Nodule
382 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
383 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
384 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
385 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
386 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
387 2718218363 Rhizobium sp. N113 Isolate Nodule
388 2718218365 Rhizobium sp. N731 Isolate Nodule
389 2718218366 Rhizobium sp. N621 Isolate Nodule
390 2718218423 Rhizobium sp. N941 Isolate Nodule
391 2721755514 Rhizobium sp. N6212 Isolate Nodule
392 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
393 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
394 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
395 2721755809 Rhizobium sp. N541 Isolate Nodule
396 2721755810 Rhizobium sp. N871 Isolate Nodule
397 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
398 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
399 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
400 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
401 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
402 2728369365 Rhizobium sp. N1341 Isolate Nodule
403 2728369397 Rhizobium sp. N1314 Isolate Nodule
404 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
405 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
406 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
407 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
408 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
409 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
410 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
411 2791355256 Rhizobium sp. M10 Isolate Nodule
412 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
413 2791355261 Rhizobium sp. J15 Isolate Nodule
414 2791355262 Rhizobium sp. M1 Isolate Nodule
415 2791355263 Rhizobium chutanense C5 Isolate Nodule
416 2791355264 Rhizobium sp. S9 Isolate Nodule
417 2791355265 Rhizobium sp. H4 Isolate Nodule
418 2791355266 Rhizobium sp. L43 Isolate Nodule
419 2791355267 Rhizobium sp. L18 Isolate Nodule
420 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
421 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
422 2802429633 Rhizobium anhuiense J3 Isolate Nodule
423 2802429634 Rhizobium anhuiense S10 Isolate Nodule
424 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
425 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
426 2802429637 Rhizobium anhuiense C15 Isolate Nodule
427 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
428 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
429 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
430 2818991467 Bosea vestrisii 3192 Isolate Unclassified
431 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
432 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
433 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
434 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
435 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
436 2838048938 Rhizobium pisi 27/80 Isolate Nodule
437 2838061910 Rhizobium phaseoli L15 Isolate Nodule
438 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
439 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
440 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
441 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
442 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
443 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
444 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
445 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
446 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
447 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
448 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
449 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
450 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
451 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
452 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
453 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
454 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
455 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
456 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
457 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
458 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
459 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
460 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
461 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
462 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
463 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
464 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
465 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
466 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
467 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
468 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
469 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
470 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
471 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
472 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
473 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
474 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
475 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
476 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
477 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
478 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
479 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
480 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
481 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
482 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
483 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
484 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
485 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
486 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
487 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
488 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
489 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
490 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
491 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
492 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
493 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
494 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
495 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
496 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
497 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
498 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
499 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
500 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
501 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
502 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
503 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
504 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
505 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
506 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
507 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
508 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
509 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
510 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
511 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
512 2885266251 Ralstonia sp. SET104 Isolate Nodule
513 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
514 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
515 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
516 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
517 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
518 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
519 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
520 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
521 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
522 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
523 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
524 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
525 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
526 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
527 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
528 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
529 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
530 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
531 2933599457 Rhizobium phaseoli M3 Isolate Nodule
532 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
533 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
534 2936381700 Rhizobium chutanense C16 Isolate Unclassified
535 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
536 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
537 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
538 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
539 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
540 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
541 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
542 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
543 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
544 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
545 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
546 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
547 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
548 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
549 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
550 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
551 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
552 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
553 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
554 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
555 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
556 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
557 2996887358 Rhizobium sp. R711 Isolate Nodule
558 2996893221 Rhizobium sp. R635 Isolate Nodule
559 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
560 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
561 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
562 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
563 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
564 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
565 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
566 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
567 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
568 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
569 8005258706 Rhizobium sp. R693 Isolate Nodule
570 8005275841 Rhizobium sp. N4311 Isolate Nodule
571 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
572 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
573 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
574 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
575 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
576 8005321885 Rhizobium sp. R72 Isolate Nodule
577 8005382845 Rhizobium sp. R634 Isolate Nodule
578 8005395548 Rhizobium sp. R339 Isolate Nodule
579 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
580 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
581 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
582 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
583 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
584 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
585 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
586 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
587 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
588 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
589 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
590 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
591 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
592 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
593 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
594 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
595 8018176218 Rhizobium sp. N122 Isolate Nodule
596 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
597 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
598 8024501048 Rhizobium sp. H4 Isolate Nodule
599 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
600 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
601 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
602 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
603 8056382006 Rhizobium croatiense 13T Isolate Nodule
604 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
605 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.71
Metatranscriptomes 0.37
Isolates 34.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.38
Nodule 27.08
Rhizoplane 3.68
Rhizosphere 37.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075367_10017261 3300006178 Bacteria 3958
2 JGI24740J21852_10000004 3300001979 Bacteria 91019
3 JGI24740J21852_10003496 3300001979 Bacteria 6889
4 JGI24739J22299_10014069 3300001989 Bacteria 2914
5 JGI24737J22298_10015335 3300001990 Bacteria 2480
6 JGI24735J21928_10019816 3300002067 Bacteria 2066
7 JGI25155J39150_1000004 3300002704 Bacteria 269098
8 JGI25156J39149_1000014 3300002705 Bacteria 189257
9 JGI25162J39368_1000176 3300002737 Bacteria 68840
10 JGI25162J39368_1000405 3300002737 Bacteria 35507
11 JGI25154J39366_1000026 3300002738 Bacteria 200613
12 JGI25154J39366_1000096 3300002738 Bacteria 79168
13 JGI25157J39369_1000005 3300002741 Bacteria 269089
14 JGI25152J39213_1002060 3300002773 Bacteria 7914
15 JGI25159J45721_1000387 3300002987 Bacteria 20451
16 JGI25151J46595_10000959 3300003187 Bacteria 22046
17 JGI25165J46597_1000190 3300003214 Bacteria 91363
18 JGI25165J46597_1000328 3300003214 Bacteria 56610
19 JGI25153J46596_10002309 3300003215 Bacteria 11089
20 JGI25153J46596_10056106 3300003215 Bacteria 1098
21 rootH1_10056207 3300003316 Bacteria 6970
22 rootL2_10002812 3300003322 Bacteria 40354
23 rootL2_10034088 3300003322 Bacteria 8960
24 rootL2_10199716 3300003322 Bacteria 2403
25 rootH1_10012054 3300003323 Bacteria 3264
26 JGI25160J50197_1000022 3300003354 Bacteria 201071
27 JGI25160J50197_1010328 3300003354 Bacteria 3385
28 JGI25160J50197_1020744 3300003354 Bacteria 1973
29 JGI25161J50226_1000139 3300003374 Bacteria 50307
30 JGI25161J50226_1004271 3300003374 Bacteria 3029
31 Ga0055535_1000770 3300003761 Bacteria 23736
32 Ga0055542_1000875 3300003762 Bacteria 21006
33 Ga0055529_1000622 3300003763 Bacteria 26539
34 Ga0055526_1000722 3300003771 Bacteria 25003
35 Ga0055526_1001290 3300003771 Bacteria 17969
36 Ga0055526_1007701 3300003771 Bacteria 5533
37 Ga0055524_1004653 3300003775 Bacteria 6292
38 Ga0055524_1017972 3300003775 Bacteria 2474
39 Ga0055524_1036748 3300003775 Bacteria 1311
40 Ga0055528_1000267 3300003790 Bacteria 44269
41 Ga0055528_1000310 3300003790 Bacteria 41194
42 Ga0055528_1001158 3300003790 Bacteria 17071
43 Ga0055528_1013301 3300003790 Bacteria 3126
44 Ga0055528_1018866 3300003790 Bacteria 2317
45 Ga0055528_1032507 3300003790 Bacteria 1329
46 Ga0055540_1000098 3300003792 Bacteria 96649
47 Ga0058692_1023728 3300003856 Bacteria 1242
48 Ga0055543_1000125 3300004625 Bacteria 63343
49 Ga0055543_1000477 3300004625 Bacteria 23520
50 Ga0065165_1001084 3300005262 Bacteria 32438
51 Ga0065165_1003916 3300005262 Bacteria 9824
52 Ga0070670_100000186 3300005331 Bacteria 56675
53 Ga0068869_100291828 3300005334 Bacteria 1314
54 Ga0070680_100203322 3300005336 Bacteria 1671
55 Ga0070668_100062558 3300005347 Bacteria 2884
56 Ga0070659_100118535 3300005366 Bacteria 2141
57 Ga0070667_100072057 3300005367 Bacteria 2943
58 Ga0070714_100476522 3300005435 Bacteria 1188
59 Ga0070663_100017519 3300005455 Bacteria 4677
60 Ga0070663_100167137 3300005455 Bacteria 1698
61 Ga0070678_100078545 3300005456 Bacteria 2493
62 Ga0070679_100123324 3300005530 Bacteria 2574
63 Ga0070684_100039745 3300005535 Bacteria 4048
64 Ga0070697_100173729 3300005536 Bacteria 1824
65 Ga0068853_100079915 3300005539 Bacteria 2860
66 Ga0070665_100147437 3300005548 Bacteria 2356
67 Ga0068855_100074120 3300005563 Bacteria 3953
68 Ga0068855_100206891 3300005563 Bacteria 2207
69 Ga0068855_100435557 3300005563 Bacteria 1432
70 Ga0068857_100052386 3300005577 Bacteria 3621
71 Ga0068854_100003244 3300005578 Bacteria 10142
72 Ga0068856_100068339 3300005614 Bacteria 3512
73 Ga0068856_100117526 3300005614 Bacteria 2660
74 Ga0068856_100121297 3300005614 Bacteria 2616
75 Ga0068852_100039189 3300005616 Bacteria 3988
76 Ga0068852_100040965 3300005616 Bacteria 3912
77 Ga0068852_100420827 3300005616 Bacteria 1318
78 Ga0068851_10000708 3300005834 Bacteria 14221
79 Ga0068858_100077471 3300005842 Bacteria 3089
80 Ga0075365_10013444 3300006038 Bacteria 4896
81 Ga0075365_10025191 3300006038 Bacteria 3764
82 Ga0075365_10033111 3300006038 Bacteria 3327
83 Ga0075365_10212204 3300006038 Bacteria 1357
84 Ga0075368_10008162 3300006042 Bacteria 3720
85 Ga0075364_10037754 3300006051 Bacteria 3129
86 Ga0070712_100039339 3300006175 Bacteria 3236
87 Ga0075362_10082545 3300006177 Bacteria 1483
88 Ga0075367_10017114 3300006178 Bacteria 3973
89 Ga0075369_10004067 3300006186 Bacteria 5375
90 Ga0075366_10001819 3300006195 Bacteria 10770
91 Ga0097621_100103113 3300006237 Bacteria 2402
92 Ga0075370_10000447 3300006353 Bacteria 15399
93 Ga0075370_10020254 3300006353 Bacteria 3634
94 Ga0075370_10096700 3300006353 Bacteria 1707
95 Ga0075370_10202589 3300006353 Bacteria 1171
96 Ga0105244_10065307 3300009036 Bacteria 1823
97 Ga0105250_10080224 3300009092 Bacteria 1322
98 Ga0105240_10000013 3300009093 Bacteria 483458
99 Ga0105240_10047463 3300009093 Bacteria 5434
100 Ga0105240_10069581 3300009093 Bacteria 4355
101 Ga0105245_10042130 3300009098 Bacteria 4073
102 Ga0105245_10474751 3300009098 Bacteria 1263
103 Ga0105243_10351563 3300009148 Bacteria 1353
104 Ga0105241_10006350 3300009174 Bacteria 8713
105 Ga0105241_10037067 3300009174 Bacteria 3672
106 Ga0105242_10301794 3300009176 Bacteria 1462
107 Ga0105248_10303915 3300009177 Bacteria 1797
108 Ga0105237_10003026 3300009545 Bacteria 20277
109 Ga0105237_10034571 3300009545 Bacteria 5117
110 Ga0105238_10010637 3300009551 Bacteria 9242
111 Ga0105238_10040051 3300009551 Bacteria 4750
112 Ga0123341_1000002 3300009765 Bacteria 191257
113 Ga0123341_1060290 3300009765 Bacteria 1881
114 Ga0123342_1021626 3300009766 Bacteria 4489
115 Ga0123342_1047491 3300009766 Bacteria 1365
116 Ga0099796_10015771 3300010159 Bacteria 2216
117 Ga0105239_10008517 3300010375 Bacteria 11658
118 Ga0105239_10043023 3300010375 Bacteria 4949
119 Ga0105239_10280874 3300010375 Bacteria 1874
120 Ga0105239_10504524 3300010375 Bacteria 1375
121 Ga0105246_10012687 3300011119 Bacteria 5265
122 Ga0157370_10000776 3300013104 Bacteria 40017
123 Ga0157370_10004045 3300013104 Bacteria 17021
124 Ga0157370_10282691 3300013104 Bacteria 1533
125 Ga0157369_10115331 3300013105 Bacteria 2853
126 Ga0157374_10013709 3300013296 Bacteria 7081
127 Ga0157378_10766473 3300013297 Bacteria 989
128 Ga0163162_10095304 3300013306 Bacteria 3062
129 Ga0163162_10410020 3300013306 Bacteria 1488
130 Ga0157375_10043163 3300013308 Bacteria 4370
131 Ga0163163_10492163 3300014325 Bacteria 1288
132 Ga0157377_10365736 3300014745 Bacteria 972
133 Ga0157379_10234919 3300014968 Bacteria 1662
134 Ga0182005_1013625 3300015265 Bacteria 2286
135 Ga0213872_10000877 3300021361 Bacteria 21747
136 Ga0213872_10000895 3300021361 Bacteria 21436
137 Ga0213872_10113541 3300021361 Bacteria 1201
138 Ga0213874_10003479 3300021377 Bacteria 3496
139 Ga0209435_100009 3300025206 Bacteria 476614
140 Ga0209563_101969 3300025230 Bacteria 4940
141 Ga0209437_100057 3300025233 Bacteria 362922
142 Ga0209437_100206 3300025233 Bacteria 115048
143 Ga0209258_100342 3300025242 Bacteria 68390
144 Ga0207425_1004420 3300025245 Bacteria 4223
145 Ga0209646_1000018 3300025246 Bacteria 476716
146 Ga0209026_1000043 3300025250 Bacteria 269142
147 Ga0209677_100446 3300025253 Bacteria 24001
148 Ga0209148_1000056 3300025254 Bacteria 363380
149 Ga0209148_1004253 3300025254 Bacteria 3578
150 Ga0209759_1000007 3300025256 Bacteria 476614
151 Ga0209759_1000816 3300025256 Bacteria 24775
152 Ga0209129_1000353 3300025258 Bacteria 38674
153 Ga0209129_1000355 3300025258 Bacteria 38491
154 Ga0209129_1008563 3300025258 Bacteria 2829
155 Ga0209129_1009834 3300025258 Bacteria 2461
156 Ga0209233_1000130 3300025261 Bacteria 205687
157 Ga0209233_1000178 3300025261 Bacteria 140956
158 Ga0209233_1000256 3300025261 Bacteria 80855
159 Ga0209455_1000214 3300025272 Bacteria 81374
160 Ga0209455_1000511 3300025272 Bacteria 27782
161 Ga0209673_1000022 3300025273 Bacteria 413125
162 Ga0209673_1000138 3300025273 Bacteria 158321
163 Ga0209673_1000206 3300025273 Bacteria 118136
164 Ga0209673_1000760 3300025273 Bacteria 43954
165 Ga0209673_1008483 3300025273 Bacteria 4567
166 Ga0209673_1011786 3300025273 Bacteria 3576
167 Ga0209130_1000108 3300025284 Bacteria 133733
168 Ga0209676_1053548 3300025292 Bacteria 1046
169 Ga0209025_1000190 3300025294 Bacteria 153726
170 Ga0209025_1001576 3300025294 Bacteria 28831
171 Ga0209025_1008668 3300025294 Bacteria 7270
172 Ga0209025_1057512 3300025294 Bacteria 1485
173 Ga0209564_1000440 3300025295 Bacteria 71511
174 Ga0209564_1002550 3300025295 Bacteria 14020
175 Ga0209564_1004320 3300025295 Bacteria 8777
176 Ga0209564_1008576 3300025295 Bacteria 5018
177 Ga0209564_1013193 3300025295 Bacteria 3531
178 Ga0209758_1000245 3300025297 Bacteria 111769
179 Ga0209758_1004506 3300025297 Bacteria 11554
180 Ga0209758_1005978 3300025297 Bacteria 9012
181 Ga0209758_1006439 3300025297 Bacteria 8436
182 Ga0209758_1009016 3300025297 Bacteria 6304
183 Ga0209758_1035942 3300025297 Bacteria 1943
184 Ga0209050_1010904 3300025298 Bacteria 4399
185 Ga0209256_1000696 3300025299 Bacteria 44631
186 Ga0209256_1000970 3300025299 Bacteria 34492
187 Ga0209256_1001032 3300025299 Bacteria 32691
188 Ga0209256_1006727 3300025299 Bacteria 5958
189 Ga0209256_1010839 3300025299 Bacteria 3747
190 Ga0207426_1000082 3300025302 Bacteria 298939
191 Ga0207426_1000109 3300025302 Bacteria 238665
192 Ga0207426_1001015 3300025302 Bacteria 27187
193 Ga0209051_1000264 3300025303 Bacteria 87736
194 Ga0209051_1014171 3300025303 Bacteria 3736
195 Ga0209257_1004220 3300025304 Bacteria 11383
196 Ga0207656_10001363 3300025321 Bacteria 8048
197 Ga0207688_10100592 3300025901 Bacteria 1669
198 Ga0207647_10000972 3300025904 Bacteria 22175
199 Ga0207654_10000729 3300025911 Bacteria 18348
200 Ga0207654_10068195 3300025911 Bacteria 2104
201 Ga0207695_10000044 3300025913 Bacteria 440819
202 Ga0207695_10026423 3300025913 Bacteria 6479
203 Ga0207695_10066797 3300025913 Bacteria 3691
204 Ga0207671_10000497 3300025914 Bacteria 53394
205 Ga0207671_10100148 3300025914 Bacteria 2194
206 Ga0207693_10116020 3300025915 Bacteria 2102
207 Ga0207660_10066561 3300025917 Bacteria 2607
208 Ga0207657_10002575 3300025919 Bacteria 19610
209 Ga0207652_10502052 3300025921 Bacteria 1092
210 Ga0207694_10003030 3300025924 Bacteria 13468
211 Ga0207694_10041527 3300025924 Bacteria 3545
212 Ga0207650_10000437 3300025925 Bacteria 36104
213 Ga0207650_10197982 3300025925 Bacteria 1608
214 Ga0207687_10069228 3300025927 Bacteria 2516
215 Ga0207687_10137996 3300025927 Bacteria 1846
216 Ga0207690_10318889 3300025932 Bacteria 1221
217 Ga0207686_10090479 3300025934 Bacteria 2019
218 Ga0207709_10166073 3300025935 Bacteria 1544
219 Ga0207689_10175147 3300025942 Bacteria 1769
220 Ga0207667_10084436 3300025949 Bacteria 3287
221 Ga0207667_10224858 3300025949 Bacteria 1923
222 Ga0207668_10065644 3300025972 Bacteria 2570
223 Ga0207640_10044590 3300025981 Bacteria 2842
224 Ga0207640_10287415 3300025981 Bacteria 1295
225 Ga0207658_10046261 3300025986 Bacteria 3177
226 Ga0207677_10068448 3300026023 Bacteria 2492
227 Ga0207703_10044646 3300026035 Bacteria 3563
228 Ga0207639_10030210 3300026041 Bacteria 3972
229 Ga0207678_10025687 3300026067 Bacteria 5141
230 Ga0207678_10088160 3300026067 Bacteria 2652
231 Ga0207702_10000003 3300026078 Bacteria 434196
232 Ga0207702_10092073 3300026078 Bacteria 2656
233 Ga0207702_10177695 3300026078 Bacteria 1958
234 Ga0207648_10179862 3300026089 Bacteria 1872
235 Ga0207683_10010329 3300026121 Bacteria 7963
236 Ga0207683_10571088 3300026121 Bacteria 1046
237 Ga0207698_10052292 3300026142 Bacteria 3129
238 Ga0207698_10283438 3300026142 Bacteria 1534
239 Ga0209371_1001399 3300027312 Bacteria 16549
240 Ga0209179_1008838 3300027512 Bacteria 1710
241 Ga0268266_10069718 3300028379 Bacteria 3047
242 Ga0268264_10314839 3300028381 Bacteria 1478
243 Ga0268256_1004035 3300030500 Bacteria 6307
244 Ga0265332_10000014 3300031238 Bacteria 249035
245 Ga0307513_10112041 3300031456 Bacteria 2720
246 Ga0265314_10062274 3300031711 Bacteria 2536
247 Ga0265314_10071321 3300031711 Bacteria 2325
248 Ga0307405_10010050 3300031731 Bacteria 4882
249 Ga0307406_10007541 3300031901 Bacteria 6040
250 Ga0307510_10053093 3300033180 Bacteria 4265
251 Ga0373938_0024842 3300034957 Bacteria 1242
252 Ga0373943_0008616 3300035170 Bacteria 4573
253 Ga0373955_0172583 3300035172 Bacteria 1280
254 Ga0373924_0175875 3300035410 Bacteria 941
255 Ga0373931_0027047 3300035691 Bacteria 2924
256 Ga0373931_0214466 3300035691 Bacteria 1156
257 Ga0373935_0000354 3300035692 Bacteria 23386
258 Ga0373927_0000265 3300035695 Bacteria 41459
259 Ga0373927_0004375 3300035695 Bacteria 9906
260 Ga0373927_0020052 3300035695 Bacteria 4385
261 Ga0373933_0167988 3300035724 Bacteria 1395
262 Ga0373947_0004190 3300035725 Bacteria 8462
263 Ga0373947_0015251 3300035725 Bacteria 4412
264 Ga0373937_0123081 3300036401 Bacteria 2418
265 Ga0373925_0006149 3300037068 Bacteria 8865
266 Ga0373925_0013841 3300037068 Bacteria 5841
267 Ga0395900_0019859 3300037418 Bacteria 6849
268 Ga0395900_0031285 3300037418 Bacteria 5466
269 Ga0395898_0044213 3300037466 Bacteria 4387
270 Ga0395898_0110809 3300037466 Bacteria 2630
271 Ga0395905_0001232 3300037471 Bacteria 31813
272 Ga0395905_0018431 3300037471 Bacteria 6625
273 Ga0395905_0030803 3300037471 Bacteria 5052
274 Ga0395905_0060100 3300037471 Bacteria 3554
275 Ga0395905_0211449 3300037471 Bacteria 1817
276 Ga0395905_0270839 3300037471 Bacteria 1584
277 Ga0436361_0146255 3300039447 Bacteria 25628
278 Ga0436361_0280903 3300039447 Bacteria 12591
279 Ga0436361_0951475 3300039447 Bacteria 1230
280 Ga0436361_1080875 3300039447 Bacteria 19487
281 Ga0436363_0750994 3300039450 Bacteria 9988
282 Ga0451833_0575160 3300041491 Bacteria 3069
283 Ga0451833_0630363 3300041491 Bacteria 2884
284 Ga0451847_0221458 3300041503 Bacteria 2190
285 Ga0451843_0087885 3300041509 Bacteria 1042
286 Ga0451843_0869831 3300041509 Bacteria 1466
287 Ga0451855_0206026 3300041511 Bacteria 1518
288 Ga0451853_2943458 3300041512 Bacteria 1348
289 Ga0451577_0006848 3300042876 Bacteria 11288
290 Ga0453683_0207399 3300044673 Bacteria 1245
291 Ga0466966_0000108 3300044684 Bacteria 50952
292 Ga0466961_0086004 3300044693 Bacteria 1988
293 Ga0466963_0004123 3300044694 Bacteria 8405
294 Ga0466963_0009644 3300044694 Bacteria 5820
295 Ga0453684_0020440 3300044712 Bacteria 9984
296 Ga0453684_0032029 3300044712 Bacteria 7371
297 Ga0466959_0001228 3300045049 Bacteria 15477
298 Ga0451576_0034048 3300045051 Bacteria 5412
299 Ga0466958_0000395 3300045836 Bacteria 17834
300 Ga0495592_0010550 3300046454 Bacteria 6967
301 Ga0495603_0000521 3300046455 Bacteria 21337
302 Ga0495603_0006219 3300046455 Bacteria 7140
303 Ga0495603_0011257 3300046455 Bacteria 5419
304 Ga0495629_0000416 3300046459 Bacteria 35794
305 Ga0495629_0136158 3300046459 Bacteria 1710
306 Ga0495638_0000373 3300046460 Bacteria 55670
307 Ga0495638_0058806 3300046460 Bacteria 2381
308 Ga0495638_0079199 3300046460 Bacteria 1998
309 Ga0495641_0033497 3300046461 Bacteria 2437
310 Ga0495651_0030505 3300046462 Bacteria 4205
311 Ga0495651_0050264 3300046462 Bacteria 3217
312 Ga0495653_0153585 3300046463 Bacteria 1606
313 Ga0495580_0004213 3300046472 Bacteria 12094
314 Ga0495580_0108213 3300046472 Bacteria 1930
315 Ga0495582_0000497 3300046473 Bacteria 21510
316 Ga0495582_0034499 3300046473 Bacteria 2781
317 Ga0495605_0020531 3300046474 Bacteria 3509
318 Ga0495605_0026112 3300046474 Bacteria 3038
319 Ga0495639_0000827 3300046475 Bacteria 14118
320 Ga0495639_0010220 3300046475 Bacteria 4038
321 Ga0495639_0043476 3300046475 Bacteria 2030
322 Ga0495639_0109638 3300046475 Bacteria 1309
323 Ga0495662_0000367 3300046476 Bacteria 19860
324 Ga0495662_0007097 3300046476 Bacteria 5560
325 Ga0495664_0056426 3300046477 Bacteria 2337
326 Ga0495585_0037873 3300046492 Bacteria 2715
327 Ga0495594_0000194 3300046499 Bacteria 29650
328 Ga0495607_0023626 3300046501 Bacteria 3845
329 Ga0495583_0023484 3300046506 Bacteria 3118
330 Ga0495583_0045089 3300046506 Bacteria 2041
331 Ga0495606_0013214 3300046507 Bacteria 6549
332 Ga0495606_0061345 3300046507 Bacteria 2405
333 Ga0495610_0008012 3300046512 Bacteria 6921
334 Ga0495616_0065780 3300046513 Bacteria 1765
335 Ga0495618_0052753 3300046514 Bacteria 2571
336 Ga0495618_0126338 3300046514 Bacteria 1638
337 Ga0495620_0011952 3300046515 Bacteria 4510
338 Ga0495628_0126343 3300046516 Bacteria 1959
339 Ga0495630_0188492 3300046517 Bacteria 1573
340 Ga0495630_0197768 3300046517 Bacteria 1534
341 Ga0495630_0481246 3300046517 Bacteria 952
342 Ga0495631_0050162 3300046518 Bacteria 1826
343 Ga0495643_0015214 3300046522 Bacteria 4554
344 Ga0495643_0044629 3300046522 Bacteria 2408
345 Ga0495643_0111911 3300046522 Bacteria 1387
346 Ga0495648_0002325 3300046524 Bacteria 17689
347 Ga0495648_0030003 3300046524 Bacteria 3602
348 Ga0495666_0070724 3300046526 Bacteria 1659
349 Ga0495652_0032802 3300046529 Bacteria 4538
350 Ga0495652_0197062 3300046529 Bacteria 1532
351 Ga0495654_0017301 3300046530 Bacteria 3792
352 Ga0495665_0000800 3300046531 Bacteria 16467
353 Ga0495665_0065520 3300046531 Bacteria 1918
354 Ga0495640_0005387 3300046533 Bacteria 10181
355 Ga0495640_0173186 3300046533 Bacteria 1378
356 Ga0495586_0064007 3300046535 Bacteria 2004
357 Ga0495587_0147694 3300046536 Bacteria 1340
358 Ga0495645_0007519 3300046543 Bacteria 7584
359 Ga0495645_0166473 3300046543 Bacteria 1520
360 Ga0495622_0020290 3300046557 Bacteria 3094
361 Ga0495633_0022070 3300046558 Bacteria 3173
362 Ga0495667_0122036 3300046559 Bacteria 1682
363 Ga0495656_0071862 3300046615 Bacteria 1539
364 Ga0495668_0002042 3300046616 Bacteria 17569
365 Ga0495634_0000602 3300046642 Bacteria 34812
366 Ga0495634_0124827 3300046642 Bacteria 1646
367 Ga0495625_0122795 3300046660 Bacteria 1766
368 Ga0495625_0235193 3300046660 Bacteria 1195
369 Ga0495635_0008057 3300046663 Bacteria 7360
370 Ga0495661_0012341 3300046665 Bacteria 5769
371 Ga0495661_0059141 3300046665 Bacteria 2282
372 Ga0495588_0040450 3300046674 Bacteria 2378
373 Ga0495588_0079515 3300046674 Bacteria 1711
374 Ga0495646_0192434 3300046680 Bacteria 1114
375 Ga0495647_0012690 3300046681 Bacteria 2906
376 Ga0495658_0000593 3300046683 Bacteria 19832
377 Ga0495613_0001953 3300046689 Bacteria 15646
378 Ga0495670_0013926 3300046691 Bacteria 3956
379 Ga0495671_0085352 3300046692 Bacteria 1547
380 Ga0495649_0020268 3300046694 Bacteria 3731
381 Ga0495600_0016779 3300046809 Bacteria 4654
382 Ga0495660_0018153 3300046810 Bacteria 4044
383 Ga0495581_0000133 3300047315 Bacteria 32384
384 Ga0495581_0039931 3300047315 Bacteria 2717
385 Ga0495674_0000874 3300047319 Bacteria 28828
386 Ga0495676_0021332 3300047321 Bacteria 5661
387 Ga0495680_0121626 3300047322 Bacteria 1927
388 Ga0495681_0049119 3300047470 Bacteria 1996
389 Ga0495684_0021929 3300047471 Bacteria 4917
390 Ga0495686_0000090 3300047472 Bacteria 193179
391 Ga0495686_0009064 3300047472 Bacteria 7217
392 Ga0495686_0089407 3300047472 Bacteria 1871
393 Ga0495686_0257917 3300047472 Bacteria 977
394 Ga0495593_0000022 3300047673 Bacteria 69741
395 Ga0495602_0175312 3300048088 Bacteria 1660
396 Ga0495602_0226096 3300048088 Bacteria 1409
397 Ga0495626_0024957 3300048091 Bacteria 2926
398 Ga0496100_0073535 3300048903 Bacteria 2288
399 Ga0496100_0163842 3300048903 Bacteria 1596
400 Ga0496102_0195462 3300048905 Bacteria 1906
401 Ga0496103_0013416 3300048906 Bacteria 4858
402 Ga0496104_0004491 3300048907 Bacteria 12157
403 Ga0496104_0045777 3300048907 Bacteria 4117
404 Ga0496104_0104336 3300048907 Bacteria 2716
405 Ga0496104_0242475 3300048907 Bacteria 1715
406 Ga0496105_0025936 3300048908 Bacteria 4775
407 Ga0496105_0039864 3300048908 Bacteria 3872
408 Ga0496106_0027770 3300048909 Bacteria 4215
409 Ga0496106_0086752 3300048909 Bacteria 2411
410 Ga0496107_0002052 3300048910 Bacteria 12878
411 Ga0496108_0068748 3300048911 Bacteria 2988
412 Ga0496110_0009445 3300048913 Bacteria 7898
413 Ga0496110_0540527 3300048913 Bacteria 1059
414 Ga0496111_0057294 3300048914 Bacteria 2821
415 Ga0496112_0068217 3300048915 Bacteria 3512
416 Ga0496112_0625386 3300048915 Bacteria 1007
417 Ga0496113_0095103 3300048916 Bacteria 2302
418 Ga0496113_0228668 3300048916 Bacteria 1483
419 Ga0496113_0304470 3300048916 Bacteria 1276
420 Ga0496114_0057512 3300048917 Bacteria 3247
421 Ga0496115_0010980 3300048918 Bacteria 6781
422 Ga0496115_0074802 3300048918 Bacteria 2751
423 Ga0496115_0132525 3300048918 Bacteria 2054
424 Ga0496116_0000216 3300048919 Bacteria 108542
425 Ga0496116_0003756 3300048919 Bacteria 14849
426 Ga0496116_0035714 3300048919 Bacteria 3488
427 Ga0496116_0171039 3300048919 Bacteria 1177
428 Ga0496117_0001639 3300048920 Bacteria 31496
429 Ga0496117_0031632 3300048920 Bacteria 4036
430 Ga0496117_0072325 3300048920 Bacteria 2306
431 Ga0496117_0102556 3300048920 Bacteria 1805
432 Ga0496118_0001422 3300048921 Bacteria 36121
433 Ga0496118_0002888 3300048921 Bacteria 22381
434 Ga0496118_0057612 3300048921 Bacteria 2910
435 Ga0496118_0080551 3300048921 Bacteria 2291
436 Ga0496119_0004579 3300048922 Bacteria 13664
437 Ga0496119_0079050 3300048922 Bacteria 1901
438 Ga0496119_0127927 3300048922 Bacteria 1388
439 Ga0496119_0214143 3300048922 Bacteria 989
440 Ga0496120_0016909 3300048923 Bacteria 4749
441 Ga0496120_0054972 3300048923 Bacteria 2253
442 Ga0496120_0092272 3300048923 Bacteria 1615
443 Ga0496120_0101030 3300048923 Bacteria 1524
444 Ga0496121_0001525 3300048924 Bacteria 38839
445 Ga0496121_0047971 3300048924 Bacteria 3638
446 Ga0496121_0051661 3300048924 Bacteria 3460
447 Ga0496121_0130683 3300048924 Bacteria 1880
448 Ga0496121_0197929 3300048924 Bacteria 1435
449 Ga0496122_0002437 3300048925 Bacteria 26428
450 Ga0496122_0018774 3300048925 Bacteria 6361
451 Ga0496122_0021846 3300048925 Bacteria 5710
452 Ga0496122_0064697 3300048925 Bacteria 2658
453 Ga0496123_0004314 3300048926 Bacteria 15093
454 Ga0496123_0037937 3300048926 Bacteria 3395
455 Ga0496124_0000023 3300048927 Bacteria 415226
456 Ga0496124_0039852 3300048927 Bacteria 4067
457 Ga0496124_0050073 3300048927 Bacteria 3561
458 Ga0496124_0179111 3300048927 Bacteria 1633
459 Ga0496125_0000154 3300048928 Bacteria 152240
460 Ga0496125_0001251 3300048928 Bacteria 37908
461 Ga0496125_0029696 3300048928 Bacteria 4907
462 Ga0496125_0157271 3300048928 Bacteria 1550
463 Ga0496125_0206661 3300048928 Bacteria 1280
464 Ga0496126_0101205 3300048929 Bacteria 2521
465 Ga0496126_0190996 3300048929 Bacteria 1734
466 Ga0495678_038391 3300049459 Bacteria 1938
467 Ga0495682_0141534 3300049460 Bacteria 859
468 Ga0501033_0000692 3300049570 Bacteria 31217
469 Ga0501033_0211008 3300049570 Bacteria 1385
470 Ga0501038_0477352 3300049574 Bacteria 956
471 Ga0501067_0041476 3300049583 Bacteria 2556
472 Ga0501070_0024967 3300049586 Bacteria 5012
473 Ga0501073_0182035 3300049589 Bacteria 1454
474 Ga0501083_0036549 3300049744 Bacteria 3350
475 Ga0501035_0000157 3300049822 Bacteria 83835
476 Ga0501044_0109959 3300049823 Bacteria 2765
477 nmdc:mga0yw44_18839_c1 3300050492 Bacteria 3791
478 nmdc:mga0yw44_26478_c1 3300050492 Bacteria 3313
479 nmdc:mga0k408_20467_c1 3300050493 Bacteria 3707
480 nmdc:mga07m45_32899_c1 3300050496 Bacteria 2877
481 nmdc:mga07m45_90264_c1 3300050496 Bacteria 1755
482 nmdc:mga0sz30_23992_c1 3300050516 Bacteria 2487
483 Ga0495595_0006793 3300053084 Bacteria 4670
484 Ga0495619_0010247 3300053085 Bacteria 5901
485 Ga0495619_0241116 3300053085 Bacteria 1253
486 Ga0500578_0015703 3300053086 Bacteria 4861
487 Ga0500581_021254 3300053089 Bacteria 3282
488 Ga0500583_0164034 3300053092 Bacteria 1107
489 Ga0500651_0008860 3300053093 Bacteria 5949
490 Ga0500651_0017164 3300053093 Bacteria 4460
491 Ga0500566_0001411 3300053094 Bacteria 14068
492 Ga0500650_0014378 3300053098 Bacteria 3345
493 Ga0500554_000403 3300053102 Bacteria 9153
494 Ga0500556_0003108 3300053104 Bacteria 4953
495 Ga0500562_011794 3300053108 Bacteria 2219
496 Ga0500569_005433 3300053109 Bacteria 2739
497 Ga0500595_000650 3300053119 Bacteria 20929
498 Ga0500608_039048 3300053122 Bacteria 2272
499 Ga0500608_059560 3300053122 Bacteria 1827
500 Ga0500614_065366 3300053123 Bacteria 987
501 Ga0500618_000028 3300053125 Bacteria 140440
502 Ga0500618_000184 3300053125 Bacteria 51349
503 Ga0500618_042324 3300053125 Bacteria 1043
504 Ga0500642_0000050 3300053130 Bacteria 79050
505 Ga0500652_000113 3300053131 Bacteria 31589
506 Ga0500658_0000154 3300053134 Bacteria 32862
507 Ga0500658_0062998 3300053134 Bacteria 1547
508 Ga0500559_0001538 3300053136 Bacteria 12922
509 Ga0500568_0010398 3300053139 Bacteria 4359
510 Ga0500577_0000088 3300053142 Bacteria 21585
511 Ga0500586_033897 3300053145 Bacteria 1699
512 Ga0500590_000571 3300053148 Bacteria 12943
513 Ga0500590_058338 3300053148 Bacteria 1945
514 Ga0500603_000904 3300053150 Bacteria 7030
515 Ga0500604_0008644 3300053151 Bacteria 2702
516 Ga0500604_0022312 3300053151 Bacteria 1796
517 Ga0500616_0000026 3300053153 Bacteria 454314
518 Ga0500616_0014499 3300053153 Bacteria 4528
519 Ga0500616_0064454 3300053153 Bacteria 1887
520 Ga0500616_0146943 3300053153 Bacteria 1095
521 Ga0500620_000196 3300053155 Bacteria 12159
522 Ga0500622_0002374 3300053156 Bacteria 13646
523 Ga0500627_0078350 3300053158 Bacteria 1471
524 Ga0500636_0001195 3300053177 Bacteria 14015
525 Ga0500637_0000914 3300053178 Bacteria 11908
526 Ga0500637_0048419 3300053178 Bacteria 2416
527 Ga0500645_024646 3300053730 Bacteria 1838
528 Ga0500661_000920 3300055283 Bacteria 5524
529 Ga0587075_006556 3300059644 Bacteria 1434
530 Ga0587078_011011 3300059646 Bacteria 1046
531 Ga0587071_030046 3300060344 Bacteria 1042
532 2509390561 2509276021 Bacteria 7634384
533 2509442240 2509276033 Bacteria 7180565
534 2510892810 2510461076 Bacteria 8618824
535 2511134145 2510917022 Bacteria 6504556
536 2511181377 2510917028 Bacteria 6185411
537 2511199556 2510917030 Bacteria 7460662
538 2513579411 2513237085 Bacteria 7695351
539 2513595286 2513237088 Bacteria 6927906
540 2513630661 2513237093 Bacteria 7545552
541 2513711987 2513237103 Bacteria 7647401
542 2513868647 2513237138 Bacteria 7368160
543 2513927826 2513237146 Bacteria 7166346
544 2514018321 2513237162 Bacteria 7468464
545 2514033239 2513237164 Bacteria 7563725
546 2515633107 2515154113 Bacteria 7807172
547 2515640312 2515154114 Bacteria 7848616
548 2515656394 2515154116 Bacteria 7552979
549 2515738419 2515154134 Bacteria 7220242
550 2517040832 2516653077 Bacteria 7555578
551 2517080455 2516653085 Bacteria 7346596
552 2517098430 2517093000 Bacteria 7412387
553 2517409920 2517287029 Bacteria 6905599
554 2520381896 2519899620 Bacteria 6499161
555 2523469624 2523231067 Bacteria 5230452
556 2524458542 2524023209 Bacteria 6679728
557 2530649080 2529292951 Bacteria 6916614
558 2561467499 2558860983 Bacteria 4133860
559 2585225961 2582581298 Bacteria 7315509
560 2585271758 2582581307 Bacteria 6597605
561 2585279864 2582581308 Bacteria 7413247
562 2585326589 2582581315 Bacteria 7318924
563 2585334065 2582581316 Bacteria 7774528
564 2585404931 2582581867 Bacteria 7184437
565 2585526781 2585427526 Bacteria 7258840
566 2585531732 2585427527 Bacteria 7273426
567 2585543113 2585427528 Bacteria 6842387
568 2585546921 2585427529 Bacteria 7395659
569 2585551321 2585427530 Bacteria 7383882
570 2585563002 2585427531 Bacteria 6992870
571 2585820375 2585427590 Bacteria 6824633
572 2585841479 2585427593 Bacteria 7141551
573 2585846475 2585427594 Bacteria 6180594
574 2585902919 2585427608 Bacteria 6544331
575 2585907217 2585427609 Bacteria 6667127
576 2587982789 2585428125 Bacteria 6662905
577 2588515484 2588253730 Bacteria 6881675
578 2599416741 2599185170 Bacteria 7295545
579 2599937920 2599185301 Bacteria 6161860
580 2603862594 2602042107 Bacteria 6226103
581 2616297147 2615840624 Bacteria 6557588
582 2616306657 2615840626 Bacteria 7921970
583 2616551291 2615840698 Bacteria 7319877
584 2617386031 2617270742 Bacteria 6808054
585 2643985282 2643221595 Bacteria 6565519
586 2644155082 2643221627 Bacteria 6761570
587 2671113410 2667528174 Bacteria 6435400
588 2719184805 2718217882 Bacteria 6556348
589 2719389508 2718217927 Bacteria 6972593
590 2719668806 2718217997 Bacteria 6740740
591 2719728825 2718218009 Bacteria 6478651
592 2720489499 2718218199 Bacteria 6740745
593 2720610171 2718218232 Bacteria 6720332
594 2720617599 2718218233 Bacteria 6662049
595 2720628742 2718218235 Bacteria 6630699
596 2720772691 2718218269 Bacteria 6906114
597 2721144516 2718218363 Bacteria 6524337
598 2721156463 2718218365 Bacteria 6274507
599 2721161886 2718218366 Bacteria 6425255
600 2721402276 2718218423 Bacteria 6438183
601 2722843031 2721755514 Bacteria 6424414
602 2723030130 2721755556 Bacteria 6745503
603 2723564535 2721755684 Bacteria 6859907
604 2723569824 2721755685 Bacteria 6704835
605 2724036109 2721755809 Bacteria 6438790
606 2724041850 2721755810 Bacteria 6479005
607 2724092720 2721755819 Bacteria 6906405
608 2724101371 2721755822 Bacteria 6726041
609 2724113105 2721755823 Bacteria 6752556
610 2725949451 2724679232 Bacteria 7646494
611 2730110663 2728369352 Bacteria 6745171
612 2730160920 2728369365 Bacteria 6555560
613 2730295996 2728369397 Bacteria 6274511
614 2739035181 2738541333 Bacteria 7106503
615 2746096006 2744054901 Bacteria 8397047
616 2756673367 2756170246 Bacteria 7451806
617 2766068934 2765235942 Bacteria 7445910
618 2778178982 2775507266 Bacteria 7392367
619 2792749060 2791355123 Bacteria 8049106
620 2792838382 2791355137 Bacteria 9654227
621 2793297948 2791355256 Bacteria 6798008
622 2793315064 2791355259 Bacteria 7254731
623 2793330746 2791355261 Bacteria 6661293
624 2793333916 2791355262 Bacteria 6774204
625 2793342245 2791355263 Bacteria 6872478
626 2793345697 2791355264 Bacteria 6429314
627 2793354384 2791355265 Bacteria 6539969
628 2793360252 2791355266 Bacteria 7116587
629 2793368714 2791355267 Bacteria 7222458
630 2805928401 2802429605 Bacteria 6875453
631 2805935213 2802429606 Bacteria 6346811
632 2806048083 2802429633 Bacteria 7341974
633 2806054619 2802429634 Bacteria 7083200
634 2806060627 2802429635 Bacteria 7650140
635 2806069453 2802429636 Bacteria 7597525
636 2806076912 2802429637 Bacteria 7067217
637 2819611576 2818991448 Bacteria 6772224
638 2819638751 2818991453 Bacteria 7181617
639 2819683605 2818991461 Bacteria 7026071
640 2819721743 2818991467 Bacteria 5893227
641 2838020452 2838016132 Bacteria 6577831
642 2838025162 2838022645 Bacteria 6494267
643 2838031001 2838029111 Bacteria 6603031
644 2838036852 2838035591 Bacteria 7166484
645 2838044129 2838042994 Bacteria 6046894
646 2838049893 2838048938 Bacteria 6044578
647 2838062160 2838061910 Bacteria 6794874
648 2838069484 2838068647 Bacteria 6208656
649 2838662112 2838661181 Bacteria 7385261
650 2838669334 2838668709 Bacteria 6671819
651 2838684687 2838680041 Bacteria 6545511
652 2838690532 2838686498 Bacteria 7807632
653 2838698849 2838694306 Bacteria 6853137
654 2838701706 2838701080 Bacteria 6669771
655 2838712271 2838707686 Bacteria 6619912
656 2838733111 2838729681 Bacteria 7400765
657 2838747300 2838742623 Bacteria 7396178
658 2841855453 2841851746 Bacteria 7532261
659 2841866124 2841864319 Bacteria 6742987
660 2842117039 2842110456 Bacteria 7656360
661 2842122670 2842118031 Bacteria 7033875
662 2842160840 2842156927 Bacteria 6894975
663 2842164369 2842163707 Bacteria 6916235
664 2842184456 2842180545 Bacteria 6888678
665 2842195973 2842192696 Bacteria 6147454
666 2842200728 2842198810 Bacteria 6608673
667 2842209860 2842205361 Bacteria 6340321
668 2842219715 2842217011 Bacteria 7497767
669 2842232039 2842229732 Bacteria 7475766
670 2842241683 2842237096 Bacteria 6620661
671 2842248559 2842243621 Bacteria 7421798
672 2842251870 2842250916 Bacteria 6579627
673 2842262633 2842257432 Bacteria 7401195
674 2842264859 2842264693 Bacteria 6472963
675 2842275154 2842271015 Bacteria 7807131
676 2842283314 2842278818 Bacteria 6340002
677 2842295807 2842291075 Bacteria 7076806
678 2842300199 2842298080 Bacteria 6123127
679 2842307410 2842304105 Bacteria 7023636
680 2842313000 2842311132 Bacteria 6616990
681 2842320273 2842317721 Bacteria 6793725
682 2842342021 2842341865 Bacteria 7003929
683 2842359110 2842357229 Bacteria 6485165
684 2842365998 2842363717 Bacteria 6844742
685 2842374312 2842370503 Bacteria 7038661
686 2842382211 2842377471 Bacteria 7140707
687 2842389218 2842384541 Bacteria 7057858
688 2842397001 2842395702 Bacteria 6780583
689 2842405901 2842402390 Bacteria 6681310
690 2842412485 2842409023 Bacteria 6687331
691 2842419129 2842415677 Bacteria 6596907
692 2842422675 2842422224 Bacteria 6239196
693 2842429088 2842428310 Bacteria 6767288
694 2842435701 2842434925 Bacteria 6502746
695 2842441437 2842441272 Bacteria 6769273
696 2842448493 2842447887 Bacteria 6754142
697 2842463512 2842462802 Bacteria 6588055
698 2842470031 2842469257 Bacteria 6752936
699 2842477733 2842475841 Bacteria 6603183
700 2842485036 2842482326 Bacteria 7212537
701 2842489846 2842489311 Bacteria 6620893
702 2842498106 2842495871 Bacteria 6820686
703 2842504395 2842502639 Bacteria 6604161
704 2842511633 2842509118 Bacteria 6850950
705 2844005826 2844002411 Bacteria 7168230
706 2844460188 2844454524 Bacteria 7952546
707 2852391779 2852387548 Bacteria 8025568
708 2856364519 2856364286 Bacteria 6939991
709 2857355954 2857349434 Bacteria 7926032
710 2857517761 2857516855 Bacteria 7787325
711 2857529936 2857524615 Bacteria 6615449
712 2869281531 2869278585 Bacteria 7077053
713 2869292808 2869285874 Bacteria 6901219
714 2871429621 2871429161 Bacteria 6547891
715 2874140807 2874139085 Bacteria 7021506
716 2874147085 2874146452 Bacteria 7533118
717 2874156936 2874155637 Bacteria 6724144
718 2876366557 2876363079 Bacteria 6544991
719 2876414375 2876413966 Bacteria 6831344
720 2878742586 2878738818 Bacteria 7136951
721 2878746207 2878745973 Bacteria 6867388
722 2885266462 2885266251 Bacteria 4796748
723 2885312309 2885305155 Bacteria 7348390
724 2885330861 2885326080 Bacteria 7134805
725 2885335353 2885334103 Bacteria 7216818
726 2888341235 2888337043 Bacteria 6629336
727 2893069418 2893066018 Bacteria 6158120
728 2903452730 2903448605 Bacteria 7357801
729 2903500549 2903492973 Bacteria 13473544
730 2903524425 2903521522 Bacteria 6525694
731 2903530055 2903528002 Bacteria 6586099
732 2906308520 2906308376 Bacteria 6841989
733 2906321888 2906321335 Bacteria 6579571
734 2906382894 2906378014 Bacteria 6911440
735 2919077208 2919073203 Bacteria 6531949
736 2919411133 2919408235 Bacteria 6149349
737 2924726203 2924718760 Bacteria 6331356
738 2924780386 2924776078 Bacteria 7492003
739 2933573934 2933570622 Bacteria 7023390
740 2933593211 2933586486 Bacteria 7667493
741 2933600147 2933599457 Bacteria 5858799
742 2935898766 2935894831 Bacteria 6620579
743 2935906170 2935901341 Bacteria 7341747
744 2936385382 2936381700 Bacteria 7006523
745 2937814267 2937813078 Bacteria 7783518
746 2937852350 2937848649 Bacteria 6983481
747 2937882908 2937877337 Bacteria 7246526
748 2937973663 2937972304 Bacteria 7532020
749 2958037492 2958034702 Bacteria 6989922
750 2958047204 2958041894 Bacteria 13082850
751 2958054050 2958041894 Bacteria 13082850
752 2958068731 2958064165 Bacteria 7158582
753 2958090033 2958084443 Bacteria 7312792
754 2958137299 2958130278 Bacteria 6897202
755 2958150371 2958144490 Bacteria 6677056
756 2958180324 2958179912 Bacteria 6874908
757 2961078156 2961077736 Bacteria 7079850
758 2963649352 2963644680 Bacteria 6530403
759 2968019673 2968016561 Bacteria 7022047
760 2968084511 2968083720 Bacteria 7351627
761 2970472994 2970469710 Bacteria 6969209
762 2970596134 2970593180 Bacteria 7073582
763 2977844954 2977843712 Bacteria 6753583
764 2977927170 2977922695 Bacteria 6956781
765 2977943982 2977942078 Bacteria 7570577
766 2977990362 2977986579 Bacteria 6581278
767 2987639768 2987636660 Bacteria 8088555
768 2996887392 2996887358 Bacteria 5795980
769 2996897407 2996893221 Bacteria 5823108
770 3002146303 3002141150 Bacteria 5254435
771 3004207341 3004203850 Bacteria 7307914
772 3004214699 3004211236 Bacteria 7417683
773 3004219382 3004218560 Bacteria 7421728
774 3005421554 3005416602 Bacteria 7064308
775 637079624 637000159 Bacteria 7596297
776 639645427 639633055 Bacteria 7751309
777 8004388372 8004387939 Bacteria 7049250
778 8004641661 8004640170 Bacteria 6723001
779 8004714776 8004714634 Bacteria 6776161
780 8005261953 8005258706 Bacteria 6184835
781 8005277851 8005275841 Bacteria 6929066
782 8005285789 8005282627 Bacteria 6675747
783 8005290361 8005289223 Bacteria 6634003
784 8005301234 8005301065 Bacteria 6614431
785 8005308240 8005307578 Bacteria 7395396
786 8005319743 8005314921 Bacteria 7072929
787 8005321919 8005321885 Bacteria 5795980
788 8005383135 8005382845 Bacteria 6732062
789 8005398736 8005395548 Bacteria 6806915
790 8005436627 8005430974 Bacteria 6689030
791 8005490366 8005484373 Bacteria 6297373
792 8005501953 8005497431 Bacteria 6477605
793 8005548695 8005542996 Bacteria 7077758
794 8005562629 8005556819 Bacteria 6908598
795 8005566403 8005563573 Bacteria 7153261
796 8005571338 8005570704 Bacteria 6957481
797 8005624197 8005619151 Bacteria 7030230
798 8005629459 8005626139 Bacteria 6534237
799 8005647015 8005645114 Bacteria 6950293
800 8005673375 8005668836 Bacteria 6953162
801 8005686945 8005682033 Bacteria 6726518
802 8005688953 8005688590 Bacteria 6610080
803 8005697087 8005695170 Bacteria 6912330
804 8018132243 8018127388 Bacteria 7351159
805 8018163678 8018163183 Bacteria 7277977
806 8018176407 8018176218 Bacteria 6896178
807 8023681631 8023680758 Bacteria 7729763
808 8024490113 8024486573 Bacteria 6540512
809 8024507376 8024501048 Bacteria 6427847
810 8046767299 8046767195 Bacteria 7547379
811 8055267856 8055266321 Bacteria 7999742
812 8055432360 8055431914 Bacteria 4551896
813 8056378056 8056375014 Bacteria 7006639
814 8056382129 8056382006 Bacteria 6408074
815 8057580062 8057575449 Bacteria 7367519
816 8057881367 8057874678 Bacteria 7494653
817 Ga0075367_10017261
818 JGI24740J21852_10000004
819 JGI24740J21852_10003496
820 JGI24739J22299_10014069
821 JGI24737J22298_10015335
822 JGI24735J21928_10019816
823 JGI25155J39150_1000004
824 JGI25156J39149_1000014
825 JGI25162J39368_1000176
826 JGI25162J39368_1000405
827 JGI25154J39366_1000026
828 JGI25154J39366_1000096
829 JGI25157J39369_1000005
830 JGI25152J39213_1002060
831 JGI25159J45721_1000387
832 JGI25151J46595_10000959
833 JGI25165J46597_1000190
834 JGI25165J46597_1000328
835 JGI25153J46596_10002309
836 JGI25153J46596_10056106
837 rootH1_10056207
838 rootL2_10002812
839 rootL2_10034088
840 rootL2_10199716
841 rootH1_10012054
842 JGI25160J50197_1000022
843 JGI25160J50197_1010328
844 JGI25160J50197_1020744
845 JGI25161J50226_1000139
846 JGI25161J50226_1004271
847 Ga0055535_1000770
848 Ga0055542_1000875
849 Ga0055529_1000622
850 Ga0055526_1000722
851 Ga0055526_1001290
852 Ga0055526_1007701
853 Ga0055524_1004653
854 Ga0055524_1017972
855 Ga0055524_1036748
856 Ga0055528_1000267
857 Ga0055528_1000310
858 Ga0055528_1001158
859 Ga0055528_1013301
860 Ga0055528_1018866
861 Ga0055528_1032507
862 Ga0055540_1000098
863 Ga0058692_1023728
864 Ga0055543_1000125
865 Ga0055543_1000477
866 Ga0065165_1001084
867 Ga0065165_1003916
868 Ga0070670_100000186
869 Ga0068869_100291828
870 Ga0070680_100203322
871 Ga0070668_100062558
872 Ga0070659_100118535
873 Ga0070667_100072057
874 Ga0070714_100476522
875 Ga0070663_100017519
876 Ga0070663_100167137
877 Ga0070678_100078545
878 Ga0070679_100123324
879 Ga0070684_100039745
880 Ga0070697_100173729
881 Ga0068853_100079915
882 Ga0070665_100147437
883 Ga0068855_100074120
884 Ga0068855_100206891
885 Ga0068855_100435557
886 Ga0068857_100052386
887 Ga0068854_100003244
888 Ga0068856_100068339
889 Ga0068856_100117526
890 Ga0068856_100121297
891 Ga0068852_100039189
892 Ga0068852_100040965
893 Ga0068852_100420827
894 Ga0068851_10000708
895 Ga0068858_100077471
896 Ga0075365_10013444
897 Ga0075365_10025191
898 Ga0075365_10033111
899 Ga0075365_10212204
900 Ga0075368_10008162
901 Ga0075364_10037754
902 Ga0070712_100039339
903 Ga0075362_10082545
904 Ga0075367_10017114
905 Ga0075369_10004067
906 Ga0075366_10001819
907 Ga0097621_100103113
908 Ga0075370_10000447
909 Ga0075370_10020254
910 Ga0075370_10096700
911 Ga0075370_10202589
912 Ga0105244_10065307
913 Ga0105250_10080224
914 Ga0105240_10000013
915 Ga0105240_10047463
916 Ga0105240_10069581
917 Ga0105245_10042130
918 Ga0105245_10474751
919 Ga0105243_10351563
920 Ga0105241_10006350
921 Ga0105241_10037067
922 Ga0105242_10301794
923 Ga0105248_10303915
924 Ga0105237_10003026
925 Ga0105237_10034571
926 Ga0105238_10010637
927 Ga0105238_10040051
928 Ga0123341_1000002
929 Ga0123341_1060290
930 Ga0123342_1021626
931 Ga0123342_1047491
932 Ga0099796_10015771
933 Ga0105239_10008517
934 Ga0105239_10043023
935 Ga0105239_10280874
936 Ga0105239_10504524
937 Ga0105246_10012687
938 Ga0157370_10000776
939 Ga0157370_10004045
940 Ga0157370_10282691
941 Ga0157369_10115331
942 Ga0157374_10013709
943 Ga0157378_10766473
944 Ga0163162_10095304
945 Ga0163162_10410020
946 Ga0157375_10043163
947 Ga0163163_10492163
948 Ga0157377_10365736
949 Ga0157379_10234919
950 Ga0182005_1013625
951 Ga0213872_10000877
952 Ga0213872_10000895
953 Ga0213872_10113541
954 Ga0213874_10003479
955 Ga0209435_100009
956 Ga0209563_101969
957 Ga0209437_100057
958 Ga0209437_100206
959 Ga0209258_100342
960 Ga0207425_1004420
961 Ga0209646_1000018
962 Ga0209026_1000043
963 Ga0209677_100446
964 Ga0209148_1000056
965 Ga0209148_1004253
966 Ga0209759_1000007
967 Ga0209759_1000816
968 Ga0209129_1000353
969 Ga0209129_1000355
970 Ga0209129_1008563
971 Ga0209129_1009834
972 Ga0209233_1000130
973 Ga0209233_1000178
974 Ga0209233_1000256
975 Ga0209455_1000214
976 Ga0209455_1000511
977 Ga0209673_1000022
978 Ga0209673_1000138
979 Ga0209673_1000206
980 Ga0209673_1000760
981 Ga0209673_1008483
982 Ga0209673_1011786
983 Ga0209130_1000108
984 Ga0209676_1053548
985 Ga0209025_1000190
986 Ga0209025_1001576
987 Ga0209025_1008668
988 Ga0209025_1057512
989 Ga0209564_1000440
990 Ga0209564_1002550
991 Ga0209564_1004320
992 Ga0209564_1008576
993 Ga0209564_1013193
994 Ga0209758_1000245
995 Ga0209758_1004506
996 Ga0209758_1005978
997 Ga0209758_1006439
998 Ga0209758_1009016
999 Ga0209758_1035942
1000 Ga0209050_1010904
1001 Ga0209256_1000696
1002 Ga0209256_1000970
1003 Ga0209256_1001032
1004 Ga0209256_1006727
1005 Ga0209256_1010839
1006 Ga0207426_1000082
1007 Ga0207426_1000109
1008 Ga0207426_1001015
1009 Ga0209051_1000264
1010 Ga0209051_1014171
1011 Ga0209257_1004220
1012 Ga0207656_10001363
1013 Ga0207688_10100592
1014 Ga0207647_10000972
1015 Ga0207654_10000729
1016 Ga0207654_10068195
1017 Ga0207695_10000044
1018 Ga0207695_10026423
1019 Ga0207695_10066797
1020 Ga0207671_10000497
1021 Ga0207671_10100148
1022 Ga0207693_10116020
1023 Ga0207660_10066561
1024 Ga0207657_10002575
1025 Ga0207652_10502052
1026 Ga0207694_10003030
1027 Ga0207694_10041527
1028 Ga0207650_10000437
1029 Ga0207650_10197982
1030 Ga0207687_10069228
1031 Ga0207687_10137996
1032 Ga0207690_10318889
1033 Ga0207686_10090479
1034 Ga0207709_10166073
1035 Ga0207689_10175147
1036 Ga0207667_10084436
1037 Ga0207667_10224858
1038 Ga0207668_10065644
1039 Ga0207640_10044590
1040 Ga0207640_10287415
1041 Ga0207658_10046261
1042 Ga0207677_10068448
1043 Ga0207703_10044646
1044 Ga0207639_10030210
1045 Ga0207678_10025687
1046 Ga0207678_10088160
1047 Ga0207702_10000003
1048 Ga0207702_10092073
1049 Ga0207702_10177695
1050 Ga0207648_10179862
1051 Ga0207683_10010329
1052 Ga0207683_10571088
1053 Ga0207698_10052292
1054 Ga0207698_10283438
1055 Ga0209371_1001399
1056 Ga0209179_1008838
1057 Ga0268266_10069718
1058 Ga0268264_10314839
1059 Ga0268256_1004035
1060 Ga0265332_10000014
1061 Ga0307513_10112041
1062 Ga0265314_10062274
1063 Ga0265314_10071321
1064 Ga0307405_10010050
1065 Ga0307406_10007541
1066 Ga0307510_10053093
1067 Ga0373938_0024842
1068 Ga0373943_0008616
1069 Ga0373955_0172583
1070 Ga0373924_0175875
1071 Ga0373931_0027047
1072 Ga0373931_0214466
1073 Ga0373935_0000354
1074 Ga0373927_0000265
1075 Ga0373927_0004375
1076 Ga0373927_0020052
1077 Ga0373933_0167988
1078 Ga0373947_0004190
1079 Ga0373947_0015251
1080 Ga0373937_0123081
1081 Ga0373925_0006149
1082 Ga0373925_0013841
1083 Ga0395900_0019859
1084 Ga0395900_0031285
1085 Ga0395898_0044213
1086 Ga0395898_0110809
1087 Ga0395905_0001232
1088 Ga0395905_0018431
1089 Ga0395905_0030803
1090 Ga0395905_0060100
1091 Ga0395905_0211449
1092 Ga0395905_0270839
1093 Ga0436361_0146255
1094 Ga0436361_0280903
1095 Ga0436361_0951475
1096 Ga0436361_1080875
1097 Ga0436363_0750994
1098 Ga0451833_0575160
1099 Ga0451833_0630363
1100 Ga0451847_0221458
1101 Ga0451843_0087885
1102 Ga0451843_0869831
1103 Ga0451855_0206026
1104 Ga0451853_2943458
1105 Ga0451577_0006848
1106 Ga0453683_0207399
1107 Ga0466966_0000108
1108 Ga0466961_0086004
1109 Ga0466963_0004123
1110 Ga0466963_0009644
1111 Ga0453684_0020440
1112 Ga0453684_0032029
1113 Ga0466959_0001228
1114 Ga0451576_0034048
1115 Ga0466958_0000395
1116 Ga0495592_0010550
1117 Ga0495603_0000521
1118 Ga0495603_0006219
1119 Ga0495603_0011257
1120 Ga0495629_0000416
1121 Ga0495629_0136158
1122 Ga0495638_0000373
1123 Ga0495638_0058806
1124 Ga0495638_0079199
1125 Ga0495641_0033497
1126 Ga0495651_0030505
1127 Ga0495651_0050264
1128 Ga0495653_0153585
1129 Ga0495580_0004213
1130 Ga0495580_0108213
1131 Ga0495582_0000497
1132 Ga0495582_0034499
1133 Ga0495605_0020531
1134 Ga0495605_0026112
1135 Ga0495639_0000827
1136 Ga0495639_0010220
1137 Ga0495639_0043476
1138 Ga0495639_0109638
1139 Ga0495662_0000367
1140 Ga0495662_0007097
1141 Ga0495664_0056426
1142 Ga0495585_0037873
1143 Ga0495594_0000194
1144 Ga0495607_0023626
1145 Ga0495583_0023484
1146 Ga0495583_0045089
1147 Ga0495606_0013214
1148 Ga0495606_0061345
1149 Ga0495610_0008012
1150 Ga0495616_0065780
1151 Ga0495618_0052753
1152 Ga0495618_0126338
1153 Ga0495620_0011952
1154 Ga0495628_0126343
1155 Ga0495630_0188492
1156 Ga0495630_0197768
1157 Ga0495630_0481246
1158 Ga0495631_0050162
1159 Ga0495643_0015214
1160 Ga0495643_0044629
1161 Ga0495643_0111911
1162 Ga0495648_0002325
1163 Ga0495648_0030003
1164 Ga0495666_0070724
1165 Ga0495652_0032802
1166 Ga0495652_0197062
1167 Ga0495654_0017301
1168 Ga0495665_0000800
1169 Ga0495665_0065520
1170 Ga0495640_0005387
1171 Ga0495640_0173186
1172 Ga0495586_0064007
1173 Ga0495587_0147694
1174 Ga0495645_0007519
1175 Ga0495645_0166473
1176 Ga0495622_0020290
1177 Ga0495633_0022070
1178 Ga0495667_0122036
1179 Ga0495656_0071862
1180 Ga0495668_0002042
1181 Ga0495634_0000602
1182 Ga0495634_0124827
1183 Ga0495625_0122795
1184 Ga0495625_0235193
1185 Ga0495635_0008057
1186 Ga0495661_0012341
1187 Ga0495661_0059141
1188 Ga0495588_0040450
1189 Ga0495588_0079515
1190 Ga0495646_0192434
1191 Ga0495647_0012690
1192 Ga0495658_0000593
1193 Ga0495613_0001953
1194 Ga0495670_0013926
1195 Ga0495671_0085352
1196 Ga0495649_0020268
1197 Ga0495600_0016779
1198 Ga0495660_0018153
1199 Ga0495581_0000133
1200 Ga0495581_0039931
1201 Ga0495674_0000874
1202 Ga0495676_0021332
1203 Ga0495680_0121626
1204 Ga0495681_0049119
1205 Ga0495684_0021929
1206 Ga0495686_0000090
1207 Ga0495686_0009064
1208 Ga0495686_0089407
1209 Ga0495686_0257917
1210 Ga0495593_0000022
1211 Ga0495602_0175312
1212 Ga0495602_0226096
1213 Ga0495626_0024957
1214 Ga0496100_0073535
1215 Ga0496100_0163842
1216 Ga0496102_0195462
1217 Ga0496103_0013416
1218 Ga0496104_0004491
1219 Ga0496104_0045777
1220 Ga0496104_0104336
1221 Ga0496104_0242475
1222 Ga0496105_0025936
1223 Ga0496105_0039864
1224 Ga0496106_0027770
1225 Ga0496106_0086752
1226 Ga0496107_0002052
1227 Ga0496108_0068748
1228 Ga0496110_0009445
1229 Ga0496110_0540527
1230 Ga0496111_0057294
1231 Ga0496112_0068217
1232 Ga0496112_0625386
1233 Ga0496113_0095103
1234 Ga0496113_0228668
1235 Ga0496113_0304470
1236 Ga0496114_0057512
1237 Ga0496115_0010980
1238 Ga0496115_0074802
1239 Ga0496115_0132525
1240 Ga0496116_0000216
1241 Ga0496116_0003756
1242 Ga0496116_0035714
1243 Ga0496116_0171039
1244 Ga0496117_0001639
1245 Ga0496117_0031632
1246 Ga0496117_0072325
1247 Ga0496117_0102556
1248 Ga0496118_0001422
1249 Ga0496118_0002888
1250 Ga0496118_0057612
1251 Ga0496118_0080551
1252 Ga0496119_0004579
1253 Ga0496119_0079050
1254 Ga0496119_0127927
1255 Ga0496119_0214143
1256 Ga0496120_0016909
1257 Ga0496120_0054972
1258 Ga0496120_0092272
1259 Ga0496120_0101030
1260 Ga0496121_0001525
1261 Ga0496121_0047971
1262 Ga0496121_0051661
1263 Ga0496121_0130683
1264 Ga0496121_0197929
1265 Ga0496122_0002437
1266 Ga0496122_0018774
1267 Ga0496122_0021846
1268 Ga0496122_0064697
1269 Ga0496123_0004314
1270 Ga0496123_0037937
1271 Ga0496124_0000023
1272 Ga0496124_0039852
1273 Ga0496124_0050073
1274 Ga0496124_0179111
1275 Ga0496125_0000154
1276 Ga0496125_0001251
1277 Ga0496125_0029696
1278 Ga0496125_0157271
1279 Ga0496125_0206661
1280 Ga0496126_0101205
1281 Ga0496126_0190996
1282 Ga0495678_038391
1283 Ga0495682_0141534
1284 Ga0501033_0000692
1285 Ga0501033_0211008
1286 Ga0501038_0477352
1287 Ga0501067_0041476
1288 Ga0501070_0024967
1289 Ga0501073_0182035
1290 Ga0501083_0036549
1291 Ga0501035_0000157
1292 Ga0501044_0109959
1293 nmdc:mga0yw44_18839_c1
1294 nmdc:mga0yw44_26478_c1
1295 nmdc:mga0k408_20467_c1
1296 nmdc:mga07m45_32899_c1
1297 nmdc:mga07m45_90264_c1
1298 nmdc:mga0sz30_23992_c1
1299 Ga0495595_0006793
1300 Ga0495619_0010247
1301 Ga0495619_0241116
1302 Ga0500578_0015703
1303 Ga0500581_021254
1304 Ga0500583_0164034
1305 Ga0500651_0008860
1306 Ga0500651_0017164
1307 Ga0500566_0001411
1308 Ga0500650_0014378
1309 Ga0500554_000403
1310 Ga0500556_0003108
1311 Ga0500562_011794
1312 Ga0500569_005433
1313 Ga0500595_000650
1314 Ga0500608_039048
1315 Ga0500608_059560
1316 Ga0500614_065366
1317 Ga0500618_000028
1318 Ga0500618_000184
1319 Ga0500618_042324
1320 Ga0500642_0000050
1321 Ga0500652_000113
1322 Ga0500658_0000154
1323 Ga0500658_0062998
1324 Ga0500559_0001538
1325 Ga0500568_0010398
1326 Ga0500577_0000088
1327 Ga0500586_033897
1328 Ga0500590_000571
1329 Ga0500590_058338
1330 Ga0500603_000904
1331 Ga0500604_0008644
1332 Ga0500604_0022312
1333 Ga0500616_0000026
1334 Ga0500616_0014499
1335 Ga0500616_0064454
1336 Ga0500616_0146943
1337 Ga0500620_000196
1338 Ga0500622_0002374
1339 Ga0500627_0078350
1340 Ga0500636_0001195
1341 Ga0500637_0000914
1342 Ga0500637_0048419
1343 Ga0500645_024646
1344 Ga0500661_000920
1345 Ga0587075_006556
1346 Ga0587078_011011
1347 Ga0587071_030046
1348 2509390561
1349 2509442240
1350 2510892810
1351 2511134145
1352 2511181377
1353 2511199556
1354 2513579411
1355 2513595286
1356 2513630661
1357 2513711987
1358 2513868647
1359 2513927826
1360 2514018321
1361 2514033239
1362 2515633107
1363 2515640312
1364 2515656394
1365 2515738419
1366 2517040832
1367 2517080455
1368 2517098430
1369 2517409920
1370 2520381896
1371 2523469624
1372 2524458542
1373 2530649080
1374 2561467499
1375 2585225961
1376 2585271758
1377 2585279864
1378 2585326589
1379 2585334065
1380 2585404931
1381 2585526781
1382 2585531732
1383 2585543113
1384 2585546921
1385 2585551321
1386 2585563002
1387 2585820375
1388 2585841479
1389 2585846475
1390 2585902919
1391 2585907217
1392 2587982789
1393 2588515484
1394 2599416741
1395 2599937920
1396 2603862594
1397 2616297147
1398 2616306657
1399 2616551291
1400 2617386031
1401 2643985282
1402 2644155082
1403 2671113410
1404 2719184805
1405 2719389508
1406 2719668806
1407 2719728825
1408 2720489499
1409 2720610171
1410 2720617599
1411 2720628742
1412 2720772691
1413 2721144516
1414 2721156463
1415 2721161886
1416 2721402276
1417 2722843031
1418 2723030130
1419 2723564535
1420 2723569824
1421 2724036109
1422 2724041850
1423 2724092720
1424 2724101371
1425 2724113105
1426 2725949451
1427 2730110663
1428 2730160920
1429 2730295996
1430 2739035181
1431 2746096006
1432 2756673367
1433 2766068934
1434 2778178982
1435 2792749060
1436 2792838382
1437 2793297948
1438 2793315064
1439 2793330746
1440 2793333916
1441 2793342245
1442 2793345697
1443 2793354384
1444 2793360252
1445 2793368714
1446 2805928401
1447 2805935213
1448 2806048083
1449 2806054619
1450 2806060627
1451 2806069453
1452 2806076912
1453 2819611576
1454 2819638751
1455 2819683605
1456 2819721743
1457 2838020452
1458 2838025162
1459 2838031001
1460 2838036852
1461 2838044129
1462 2838049893
1463 2838062160
1464 2838069484
1465 2838662112
1466 2838669334
1467 2838684687
1468 2838690532
1469 2838698849
1470 2838701706
1471 2838712271
1472 2838733111
1473 2838747300
1474 2841855453
1475 2841866124
1476 2842117039
1477 2842122670
1478 2842160840
1479 2842164369
1480 2842184456
1481 2842195973
1482 2842200728
1483 2842209860
1484 2842219715
1485 2842232039
1486 2842241683
1487 2842248559
1488 2842251870
1489 2842262633
1490 2842264859
1491 2842275154
1492 2842283314
1493 2842295807
1494 2842300199
1495 2842307410
1496 2842313000
1497 2842320273
1498 2842342021
1499 2842359110
1500 2842365998
1501 2842374312
1502 2842382211
1503 2842389218
1504 2842397001
1505 2842405901
1506 2842412485
1507 2842419129
1508 2842422675
1509 2842429088
1510 2842435701
1511 2842441437
1512 2842448493
1513 2842463512
1514 2842470031
1515 2842477733
1516 2842485036
1517 2842489846
1518 2842498106
1519 2842504395
1520 2842511633
1521 2844005826
1522 2844460188
1523 2852391779
1524 2856364519
1525 2857355954
1526 2857517761
1527 2857529936
1528 2869281531
1529 2869292808
1530 2871429621
1531 2874140807
1532 2874147085
1533 2874156936
1534 2876366557
1535 2876414375
1536 2878742586
1537 2878746207
1538 2885266462
1539 2885312309
1540 2885330861
1541 2885335353
1542 2888341235
1543 2893069418
1544 2903452730
1545 2903500549
1546 2903524425
1547 2903530055
1548 2906308520
1549 2906321888
1550 2906382894
1551 2919077208
1552 2919411133
1553 2924726203
1554 2924780386
1555 2933573934
1556 2933593211
1557 2933600147
1558 2935898766
1559 2935906170
1560 2936385382
1561 2937814267
1562 2937852350
1563 2937882908
1564 2937973663
1565 2958037492
1566 2958047204
1567 2958054050
1568 2958068731
1569 2958090033
1570 2958137299
1571 2958150371
1572 2958180324
1573 2961078156
1574 2963649352
1575 2968019673
1576 2968084511
1577 2970472994
1578 2970596134
1579 2977844954
1580 2977927170
1581 2977943982
1582 2977990362
1583 2987639768
1584 2996887392
1585 2996897407
1586 3002146303
1587 3004207341
1588 3004214699
1589 3004219382
1590 3005421554
1591 637079624
1592 639645427
1593 8004388372
1594 8004641661
1595 8004714776
1596 8005261953
1597 8005277851
1598 8005285789
1599 8005290361
1600 8005301234
1601 8005308240
1602 8005319743
1603 8005321919
1604 8005383135
1605 8005398736
1606 8005436627
1607 8005490366
1608 8005501953
1609 8005548695
1610 8005562629
1611 8005566403
1612 8005571338
1613 8005624197
1614 8005629459
1615 8005647015
1616 8005673375
1617 8005686945
1618 8005688953
1619 8005697087
1620 8018132243
1621 8018163678
1622 8018176407
1623 8023681631
1624 8024490113
1625 8024507376
1626 8046767299
1627 8055267856
1628 8055432360
1629 8056378056
1630 8056382129
1631 8057580062
1632 8057881367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

103

282

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dg6-assembly6.cif.gz_F structure of a de novo designed interleukin-2/interleukin-15 mimetic 0.398 118 210
6dg6-assembly6.cif.gz_F structure of a de novo designed interleukin-2/interleukin-15 mimetic 0.3817 118 210
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.3535 96 251
7met-assembly1.cif.gz_B a. baumannii msba in complex with tbt1 decoupler 0.3446 101 253
6yxx-assembly1.cif.gz_EP state a of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.3238 93 263
ID Description Score Start End Superfamily
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5163 149 251 1.10.3720.10
af_F4I4B6_271_375_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.5123 117 220 1.20.58.1220
af_Q6I630_273_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4962 89 208 1.20.1250.20
af_F4I4B6_271_375_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.4861 117 220 1.20.58.1220
af_A0A0R0I6A5_242_405_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4786 108 231 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A833KSF5-F1-model_v4 deleted 0.4804 4 115
AF-A0A833KSF5-F1-model_v4 deleted 0.4706 4 115
AF-A0A1F9CWH9-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.3955 35 258 GO:0005886
GO:0010438
GO:0055085
AF-A0A519HFG5-F1-model_v4 deleted 0.3607 47 234
AF-A0A519HFG5-F1-model_v4 deleted 0.3532 47 234

Map