F482066
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 816 | 391 | 767 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0100269|Ga0466970_0100269_271_1380 |
| Length | 352 |
| Sequence | MDDRDSGQPGDPRTAANAVHVPVLLERVLALLAPALADRPAVAVDATLGLAGHAEALLAAHPQLTLVGLDRDPAALARSRERLAPYAGRVHLVHAIYDRMPEVLEELGYDGVDGVLFDLGVSSMQLDVPERGFAYAQDAPLRVVNEYSVADLARVLREYGEERFALRIAQAIDRERRVAPLRSTAQLAELVRQAIPAATRRHGGHPAKRTFQALRIEVNGELAAVQAAVPAALDALHLGGRIVVLAYHSLEDRIVKQALNARAKDTTPPDLPVPLPDRGPQLRLLARGSEPASEAEVAANPRAASVRLRAAERIRPGPLPGAAAGRAGRARHGRGPRPGGRHTGRSPGGDAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 2 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 3 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 4 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 5 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 6 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 7 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 8 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 9 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 10 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 11 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 12 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 13 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 14 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 15 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 16 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 17 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 18 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 19 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 20 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 21 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 22 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 23 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 24 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 25 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 26 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 27 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 28 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 29 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 30 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 31 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 32 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 33 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 34 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 35 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 36 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 37 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 38 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 39 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 193 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 194 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 195 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 200 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 201 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 215 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 216 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 248 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 263 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 326 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 327 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 380 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 381 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 382 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 383 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 384 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 385 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 386 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 387 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 388 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 389 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 390 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 391 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.14 |
| Metatranscriptomes | 0.86 |
| Isolates | 6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0.12 |
| Rhizoplane | 5.51 |
| Rhizosphere | 86.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1003443 | 3300002073 | Bacteria | 1656 |
| 2 | Ga0006562J51391_1086514 | 3300003578 | Bacteria | 3549 |
| 3 | Ga0070658_10075564 | 3300005327 | Bacteria | 2763 |
| 4 | Ga0070658_10111036 | 3300005327 | Bacteria | 2271 |
| 5 | Ga0070676_10049955 | 3300005328 | Bacteria | 2450 |
| 6 | Ga0070683_100113636 | 3300005329 | Bacteria | 2556 |
| 7 | Ga0070683_100120469 | 3300005329 | Bacteria | 2478 |
| 8 | Ga0070683_100268382 | 3300005329 | Bacteria | 1623 |
| 9 | Ga0070666_10003339 | 3300005335 | Bacteria | 9730 |
| 10 | Ga0070666_10303287 | 3300005335 | Bacteria | 1137 |
| 11 | Ga0070680_100000165 | 3300005336 | Bacteria | 41910 |
| 12 | Ga0070682_100169583 | 3300005337 | Bacteria | 1515 |
| 13 | Ga0070682_100278030 | 3300005337 | Bacteria | 1219 |
| 14 | Ga0068868_100140987 | 3300005338 | Bacteria | 1979 |
| 15 | Ga0070660_100086181 | 3300005339 | Bacteria | 2471 |
| 16 | Ga0070660_100106717 | 3300005339 | Bacteria | 2224 |
| 17 | Ga0070687_100006098 | 3300005343 | Bacteria | 4920 |
| 18 | Ga0070661_100075150 | 3300005344 | Bacteria | 2489 |
| 19 | Ga0070692_10000835 | 3300005345 | Bacteria | 10326 |
| 20 | Ga0070692_10161107 | 3300005345 | Bacteria | 1285 |
| 21 | Ga0070668_100014178 | 3300005347 | Bacteria | 5954 |
| 22 | Ga0070668_100053430 | 3300005347 | Bacteria | 3115 |
| 23 | Ga0070668_100069223 | 3300005347 | Bacteria | 2745 |
| 24 | Ga0070669_100074213 | 3300005353 | Bacteria | 2522 |
| 25 | Ga0070671_100015500 | 3300005355 | Bacteria | 6159 |
| 26 | Ga0070673_100085900 | 3300005364 | Bacteria | 2562 |
| 27 | Ga0070659_100041462 | 3300005366 | Bacteria | 3598 |
| 28 | Ga0070659_100044395 | 3300005366 | Bacteria | 3480 |
| 29 | Ga0070659_100106343 | 3300005366 | Bacteria | 2262 |
| 30 | Ga0070667_100009863 | 3300005367 | Bacteria | 7917 |
| 31 | Ga0070709_10093951 | 3300005434 | Bacteria | 1983 |
| 32 | Ga0070714_100000077 | 3300005435 | Bacteria | 84205 |
| 33 | Ga0070714_100001732 | 3300005435 | Bacteria | 15906 |
| 34 | Ga0070714_100028640 | 3300005435 | Bacteria | 4624 |
| 35 | Ga0070714_100034845 | 3300005435 | Bacteria | 4216 |
| 36 | Ga0070714_100047156 | 3300005435 | Bacteria | 3659 |
| 37 | Ga0070714_100402082 | 3300005435 | Bacteria | 1295 |
| 38 | Ga0070713_100058884 | 3300005436 | Bacteria | 3205 |
| 39 | Ga0070710_10000022 | 3300005437 | Bacteria | 77699 |
| 40 | Ga0070710_10000728 | 3300005437 | Bacteria | 15674 |
| 41 | Ga0070710_10005739 | 3300005437 | Bacteria | 5911 |
| 42 | Ga0070710_10086755 | 3300005437 | Bacteria | 1838 |
| 43 | Ga0070701_10002686 | 3300005438 | Bacteria | 6896 |
| 44 | Ga0070701_10264921 | 3300005438 | Bacteria | 1043 |
| 45 | Ga0070711_100003236 | 3300005439 | Bacteria | 9453 |
| 46 | Ga0070711_100068002 | 3300005439 | Bacteria | 2501 |
| 47 | Ga0070711_100085449 | 3300005439 | Bacteria | 2260 |
| 48 | Ga0070700_100000007 | 3300005441 | Bacteria | 198866 |
| 49 | Ga0070700_100003580 | 3300005441 | Bacteria | 8023 |
| 50 | Ga0070708_100005297 | 3300005445 | Bacteria | 10220 |
| 51 | Ga0070708_100015632 | 3300005445 | Bacteria | 6273 |
| 52 | Ga0070708_100114315 | 3300005445 | Bacteria | 2483 |
| 53 | Ga0070708_100452818 | 3300005445 | Bacteria | 1211 |
| 54 | Ga0070681_10000004 | 3300005458 | Bacteria | 205157 |
| 55 | Ga0068867_100059967 | 3300005459 | Bacteria | 2821 |
| 56 | Ga0070706_100001516 | 3300005467 | Bacteria | 24353 |
| 57 | Ga0070706_100004145 | 3300005467 | Bacteria | 14098 |
| 58 | Ga0070707_100000199 | 3300005468 | Bacteria | 60047 |
| 59 | Ga0070707_100001581 | 3300005468 | Bacteria | 22058 |
| 60 | Ga0070707_100005343 | 3300005468 | Bacteria | 12029 |
| 61 | Ga0070707_100019784 | 3300005468 | Bacteria | 6346 |
| 62 | Ga0070707_100051387 | 3300005468 | Bacteria | 3952 |
| 63 | Ga0070707_100055841 | 3300005468 | Bacteria | 3786 |
| 64 | Ga0070707_100163356 | 3300005468 | Bacteria | 2170 |
| 65 | Ga0070707_100172948 | 3300005468 | Bacteria | 2105 |
| 66 | Ga0070698_100000264 | 3300005471 | Bacteria | 52985 |
| 67 | Ga0070698_100011473 | 3300005471 | Bacteria | 9403 |
| 68 | Ga0070698_100098051 | 3300005471 | Bacteria | 2906 |
| 69 | Ga0070699_100024969 | 3300005518 | Bacteria | 5152 |
| 70 | Ga0070679_100000012 | 3300005530 | Bacteria | 155885 |
| 71 | Ga0070679_100038665 | 3300005530 | Bacteria | 4744 |
| 72 | Ga0070684_100063193 | 3300005535 | Bacteria | 3245 |
| 73 | Ga0070684_100070375 | 3300005535 | Bacteria | 3078 |
| 74 | Ga0070697_100103388 | 3300005536 | Bacteria | 2368 |
| 75 | Ga0068853_100029276 | 3300005539 | Bacteria | 4640 |
| 76 | Ga0070672_100001420 | 3300005543 | Bacteria | 14804 |
| 77 | Ga0070686_100281578 | 3300005544 | Bacteria | 1226 |
| 78 | Ga0070665_100003626 | 3300005548 | Bacteria | 16353 |
| 79 | Ga0070665_100065832 | 3300005548 | Bacteria | 3634 |
| 80 | Ga0068855_100003671 | 3300005563 | Bacteria | 18771 |
| 81 | Ga0068855_100011741 | 3300005563 | Bacteria | 10590 |
| 82 | Ga0068855_100053197 | 3300005563 | Bacteria | 4765 |
| 83 | Ga0068855_100079107 | 3300005563 | Bacteria | 3814 |
| 84 | Ga0070664_100108075 | 3300005564 | Bacteria | 2425 |
| 85 | Ga0070664_100161484 | 3300005564 | Bacteria | 1983 |
| 86 | Ga0070664_100458929 | 3300005564 | Bacteria | 1170 |
| 87 | Ga0068857_100054200 | 3300005577 | Bacteria | 3558 |
| 88 | Ga0068857_100197575 | 3300005577 | Bacteria | 1833 |
| 89 | Ga0068854_100000894 | 3300005578 | Bacteria | 17906 |
| 90 | Ga0068854_100020126 | 3300005578 | Bacteria | 4509 |
| 91 | Ga0068856_100048202 | 3300005614 | Bacteria | 4197 |
| 92 | Ga0068856_100070122 | 3300005614 | Bacteria | 3467 |
| 93 | Ga0070702_100008011 | 3300005615 | Bacteria | 5096 |
| 94 | Ga0068852_100015872 | 3300005616 | Bacteria | 5857 |
| 95 | Ga0068852_100020460 | 3300005616 | Bacteria | 5264 |
| 96 | Ga0068852_100029337 | 3300005616 | Bacteria | 4519 |
| 97 | Ga0068859_100020881 | 3300005617 | Bacteria | 6573 |
| 98 | Ga0068859_100129742 | 3300005617 | Bacteria | 2592 |
| 99 | Ga0068864_100092941 | 3300005618 | Bacteria | 2664 |
| 100 | Ga0068864_100125488 | 3300005618 | Bacteria | 2300 |
| 101 | Ga0068864_100178531 | 3300005618 | Bacteria | 1940 |
| 102 | Ga0068861_100002683 | 3300005719 | Bacteria | 11656 |
| 103 | Ga0068851_10096977 | 3300005834 | Bacteria | 1560 |
| 104 | Ga0068870_10120196 | 3300005840 | Bacteria | 1512 |
| 105 | Ga0068863_100038366 | 3300005841 | Bacteria | 4558 |
| 106 | Ga0068863_100092850 | 3300005841 | Bacteria | 2864 |
| 107 | Ga0068863_100290750 | 3300005841 | Bacteria | 1584 |
| 108 | Ga0068863_100320032 | 3300005841 | Bacteria | 1507 |
| 109 | Ga0068858_100052910 | 3300005842 | Bacteria | 3757 |
| 110 | Ga0068860_100000043 | 3300005843 | Bacteria | 225862 |
| 111 | Ga0068860_100008606 | 3300005843 | Bacteria | 10172 |
| 112 | Ga0068860_100223509 | 3300005843 | Bacteria | 1828 |
| 113 | Ga0068862_100103060 | 3300005844 | Bacteria | 2498 |
| 114 | Ga0081455_10000249 | 3300005937 | Bacteria | 70419 |
| 115 | Ga0081455_10005254 | 3300005937 | Bacteria | 14230 |
| 116 | Ga0081455_10095721 | 3300005937 | Bacteria | 2396 |
| 117 | Ga0081538_10001888 | 3300005981 | Bacteria | 21088 |
| 118 | Ga0081540_1045035 | 3300005983 | Bacteria | 2245 |
| 119 | Ga0081539_10005729 | 3300005985 | Bacteria | 12423 |
| 120 | Ga0070717_10022992 | 3300006028 | Bacteria | 4932 |
| 121 | Ga0070717_10030301 | 3300006028 | Bacteria | 4346 |
| 122 | Ga0070717_10055214 | 3300006028 | Bacteria | 3276 |
| 123 | Ga0070715_10014019 | 3300006163 | Bacteria | 2958 |
| 124 | Ga0070715_10032780 | 3300006163 | Bacteria | 2119 |
| 125 | Ga0070716_100001767 | 3300006173 | Bacteria | 9771 |
| 126 | Ga0070716_100010067 | 3300006173 | Bacteria | 4730 |
| 127 | Ga0070712_100066741 | 3300006175 | Bacteria | 2558 |
| 128 | Ga0070712_100109128 | 3300006175 | Bacteria | 2062 |
| 129 | Ga0075370_10072465 | 3300006353 | Bacteria | 1972 |
| 130 | Ga0075428_100008761 | 3300006844 | Bacteria | 11222 |
| 131 | Ga0075430_100000322 | 3300006846 | Bacteria | 34136 |
| 132 | Ga0075430_100000551 | 3300006846 | Bacteria | 28427 |
| 133 | Ga0075430_100022754 | 3300006846 | Bacteria | 5330 |
| 134 | Ga0075430_100144651 | 3300006846 | Bacteria | 1980 |
| 135 | Ga0075431_100015152 | 3300006847 | Bacteria | 7809 |
| 136 | Ga0075431_100117543 | 3300006847 | Bacteria | 2744 |
| 137 | Ga0075431_100354599 | 3300006847 | Bacteria | 1474 |
| 138 | Ga0075433_10027206 | 3300006852 | Bacteria | 4848 |
| 139 | Ga0075434_100009265 | 3300006871 | Bacteria | 9176 |
| 140 | Ga0075429_100065389 | 3300006880 | Bacteria | 3166 |
| 141 | Ga0068865_100014097 | 3300006881 | Bacteria | 5072 |
| 142 | Ga0068865_100145608 | 3300006881 | Bacteria | 1791 |
| 143 | Ga0075436_100149571 | 3300006914 | Bacteria | 1643 |
| 144 | Ga0097620_100020881 | 3300006931 | Bacteria | 6573 |
| 145 | Ga0097620_100129742 | 3300006931 | Bacteria | 2592 |
| 146 | Ga0075435_100285399 | 3300007076 | Bacteria | 1409 |
| 147 | Ga0075435_100333893 | 3300007076 | Bacteria | 1298 |
| 148 | Ga0105240_10003563 | 3300009093 | Bacteria | 24152 |
| 149 | Ga0105240_10122614 | 3300009093 | Bacteria | 3128 |
| 150 | Ga0105240_10251875 | 3300009093 | Bacteria | 2042 |
| 151 | Ga0111539_10277612 | 3300009094 | Bacteria | 1950 |
| 152 | Ga0105245_10007214 | 3300009098 | Bacteria | 9739 |
| 153 | Ga0105247_10026238 | 3300009101 | Bacteria | 3517 |
| 154 | Ga0114129_10000059 | 3300009147 | Bacteria | 98984 |
| 155 | Ga0114129_10001122 | 3300009147 | Bacteria | 35346 |
| 156 | Ga0114129_10002252 | 3300009147 | Bacteria | 26655 |
| 157 | Ga0114129_10027718 | 3300009147 | Bacteria | 8020 |
| 158 | Ga0114129_10037952 | 3300009147 | Bacteria | 6796 |
| 159 | Ga0114129_10096580 | 3300009147 | Bacteria | 4091 |
| 160 | Ga0105248_10241747 | 3300009177 | Bacteria | 2032 |
| 161 | Ga0105248_10522081 | 3300009177 | Bacteria | 1339 |
| 162 | Ga0105237_10008476 | 3300009545 | Bacteria | 11124 |
| 163 | Ga0105238_10006220 | 3300009551 | Bacteria | 11859 |
| 164 | Ga0105238_10030284 | 3300009551 | Bacteria | 5509 |
| 165 | Ga0105238_10354606 | 3300009551 | Bacteria | 1456 |
| 166 | Ga0105249_10434944 | 3300009553 | Bacteria | 1348 |
| 167 | Ga0105028_104374 | 3300009993 | Bacteria | 1471 |
| 168 | Ga0105239_10241209 | 3300010375 | Bacteria | 2028 |
| 169 | Ga0105239_10278201 | 3300010375 | Bacteria | 1884 |
| 170 | Ga0105239_10467001 | 3300010375 | Bacteria | 1433 |
| 171 | Ga0105239_10502873 | 3300010375 | Bacteria | 1378 |
| 172 | Ga0105246_10079679 | 3300011119 | Bacteria | 2329 |
| 173 | Ga0157370_10006131 | 3300013104 | Bacteria | 13341 |
| 174 | Ga0157370_10147085 | 3300013104 | Bacteria | 2193 |
| 175 | Ga0157369_10109792 | 3300013105 | Bacteria | 2932 |
| 176 | Ga0163162_10094019 | 3300013306 | Bacteria | 3084 |
| 177 | Ga0157372_10000025 | 3300013307 | Bacteria | 195491 |
| 178 | Ga0157379_10020602 | 3300014968 | Bacteria | 5834 |
| 179 | Ga0197907_11058319 | 3300020069 | Bacteria | 1393 |
| 180 | Ga0197907_11375361 | 3300020069 | Bacteria | 2424 |
| 181 | Ga0206353_10075764 | 3300020082 | Bacteria | 1300 |
| 182 | Ga0206353_11385583 | 3300020082 | Bacteria | 2742 |
| 183 | Ga0206353_11687186 | 3300020082 | Bacteria | 1349 |
| 184 | Ga0213876_10062061 | 3300021384 | Bacteria | 1972 |
| 185 | Ga0213875_10002941 | 3300021388 | Bacteria | 9926 |
| 186 | Ga0213875_10030543 | 3300021388 | Bacteria | 2550 |
| 187 | Ga0224712_10031661 | 3300022467 | Bacteria | 1921 |
| 188 | Ga0207426_1005901 | 3300025302 | Bacteria | 5449 |
| 189 | Ga0207426_1012389 | 3300025302 | Bacteria | 3204 |
| 190 | Ga0207692_10000029 | 3300025898 | Bacteria | 47759 |
| 191 | Ga0207692_10000976 | 3300025898 | Bacteria | 10409 |
| 192 | Ga0207688_10086651 | 3300025901 | Bacteria | 1795 |
| 193 | Ga0207680_10049916 | 3300025903 | Bacteria | 2493 |
| 194 | Ga0207680_10149824 | 3300025903 | Bacteria | 1554 |
| 195 | Ga0207647_10007928 | 3300025904 | Bacteria | 7637 |
| 196 | Ga0207647_10021834 | 3300025904 | Bacteria | 4263 |
| 197 | Ga0207647_10052615 | 3300025904 | Bacteria | 2513 |
| 198 | Ga0207699_10001689 | 3300025906 | Bacteria | 10442 |
| 199 | Ga0207699_10003631 | 3300025906 | Bacteria | 7374 |
| 200 | Ga0207645_10054541 | 3300025907 | Bacteria | 2553 |
| 201 | Ga0207643_10000838 | 3300025908 | Bacteria | 18708 |
| 202 | Ga0207643_10010223 | 3300025908 | Bacteria | 5047 |
| 203 | Ga0207643_10023047 | 3300025908 | Bacteria | 3432 |
| 204 | Ga0207684_10001106 | 3300025910 | Bacteria | 30154 |
| 205 | Ga0207684_10001458 | 3300025910 | Bacteria | 25491 |
| 206 | Ga0207684_10010776 | 3300025910 | Bacteria | 8024 |
| 207 | Ga0207684_10011415 | 3300025910 | Bacteria | 7773 |
| 208 | Ga0207684_10160734 | 3300025910 | Bacteria | 1934 |
| 209 | Ga0207684_10243727 | 3300025910 | Bacteria | 1551 |
| 210 | Ga0207654_10025263 | 3300025911 | Bacteria | 3202 |
| 211 | Ga0207654_10049754 | 3300025911 | Bacteria | 2406 |
| 212 | Ga0207707_10000159 | 3300025912 | Bacteria | 70857 |
| 213 | Ga0207695_10003521 | 3300025913 | Bacteria | 21933 |
| 214 | Ga0207695_10050307 | 3300025913 | Bacteria | 4385 |
| 215 | Ga0207695_10136819 | 3300025913 | Bacteria | 2402 |
| 216 | Ga0207695_10181850 | 3300025913 | Bacteria | 2023 |
| 217 | Ga0207671_10000142 | 3300025914 | Bacteria | 110234 |
| 218 | Ga0207671_10246197 | 3300025914 | Bacteria | 1405 |
| 219 | Ga0207693_10011211 | 3300025915 | Bacteria | 7255 |
| 220 | Ga0207663_10003895 | 3300025916 | Bacteria | 7375 |
| 221 | Ga0207660_10000172 | 3300025917 | Bacteria | 41071 |
| 222 | Ga0207662_10094022 | 3300025918 | Bacteria | 1848 |
| 223 | Ga0207657_10019188 | 3300025919 | Bacteria | 6503 |
| 224 | Ga0207657_10206570 | 3300025919 | Bacteria | 1578 |
| 225 | Ga0207652_10000106 | 3300025921 | Bacteria | 90763 |
| 226 | Ga0207652_10174042 | 3300025921 | Bacteria | 1932 |
| 227 | Ga0207646_10000278 | 3300025922 | Bacteria | 70066 |
| 228 | Ga0207646_10002274 | 3300025922 | Bacteria | 22856 |
| 229 | Ga0207646_10010015 | 3300025922 | Bacteria | 9307 |
| 230 | Ga0207646_10011082 | 3300025922 | Bacteria | 8751 |
| 231 | Ga0207646_10021539 | 3300025922 | Bacteria | 5955 |
| 232 | Ga0207646_10024869 | 3300025922 | Bacteria | 5481 |
| 233 | Ga0207646_10071417 | 3300025922 | Bacteria | 3100 |
| 234 | Ga0207694_10000366 | 3300025924 | Bacteria | 42462 |
| 235 | Ga0207650_10389978 | 3300025925 | Bacteria | 1151 |
| 236 | Ga0207687_10038525 | 3300025927 | Bacteria | 3267 |
| 237 | Ga0207687_10042281 | 3300025927 | Bacteria | 3134 |
| 238 | Ga0207687_10075966 | 3300025927 | Bacteria | 2412 |
| 239 | Ga0207687_10248607 | 3300025927 | Bacteria | 1413 |
| 240 | Ga0207700_10007592 | 3300025928 | Bacteria | 6647 |
| 241 | Ga0207700_10010224 | 3300025928 | Bacteria | 5906 |
| 242 | Ga0207664_10000091 | 3300025929 | Bacteria | 84244 |
| 243 | Ga0207664_10003575 | 3300025929 | Bacteria | 10389 |
| 244 | Ga0207664_10004798 | 3300025929 | Bacteria | 9188 |
| 245 | Ga0207664_10009651 | 3300025929 | Bacteria | 6783 |
| 246 | Ga0207664_10339085 | 3300025929 | Bacteria | 1329 |
| 247 | Ga0207644_10010249 | 3300025931 | Bacteria | 6176 |
| 248 | Ga0207644_10039462 | 3300025931 | Bacteria | 3333 |
| 249 | Ga0207644_10178084 | 3300025931 | Bacteria | 1665 |
| 250 | Ga0207690_10040624 | 3300025932 | Bacteria | 3042 |
| 251 | Ga0207686_10080558 | 3300025934 | Bacteria | 2123 |
| 252 | Ga0207669_10028723 | 3300025937 | Bacteria | 3064 |
| 253 | Ga0207704_10045180 | 3300025938 | Bacteria | 2615 |
| 254 | Ga0207704_10174904 | 3300025938 | Bacteria | 1544 |
| 255 | Ga0207665_10009592 | 3300025939 | Bacteria | 6356 |
| 256 | Ga0207665_10018899 | 3300025939 | Bacteria | 4528 |
| 257 | Ga0207691_10002443 | 3300025940 | Bacteria | 18168 |
| 258 | Ga0207689_10012739 | 3300025942 | Bacteria | 7183 |
| 259 | Ga0207689_10039700 | 3300025942 | Bacteria | 3896 |
| 260 | Ga0207661_10106862 | 3300025944 | Bacteria | 2360 |
| 261 | Ga0207661_10322789 | 3300025944 | Bacteria | 1388 |
| 262 | Ga0207679_10111292 | 3300025945 | Bacteria | 2162 |
| 263 | Ga0207667_10016776 | 3300025949 | Bacteria | 8263 |
| 264 | Ga0207667_10024935 | 3300025949 | Bacteria | 6556 |
| 265 | Ga0207667_10354975 | 3300025949 | Bacteria | 1495 |
| 266 | Ga0207668_10048668 | 3300025972 | Bacteria | 2911 |
| 267 | Ga0207668_10239407 | 3300025972 | Bacteria | 1467 |
| 268 | Ga0207668_10274658 | 3300025972 | Bacteria | 1379 |
| 269 | Ga0207640_10160172 | 3300025981 | Bacteria | 1664 |
| 270 | Ga0207658_10012887 | 3300025986 | Bacteria | 5709 |
| 271 | Ga0207639_10024579 | 3300026041 | Bacteria | 4362 |
| 272 | Ga0207678_10203817 | 3300026067 | Bacteria | 1692 |
| 273 | Ga0207678_10250017 | 3300026067 | Bacteria | 1518 |
| 274 | Ga0207678_10298081 | 3300026067 | Bacteria | 1385 |
| 275 | Ga0207708_10000006 | 3300026075 | Bacteria | 266916 |
| 276 | Ga0207708_10000642 | 3300026075 | Bacteria | 26799 |
| 277 | Ga0207708_10006719 | 3300026075 | Bacteria | 8509 |
| 278 | Ga0207702_10008585 | 3300026078 | Bacteria | 8613 |
| 279 | Ga0207702_10217992 | 3300026078 | Bacteria | 1777 |
| 280 | Ga0207641_10002763 | 3300026088 | Bacteria | 16001 |
| 281 | Ga0207641_10039463 | 3300026088 | Bacteria | 3949 |
| 282 | Ga0207641_10107073 | 3300026088 | Bacteria | 2472 |
| 283 | Ga0207648_10004455 | 3300026089 | Bacteria | 14369 |
| 284 | Ga0207648_10067186 | 3300026089 | Bacteria | 3126 |
| 285 | Ga0207648_10317313 | 3300026089 | Bacteria | 1400 |
| 286 | Ga0207676_10116654 | 3300026095 | Bacteria | 2244 |
| 287 | Ga0207674_10168140 | 3300026116 | Bacteria | 2146 |
| 288 | Ga0207675_100013277 | 3300026118 | Bacteria | 7689 |
| 289 | Ga0207675_100013486 | 3300026118 | Bacteria | 7625 |
| 290 | Ga0207683_10129369 | 3300026121 | Bacteria | 2270 |
| 291 | Ga0207698_10020599 | 3300026142 | Bacteria | 4543 |
| 292 | Ga0207698_10146859 | 3300026142 | Bacteria | 2041 |
| 293 | Ga0207698_10166906 | 3300026142 | Bacteria | 1933 |
| 294 | Ga0207698_10472419 | 3300026142 | Bacteria | 1215 |
| 295 | Ga0268266_10001896 | 3300028379 | Bacteria | 23544 |
| 296 | Ga0268266_10094334 | 3300028379 | Bacteria | 2626 |
| 297 | Ga0268266_10190410 | 3300028379 | Bacteria | 1872 |
| 298 | Ga0268266_10193091 | 3300028379 | Bacteria | 1860 |
| 299 | Ga0268266_10307629 | 3300028379 | Bacteria | 1480 |
| 300 | Ga0268265_10061631 | 3300028380 | Bacteria | 2879 |
| 301 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 302 | Ga0268264_10006109 | 3300028381 | Bacteria | 10176 |
| 303 | Ga0268264_10604206 | 3300028381 | Bacteria | 1081 |
| 304 | Ga0265336_10014734 | 3300028666 | Bacteria | 2584 |
| 305 | Ga0307517_10107630 | 3300028786 | Bacteria | 2146 |
| 306 | Ga0307515_10048042 | 3300028794 | Bacteria | 6464 |
| 307 | Ga0307515_10053893 | 3300028794 | Bacteria | 5919 |
| 308 | Ga0307515_10126190 | 3300028794 | Bacteria | 2856 |
| 309 | Ga0265338_10000827 | 3300028800 | Bacteria | 52237 |
| 310 | Ga0307512_10049354 | 3300030522 | Bacteria | 3394 |
| 311 | Ga0316177_1035054 | 3300030731 | Bacteria | 1643 |
| 312 | Ga0316176_1086942 | 3300030732 | Bacteria | 3852 |
| 313 | Ga0314311_1071118 | 3300030733 | Bacteria | 4674 |
| 314 | Ga0307513_10000009 | 3300031456 | Bacteria | 403893 |
| 315 | Ga0307513_10096748 | 3300031456 | Bacteria | 2989 |
| 316 | Ga0307408_100010119 | 3300031548 | Bacteria | 6218 |
| 317 | Ga0307408_100013173 | 3300031548 | Bacteria | 5488 |
| 318 | Ga0307408_100379316 | 3300031548 | Bacteria | 1208 |
| 319 | Ga0307508_10138946 | 3300031616 | Bacteria | 2033 |
| 320 | Ga0307508_10212060 | 3300031616 | Bacteria | 1537 |
| 321 | Ga0307508_10236146 | 3300031616 | Bacteria | 1426 |
| 322 | Ga0307514_10005913 | 3300031649 | Bacteria | 10788 |
| 323 | Ga0316575_10018726 | 3300031665 | Bacteria | 2642 |
| 324 | Ga0316579_10022448 | 3300031691 | Bacteria | 2822 |
| 325 | Ga0316576_10003083 | 3300031727 | Bacteria | 9711 |
| 326 | Ga0316576_10072127 | 3300031727 | Bacteria | 2548 |
| 327 | Ga0316578_10103480 | 3300031728 | Bacteria | 1708 |
| 328 | Ga0307516_10120313 | 3300031730 | Bacteria | 2417 |
| 329 | Ga0307516_10188493 | 3300031730 | Bacteria | 1790 |
| 330 | Ga0307405_10030861 | 3300031731 | Bacteria | 3147 |
| 331 | Ga0307405_10087804 | 3300031731 | Bacteria | 2050 |
| 332 | Ga0307413_10036858 | 3300031824 | Bacteria | 2820 |
| 333 | Ga0307413_10211396 | 3300031824 | Bacteria | 1409 |
| 334 | Ga0307406_10063060 | 3300031901 | Bacteria | 2399 |
| 335 | Ga0307406_10070007 | 3300031901 | Bacteria | 2296 |
| 336 | Ga0307406_10180758 | 3300031901 | Bacteria | 1535 |
| 337 | Ga0307407_10096187 | 3300031903 | Bacteria | 1827 |
| 338 | Ga0307412_10090223 | 3300031911 | Bacteria | 2142 |
| 339 | Ga0307412_10100726 | 3300031911 | Bacteria | 2042 |
| 340 | Ga0307409_100010914 | 3300031995 | Bacteria | 5687 |
| 341 | Ga0307409_100018424 | 3300031995 | Bacteria | 4695 |
| 342 | Ga0307409_100085717 | 3300031995 | Bacteria | 2561 |
| 343 | Ga0307409_100111607 | 3300031995 | Bacteria | 2294 |
| 344 | Ga0307409_100237770 | 3300031995 | Bacteria | 1656 |
| 345 | Ga0307409_100241885 | 3300031995 | Bacteria | 1644 |
| 346 | Ga0307416_100000122 | 3300032002 | Bacteria | 46669 |
| 347 | Ga0307416_100011768 | 3300032002 | Bacteria | 5859 |
| 348 | Ga0307416_100119027 | 3300032002 | Bacteria | 2348 |
| 349 | Ga0307416_100662300 | 3300032002 | Bacteria | 1130 |
| 350 | Ga0307411_10059567 | 3300032005 | Bacteria | 2532 |
| 351 | Ga0307411_10347917 | 3300032005 | Bacteria | 1207 |
| 352 | Ga0307415_100000011 | 3300032126 | Bacteria | 84750 |
| 353 | Ga0307415_100026569 | 3300032126 | Bacteria | 3654 |
| 354 | Ga0307415_100077829 | 3300032126 | Bacteria | 2356 |
| 355 | Ga0307415_100090991 | 3300032126 | Bacteria | 2209 |
| 356 | Ga0307415_100107682 | 3300032126 | Bacteria | 2060 |
| 357 | Ga0316583_10018382 | 3300032133 | Bacteria | 2510 |
| 358 | Ga0316580_10002028 | 3300032139 | Bacteria | 5490 |
| 359 | Ga0316580_10031369 | 3300032139 | Bacteria | 1645 |
| 360 | Ga0373929_0008674 | 3300035085 | Bacteria | 1875 |
| 361 | Ga0373934_0000337 | 3300035086 | Bacteria | 16404 |
| 362 | Ga0373934_0000541 | 3300035086 | Bacteria | 13316 |
| 363 | Ga0373934_0082708 | 3300035086 | Bacteria | 1291 |
| 364 | Ga0373923_0017622 | 3300035111 | Bacteria | 2734 |
| 365 | Ga0373923_0089844 | 3300035111 | Bacteria | 1342 |
| 366 | Ga0373932_0007932 | 3300035112 | Bacteria | 2535 |
| 367 | Ga0373936_0000174 | 3300035113 | Bacteria | 21388 |
| 368 | Ga0373941_0002222 | 3300035115 | Bacteria | 4238 |
| 369 | Ga0373945_0010599 | 3300035116 | Bacteria | 3037 |
| 370 | Ga0373953_0000759 | 3300035117 | Bacteria | 8949 |
| 371 | Ga0373953_0001469 | 3300035117 | Bacteria | 6842 |
| 372 | Ga0373953_0009454 | 3300035117 | Bacteria | 3356 |
| 373 | Ga0373954_0010264 | 3300035118 | Bacteria | 4130 |
| 374 | Ga0373956_0001267 | 3300035119 | Bacteria | 10466 |
| 375 | Ga0373956_0006486 | 3300035119 | Bacteria | 4689 |
| 376 | Ga0373956_0068256 | 3300035119 | Bacteria | 1619 |
| 377 | Ga0373957_0000146 | 3300035120 | Bacteria | 17727 |
| 378 | Ga0373957_0002029 | 3300035120 | Bacteria | 5668 |
| 379 | Ga0373957_0009326 | 3300035120 | Bacteria | 3209 |
| 380 | Ga0373957_0045538 | 3300035120 | Bacteria | 1663 |
| 381 | Ga0373943_0068439 | 3300035170 | Bacteria | 1792 |
| 382 | Ga0373946_0042214 | 3300035171 | Bacteria | 1874 |
| 383 | Ga0373955_0000024 | 3300035172 | Bacteria | 60102 |
| 384 | Ga0373955_0004403 | 3300035172 | Bacteria | 6234 |
| 385 | Ga0373955_0035955 | 3300035172 | Bacteria | 2626 |
| 386 | Ga0316574_0120034 | 3300035398 | Bacteria | 1688 |
| 387 | Ga0373924_0003094 | 3300035410 | Bacteria | 5678 |
| 388 | Ga0373924_0018354 | 3300035410 | Bacteria | 2694 |
| 389 | Ga0373935_0009209 | 3300035692 | Bacteria | 5910 |
| 390 | Ga0373935_0014464 | 3300035692 | Bacteria | 4761 |
| 391 | Ga0373933_0001020 | 3300035724 | Bacteria | 17008 |
| 392 | Ga0373933_0057502 | 3300035724 | Bacteria | 2337 |
| 393 | Ga0373933_0083274 | 3300035724 | Bacteria | 1964 |
| 394 | Ga0373947_0091340 | 3300035725 | Bacteria | 1899 |
| 395 | Ga0373947_0270788 | 3300035725 | Bacteria | 1127 |
| 396 | Ga0373937_0000333 | 3300036401 | Bacteria | 44782 |
| 397 | Ga0373937_0007305 | 3300036401 | Bacteria | 9563 |
| 398 | Ga0373937_0517706 | 3300036401 | Bacteria | 1133 |
| 399 | Ga0316582_0002093 | 3300036647 | Bacteria | 9203 |
| 400 | Ga0316582_0008389 | 3300036647 | Bacteria | 5551 |
| 401 | Ga0316584_0009878 | 3300036712 | Bacteria | 6645 |
| 402 | Ga0316584_0047585 | 3300036712 | Bacteria | 3204 |
| 403 | Ga0373925_0095506 | 3300037068 | Bacteria | 2277 |
| 404 | Ga0373925_0174248 | 3300037068 | Bacteria | 1699 |
| 405 | Ga0373925_0236618 | 3300037068 | Bacteria | 1461 |
| 406 | Ga0395899_0002931 | 3300037312 | Bacteria | 13693 |
| 407 | Ga0395900_0035135 | 3300037418 | Bacteria | 5163 |
| 408 | Ga0395900_0073954 | 3300037418 | Bacteria | 3504 |
| 409 | Ga0395900_0091057 | 3300037418 | Bacteria | 3134 |
| 410 | Ga0395900_0212618 | 3300037418 | Bacteria | 1952 |
| 411 | Ga0395898_0008364 | 3300037466 | Bacteria | 10938 |
| 412 | Ga0395898_0021174 | 3300037466 | Bacteria | 6596 |
| 413 | Ga0395898_0022365 | 3300037466 | Bacteria | 6404 |
| 414 | Ga0395905_0078998 | 3300037471 | Bacteria | 3083 |
| 415 | Ga0395905_0183251 | 3300037471 | Bacteria | 1966 |
| 416 | Ga0436364_0132832 | 3300037853 | Bacteria | 3991 |
| 417 | Ga0436364_0235358 | 3300037853 | Bacteria | 23813 |
| 418 | Ga0436364_0805657 | 3300037853 | Bacteria | 63201 |
| 419 | Ga0436364_1271055 | 3300037853 | Bacteria | 3458 |
| 420 | Ga0395901_0009517 | 3300038443 | Bacteria | 9858 |
| 421 | Ga0395901_0137614 | 3300038443 | Bacteria | 2566 |
| 422 | Ga0395901_0254389 | 3300038443 | Bacteria | 1829 |
| 423 | Ga0436365_1288594 | 3300039437 | Bacteria | 6876 |
| 424 | Ga0439466_0022877 | 3300041411 | Bacteria | 2202 |
| 425 | Ga0439432_049534 | 3300042006 | Bacteria | 1313 |
| 426 | Ga0439449_0004608 | 3300042007 | Bacteria | 5327 |
| 427 | Ga0439449_0063996 | 3300042007 | Bacteria | 1356 |
| 428 | Ga0466969_0003516 | 3300044656 | Bacteria | 8319 |
| 429 | Ga0466969_0006780 | 3300044656 | Bacteria | 6093 |
| 430 | Ga0466969_0130717 | 3300044656 | Bacteria | 1164 |
| 431 | Ga0466972_0001796 | 3300044658 | Bacteria | 10509 |
| 432 | Ga0466965_0013634 | 3300044683 | Bacteria | 3838 |
| 433 | Ga0466965_0027995 | 3300044683 | Bacteria | 2736 |
| 434 | Ga0466965_0071387 | 3300044683 | Bacteria | 1746 |
| 435 | Ga0466966_0003006 | 3300044684 | Bacteria | 11120 |
| 436 | Ga0466966_0007315 | 3300044684 | Bacteria | 7318 |
| 437 | Ga0466966_0027334 | 3300044684 | Bacteria | 3721 |
| 438 | Ga0466966_0050017 | 3300044684 | Bacteria | 2660 |
| 439 | Ga0466966_0053353 | 3300044684 | Bacteria | 2565 |
| 440 | Ga0466966_0213904 | 3300044684 | Bacteria | 1164 |
| 441 | Ga0466961_0014013 | 3300044693 | Bacteria | 5140 |
| 442 | Ga0466961_0017088 | 3300044693 | Bacteria | 4659 |
| 443 | Ga0466961_0018613 | 3300044693 | Bacteria | 4469 |
| 444 | Ga0466961_0027860 | 3300044693 | Bacteria | 3633 |
| 445 | Ga0466961_0048556 | 3300044693 | Bacteria | 2713 |
| 446 | Ga0466961_0068137 | 3300044693 | Bacteria | 2260 |
| 447 | Ga0466961_0072650 | 3300044693 | Bacteria | 2182 |
| 448 | Ga0466961_0176004 | 3300044693 | Bacteria | 1329 |
| 449 | Ga0466963_0002403 | 3300044694 | Bacteria | 10472 |
| 450 | Ga0466963_0004099 | 3300044694 | Bacteria | 8426 |
| 451 | Ga0466963_0010690 | 3300044694 | Bacteria | 5569 |
| 452 | Ga0466963_0013515 | 3300044694 | Bacteria | 5013 |
| 453 | Ga0466963_0014379 | 3300044694 | Bacteria | 4880 |
| 454 | Ga0466963_0200568 | 3300044694 | Bacteria | 1395 |
| 455 | Ga0466963_0279000 | 3300044694 | Bacteria | 1174 |
| 456 | Ga0466963_0296111 | 3300044694 | Bacteria | 1138 |
| 457 | Ga0466964_0022535 | 3300044706 | Bacteria | 2445 |
| 458 | Ga0466964_0058322 | 3300044706 | Bacteria | 1600 |
| 459 | Ga0466971_0019544 | 3300044719 | Bacteria | 3009 |
| 460 | Ga0466971_0028152 | 3300044719 | Bacteria | 2515 |
| 461 | Ga0466971_0064055 | 3300044719 | Bacteria | 1664 |
| 462 | Ga0466970_0100269 | 3300044765 | Bacteria | 1577 |
| 463 | Ga0466970_0102994 | 3300044765 | Bacteria | 1555 |
| 464 | Ga0466957_0019200 | 3300044842 | Bacteria | 4019 |
| 465 | Ga0466957_0098828 | 3300044842 | Bacteria | 1837 |
| 466 | Ga0466957_0181777 | 3300044842 | Bacteria | 1374 |
| 467 | Ga0466957_0339857 | 3300044842 | Bacteria | 1016 |
| 468 | Ga0466960_0006158 | 3300044901 | Bacteria | 4800 |
| 469 | Ga0466960_0056586 | 3300044901 | Bacteria | 1910 |
| 470 | Ga0466959_0004080 | 3300045049 | Bacteria | 9718 |
| 471 | Ga0466959_0017053 | 3300045049 | Bacteria | 5317 |
| 472 | Ga0466959_0089157 | 3300045049 | Bacteria | 2216 |
| 473 | Ga0466959_0136079 | 3300045049 | Bacteria | 1739 |
| 474 | Ga0466959_0136498 | 3300045049 | Bacteria | 1736 |
| 475 | Ga0466958_0009011 | 3300045836 | Bacteria | 5542 |
| 476 | Ga0466958_0020687 | 3300045836 | Bacteria | 3839 |
| 477 | Ga0466967_0003203 | 3300045976 | Bacteria | 10566 |
| 478 | Ga0466967_0005551 | 3300045976 | Bacteria | 8759 |
| 479 | Ga0466967_0009756 | 3300045976 | Bacteria | 7155 |
| 480 | Ga0466967_0015327 | 3300045976 | Bacteria | 6005 |
| 481 | Ga0466967_0022174 | 3300045976 | Bacteria | 5175 |
| 482 | Ga0466967_0022348 | 3300045976 | Bacteria | 5158 |
| 483 | Ga0466967_0027436 | 3300045976 | Bacteria | 4737 |
| 484 | Ga0466967_0035877 | 3300045976 | Bacteria | 4226 |
| 485 | Ga0466967_0073021 | 3300045976 | Bacteria | 3077 |
| 486 | Ga0466967_0118942 | 3300045976 | Bacteria | 2438 |
| 487 | Ga0466967_0126708 | 3300045976 | Bacteria | 2366 |
| 488 | Ga0466967_0168653 | 3300045976 | Bacteria | 2058 |
| 489 | Ga0466967_0249483 | 3300045976 | Bacteria | 1695 |
| 490 | Ga0466967_0435926 | 3300045976 | Bacteria | 1279 |
| 491 | Ga0466967_0476315 | 3300045976 | Bacteria | 1223 |
| 492 | Ga0466967_0521250 | 3300045976 | Bacteria | 1168 |
| 493 | Ga0495592_0000304 | 3300046454 | Bacteria | 41482 |
| 494 | Ga0495592_0059696 | 3300046454 | Bacteria | 2807 |
| 495 | Ga0495592_0132341 | 3300046454 | Bacteria | 1743 |
| 496 | Ga0495592_0253053 | 3300046454 | Bacteria | 1163 |
| 497 | Ga0495603_0011591 | 3300046455 | Bacteria | 5334 |
| 498 | Ga0495629_0003034 | 3300046459 | Bacteria | 12765 |
| 499 | Ga0495629_0026903 | 3300046459 | Bacteria | 4085 |
| 500 | Ga0495629_0029254 | 3300046459 | Bacteria | 3908 |
| 501 | Ga0495641_0014739 | 3300046461 | Bacteria | 4217 |
| 502 | Ga0495641_0108185 | 3300046461 | Bacteria | 1240 |
| 503 | Ga0495651_0000252 | 3300046462 | Bacteria | 41425 |
| 504 | Ga0495651_0001465 | 3300046462 | Bacteria | 18258 |
| 505 | Ga0495651_0018040 | 3300046462 | Bacteria | 5463 |
| 506 | Ga0495653_0001371 | 3300046463 | Bacteria | 18922 |
| 507 | Ga0495653_0009566 | 3300046463 | Bacteria | 7928 |
| 508 | Ga0495653_0015034 | 3300046463 | Bacteria | 6310 |
| 509 | Ga0495582_0004181 | 3300046473 | Bacteria | 8116 |
| 510 | Ga0495639_0023641 | 3300046475 | Bacteria | 2702 |
| 511 | Ga0495662_0030834 | 3300046476 | Bacteria | 2588 |
| 512 | Ga0495662_0033767 | 3300046476 | Bacteria | 2471 |
| 513 | Ga0495664_0008824 | 3300046477 | Bacteria | 5632 |
| 514 | Ga0495664_0009068 | 3300046477 | Bacteria | 5561 |
| 515 | Ga0495664_0070973 | 3300046477 | Bacteria | 2080 |
| 516 | Ga0495664_0073784 | 3300046477 | Bacteria | 2040 |
| 517 | Ga0495585_0119637 | 3300046492 | Bacteria | 1394 |
| 518 | Ga0495594_0000668 | 3300046499 | Bacteria | 17644 |
| 519 | Ga0495608_0000101 | 3300046511 | Bacteria | 61678 |
| 520 | Ga0495608_0073663 | 3300046511 | Bacteria | 2226 |
| 521 | Ga0495608_0077131 | 3300046511 | Bacteria | 2169 |
| 522 | Ga0495618_0047408 | 3300046514 | Bacteria | 2712 |
| 523 | Ga0495618_0060659 | 3300046514 | Bacteria | 2398 |
| 524 | Ga0495618_0127440 | 3300046514 | Bacteria | 1629 |
| 525 | Ga0495628_0004884 | 3300046516 | Bacteria | 11802 |
| 526 | Ga0495628_0009964 | 3300046516 | Bacteria | 8085 |
| 527 | Ga0495628_0010389 | 3300046516 | Bacteria | 7910 |
| 528 | Ga0495628_0029794 | 3300046516 | Bacteria | 4422 |
| 529 | Ga0495628_0222350 | 3300046516 | Bacteria | 1418 |
| 530 | Ga0495630_0086753 | 3300046517 | Bacteria | 2363 |
| 531 | Ga0495652_0001004 | 3300046529 | Bacteria | 32333 |
| 532 | Ga0495652_0002437 | 3300046529 | Bacteria | 19162 |
| 533 | Ga0495652_0035206 | 3300046529 | Bacteria | 4358 |
| 534 | Ga0495652_0036673 | 3300046529 | Bacteria | 4259 |
| 535 | Ga0495652_0080402 | 3300046529 | Bacteria | 2692 |
| 536 | Ga0495652_0108556 | 3300046529 | Bacteria | 2236 |
| 537 | Ga0495652_0151072 | 3300046529 | Bacteria | 1814 |
| 538 | Ga0495665_0002038 | 3300046531 | Bacteria | 10945 |
| 539 | Ga0495665_0012035 | 3300046531 | Bacteria | 4683 |
| 540 | Ga0495640_0011285 | 3300046533 | Bacteria | 6877 |
| 541 | Ga0495640_0033826 | 3300046533 | Bacteria | 3630 |
| 542 | Ga0495640_0039427 | 3300046533 | Bacteria | 3314 |
| 543 | Ga0495640_0157321 | 3300046533 | Bacteria | 1458 |
| 544 | Ga0495586_0003009 | 3300046535 | Bacteria | 9090 |
| 545 | Ga0495587_0000228 | 3300046536 | Bacteria | 41527 |
| 546 | Ga0495587_0015528 | 3300046536 | Bacteria | 4753 |
| 547 | Ga0495645_0012873 | 3300046543 | Bacteria | 5905 |
| 548 | Ga0495645_0016317 | 3300046543 | Bacteria | 5301 |
| 549 | Ga0495645_0057988 | 3300046543 | Bacteria | 2809 |
| 550 | Ga0495645_0093623 | 3300046543 | Bacteria | 2144 |
| 551 | Ga0495645_0133386 | 3300046543 | Bacteria | 1738 |
| 552 | Ga0495645_0146232 | 3300046543 | Bacteria | 1646 |
| 553 | Ga0495645_0179584 | 3300046543 | Bacteria | 1451 |
| 554 | Ga0495622_0033129 | 3300046557 | Bacteria | 2412 |
| 555 | Ga0495667_0000396 | 3300046559 | Bacteria | 27834 |
| 556 | Ga0495667_0006408 | 3300046559 | Bacteria | 7980 |
| 557 | Ga0495667_0010402 | 3300046559 | Bacteria | 6296 |
| 558 | Ga0495667_0015810 | 3300046559 | Bacteria | 5102 |
| 559 | Ga0495667_0065960 | 3300046559 | Bacteria | 2367 |
| 560 | Ga0495634_0041873 | 3300046642 | Bacteria | 3109 |
| 561 | Ga0495611_0014403 | 3300046648 | Bacteria | 3377 |
| 562 | Ga0495635_0075014 | 3300046663 | Bacteria | 2317 |
| 563 | Ga0495635_0097321 | 3300046663 | Bacteria | 2011 |
| 564 | Ga0495657_0000156 | 3300046675 | Bacteria | 61702 |
| 565 | Ga0495657_0016689 | 3300046675 | Bacteria | 5343 |
| 566 | Ga0495657_0083947 | 3300046675 | Bacteria | 2055 |
| 567 | Ga0495657_0097031 | 3300046675 | Bacteria | 1882 |
| 568 | Ga0495599_0000097 | 3300046678 | Bacteria | 61561 |
| 569 | Ga0495599_0024650 | 3300046678 | Bacteria | 3762 |
| 570 | Ga0495599_0025075 | 3300046678 | Bacteria | 3732 |
| 571 | Ga0495599_0029592 | 3300046678 | Bacteria | 3433 |
| 572 | Ga0495599_0070310 | 3300046678 | Bacteria | 2184 |
| 573 | Ga0495623_0000598 | 3300046679 | Bacteria | 24081 |
| 574 | Ga0495623_0009845 | 3300046679 | Bacteria | 6194 |
| 575 | Ga0495646_0010719 | 3300046680 | Bacteria | 5824 |
| 576 | Ga0495646_0019048 | 3300046680 | Bacteria | 4348 |
| 577 | Ga0495658_0035192 | 3300046683 | Bacteria | 2753 |
| 578 | Ga0495613_0002133 | 3300046689 | Bacteria | 14995 |
| 579 | Ga0495613_0007752 | 3300046689 | Bacteria | 7990 |
| 580 | Ga0495613_0062317 | 3300046689 | Bacteria | 2729 |
| 581 | Ga0495624_0003732 | 3300046690 | Bacteria | 11262 |
| 582 | Ga0495624_0086786 | 3300046690 | Bacteria | 1932 |
| 583 | Ga0495600_0012217 | 3300046809 | Bacteria | 5364 |
| 584 | Ga0495600_0018080 | 3300046809 | Bacteria | 4489 |
| 585 | Ga0495581_0001296 | 3300047315 | Bacteria | 13795 |
| 586 | Ga0495604_0000196 | 3300047317 | Bacteria | 54755 |
| 587 | Ga0495604_0031980 | 3300047317 | Bacteria | 4171 |
| 588 | Ga0495604_0040446 | 3300047317 | Bacteria | 3660 |
| 589 | Ga0495604_0053482 | 3300047317 | Bacteria | 3120 |
| 590 | Ga0495674_0014152 | 3300047319 | Bacteria | 7474 |
| 591 | Ga0495674_0033589 | 3300047319 | Bacteria | 4645 |
| 592 | Ga0495674_0039058 | 3300047319 | Bacteria | 4255 |
| 593 | Ga0495674_0067157 | 3300047319 | Bacteria | 3107 |
| 594 | Ga0495676_0007067 | 3300047321 | Bacteria | 10297 |
| 595 | Ga0495680_0000226 | 3300047322 | Bacteria | 61646 |
| 596 | Ga0495680_0003937 | 3300047322 | Bacteria | 14360 |
| 597 | Ga0495680_0013697 | 3300047322 | Bacteria | 7061 |
| 598 | Ga0495680_0017763 | 3300047322 | Bacteria | 6056 |
| 599 | Ga0495683_0086216 | 3300047323 | Bacteria | 1526 |
| 600 | Ga0495675_0000536 | 3300047444 | Bacteria | 24593 |
| 601 | Ga0495675_0000758 | 3300047444 | Bacteria | 20210 |
| 602 | Ga0495675_0030117 | 3300047444 | Bacteria | 3463 |
| 603 | Ga0495675_0212295 | 3300047444 | Bacteria | 1174 |
| 604 | Ga0495684_0011554 | 3300047471 | Bacteria | 6820 |
| 605 | Ga0495684_0049281 | 3300047471 | Bacteria | 3218 |
| 606 | Ga0495684_0168873 | 3300047471 | Bacteria | 1628 |
| 607 | Ga0495593_0012847 | 3300047673 | Bacteria | 4783 |
| 608 | Ga0495593_0023845 | 3300047673 | Bacteria | 3396 |
| 609 | Ga0495602_0000172 | 3300048088 | Bacteria | 60316 |
| 610 | Ga0495602_0037737 | 3300048088 | Bacteria | 4478 |
| 611 | Ga0495602_0104695 | 3300048088 | Bacteria | 2314 |
| 612 | Ga0495602_0158965 | 3300048088 | Bacteria | 1766 |
| 613 | Ga0495614_0002029 | 3300048089 | Bacteria | 8905 |
| 614 | Ga0496100_0002693 | 3300048903 | Bacteria | 9064 |
| 615 | Ga0496101_0003317 | 3300048904 | Bacteria | 10012 |
| 616 | Ga0496101_0025918 | 3300048904 | Bacteria | 4072 |
| 617 | Ga0496101_0158094 | 3300048904 | Bacteria | 1737 |
| 618 | Ga0496102_0000018 | 3300048905 | Bacteria | 266847 |
| 619 | Ga0496102_0000072 | 3300048905 | Bacteria | 150284 |
| 620 | Ga0496102_0005012 | 3300048905 | Bacteria | 11216 |
| 621 | Ga0496102_0113320 | 3300048905 | Bacteria | 2530 |
| 622 | Ga0496102_0204942 | 3300048905 | Bacteria | 1859 |
| 623 | Ga0496103_0000053 | 3300048906 | Bacteria | 148944 |
| 624 | Ga0496103_0001801 | 3300048906 | Bacteria | 13955 |
| 625 | Ga0496103_0246750 | 3300048906 | Bacteria | 1149 |
| 626 | Ga0496104_0000813 | 3300048907 | Bacteria | 26826 |
| 627 | Ga0496105_0036185 | 3300048908 | Bacteria | 4065 |
| 628 | Ga0496105_0043052 | 3300048908 | Bacteria | 3724 |
| 629 | Ga0496105_0164025 | 3300048908 | Bacteria | 1823 |
| 630 | Ga0496105_0175902 | 3300048908 | Bacteria | 1753 |
| 631 | Ga0496106_0043439 | 3300048909 | Bacteria | 3372 |
| 632 | Ga0496106_0267091 | 3300048909 | Bacteria | 1369 |
| 633 | Ga0496106_0332276 | 3300048909 | Bacteria | 1220 |
| 634 | Ga0496106_0365211 | 3300048909 | Bacteria | 1160 |
| 635 | Ga0496107_0111748 | 3300048910 | Bacteria | 2008 |
| 636 | Ga0496107_0289660 | 3300048910 | Bacteria | 1219 |
| 637 | Ga0496108_0000130 | 3300048911 | Bacteria | 74276 |
| 638 | Ga0496108_0003404 | 3300048911 | Bacteria | 12772 |
| 639 | Ga0496108_0004785 | 3300048911 | Bacteria | 10920 |
| 640 | Ga0496109_0009814 | 3300048912 | Bacteria | 8174 |
| 641 | Ga0496109_0028190 | 3300048912 | Bacteria | 5021 |
| 642 | Ga0496109_0033320 | 3300048912 | Bacteria | 4634 |
| 643 | Ga0496109_0112040 | 3300048912 | Bacteria | 2537 |
| 644 | Ga0496109_0194740 | 3300048912 | Bacteria | 1905 |
| 645 | Ga0496110_0007345 | 3300048913 | Bacteria | 8797 |
| 646 | Ga0496110_0047416 | 3300048913 | Bacteria | 3762 |
| 647 | Ga0496110_0057829 | 3300048913 | Bacteria | 3415 |
| 648 | Ga0496110_0118394 | 3300048913 | Bacteria | 2385 |
| 649 | Ga0496111_0058995 | 3300048914 | Bacteria | 2780 |
| 650 | Ga0496111_0155115 | 3300048914 | Bacteria | 1699 |
| 651 | Ga0496111_0164307 | 3300048914 | Bacteria | 1649 |
| 652 | Ga0496112_0247362 | 3300048915 | Bacteria | 1735 |
| 653 | Ga0496113_0044748 | 3300048916 | Bacteria | 3281 |
| 654 | Ga0496113_0096616 | 3300048916 | Bacteria | 2284 |
| 655 | Ga0496114_0006308 | 3300048917 | Bacteria | 9330 |
| 656 | Ga0496114_0026532 | 3300048917 | Bacteria | 4743 |
| 657 | Ga0496115_0003858 | 3300048918 | Bacteria | 10810 |
| 658 | Ga0496115_0024030 | 3300048918 | Bacteria | 4735 |
| 659 | Ga0496116_0000235 | 3300048919 | Bacteria | 101562 |
| 660 | Ga0496117_0000236 | 3300048920 | Bacteria | 104683 |
| 661 | Ga0496118_0000100 | 3300048921 | Bacteria | 160138 |
| 662 | Ga0496118_0012761 | 3300048921 | Bacteria | 8025 |
| 663 | Ga0496119_0000287 | 3300048922 | Bacteria | 70711 |
| 664 | Ga0496119_0004320 | 3300048922 | Bacteria | 14191 |
| 665 | Ga0496119_0110024 | 3300048922 | Bacteria | 1531 |
| 666 | Ga0496120_0013256 | 3300048923 | Bacteria | 5561 |
| 667 | Ga0496120_0023174 | 3300048923 | Bacteria | 3890 |
| 668 | Ga0496120_0050532 | 3300048923 | Bacteria | 2380 |
| 669 | Ga0496121_0046206 | 3300048924 | Bacteria | 3729 |
| 670 | Ga0496123_0132360 | 3300048926 | Bacteria | 1379 |
| 671 | Ga0496124_0033648 | 3300048927 | Bacteria | 4507 |
| 672 | Ga0496125_0065010 | 3300048928 | Bacteria | 2893 |
| 673 | Ga0496126_0000327 | 3300048929 | Bacteria | 101544 |
| 674 | Ga0501031_0024088 | 3300049568 | Bacteria | 3968 |
| 675 | Ga0501031_0030747 | 3300049568 | Bacteria | 3503 |
| 676 | Ga0501032_0002522 | 3300049569 | Bacteria | 14324 |
| 677 | Ga0501032_0007658 | 3300049569 | Bacteria | 7874 |
| 678 | Ga0501032_0169478 | 3300049569 | Bacteria | 1432 |
| 679 | Ga0501033_0036701 | 3300049570 | Bacteria | 3671 |
| 680 | Ga0501033_0060395 | 3300049570 | Bacteria | 2797 |
| 681 | Ga0501034_0005719 | 3300049571 | Bacteria | 13518 |
| 682 | Ga0501034_0015342 | 3300049571 | Bacteria | 7874 |
| 683 | Ga0501034_0051470 | 3300049571 | Bacteria | 4152 |
| 684 | Ga0501036_0001806 | 3300049572 | Bacteria | 16579 |
| 685 | Ga0501036_0056168 | 3300049572 | Bacteria | 3335 |
| 686 | Ga0501036_0112079 | 3300049572 | Bacteria | 2305 |
| 687 | Ga0501037_0005665 | 3300049573 | Bacteria | 9106 |
| 688 | Ga0501037_0014110 | 3300049573 | Bacteria | 5885 |
| 689 | Ga0501038_0005464 | 3300049574 | Bacteria | 11805 |
| 690 | Ga0501038_0014231 | 3300049574 | Bacteria | 7249 |
| 691 | Ga0501038_0078455 | 3300049574 | Bacteria | 2786 |
| 692 | Ga0501038_0137555 | 3300049574 | Bacteria | 2000 |
| 693 | Ga0501039_0128598 | 3300049575 | Bacteria | 1987 |
| 694 | Ga0501040_0064002 | 3300049576 | Bacteria | 2531 |
| 695 | Ga0501041_0001046 | 3300049577 | Bacteria | 15140 |
| 696 | Ga0501042_0002964 | 3300049578 | Bacteria | 10555 |
| 697 | Ga0501042_0003678 | 3300049578 | Bacteria | 9670 |
| 698 | Ga0501043_0000455 | 3300049579 | Bacteria | 36442 |
| 699 | Ga0501043_0001998 | 3300049579 | Bacteria | 17408 |
| 700 | Ga0501046_0012457 | 3300049580 | Bacteria | 7240 |
| 701 | Ga0501046_0015268 | 3300049580 | Bacteria | 6458 |
| 702 | Ga0501046_0015991 | 3300049580 | Bacteria | 6293 |
| 703 | Ga0501047_0001178 | 3300049581 | Bacteria | 25916 |
| 704 | Ga0501047_0005117 | 3300049581 | Bacteria | 12301 |
| 705 | Ga0501047_0019871 | 3300049581 | Bacteria | 6447 |
| 706 | Ga0501047_0048994 | 3300049581 | Bacteria | 4079 |
| 707 | Ga0501048_0057694 | 3300049582 | Bacteria | 2752 |
| 708 | Ga0501067_0009126 | 3300049583 | Bacteria | 5492 |
| 709 | Ga0501067_0042551 | 3300049583 | Bacteria | 2522 |
| 710 | Ga0501068_0001299 | 3300049584 | Bacteria | 13234 |
| 711 | Ga0501069_0005490 | 3300049585 | Bacteria | 6598 |
| 712 | Ga0501071_0000279 | 3300049587 | Bacteria | 24330 |
| 713 | Ga0501072_0013377 | 3300049588 | Bacteria | 6280 |
| 714 | Ga0501073_0019654 | 3300049589 | Bacteria | 4873 |
| 715 | Ga0501080_0042678 | 3300049742 | Bacteria | 4222 |
| 716 | Ga0501083_0002070 | 3300049744 | Bacteria | 13798 |
| 717 | Ga0501035_0000635 | 3300049822 | Bacteria | 38739 |
| 718 | Ga0501035_0007116 | 3300049822 | Bacteria | 10457 |
| 719 | Ga0501035_0007550 | 3300049822 | Bacteria | 10162 |
| 720 | Ga0501044_0000558 | 3300049823 | Bacteria | 45232 |
| 721 | Ga0501044_0060463 | 3300049823 | Bacteria | 3879 |
| 722 | Ga0501044_0067276 | 3300049823 | Bacteria | 3650 |
| 723 | Ga0501045_0038258 | 3300049824 | Bacteria | 3488 |
| 724 | Ga0501045_0224068 | 3300049824 | Bacteria | 1400 |
| 725 | nmdc:mga05p37_183_c1 | 3300050507 | Bacteria | 61506 |
| 726 | nmdc:mga05p37_2542_c1 | 3300050507 | Bacteria | 21207 |
| 727 | nmdc:mga05p37_29681_c1 | 3300050507 | Bacteria | 6673 |
| 728 | nmdc:mga05p37_452_c1 | 3300050507 | Bacteria | 44614 |
| 729 | nmdc:mga05p37_456139_c1 | 3300050507 | Bacteria | 1478 |
| 730 | nmdc:mga05p37_667219_c1 | 3300050507 | Bacteria | 1161 |
| 731 | nmdc:mga09592_114343_c1 | 3300050508 | Bacteria | 2316 |
| 732 | nmdc:mga09592_134899_c1 | 3300050508 | Bacteria | 2126 |
| 733 | nmdc:mga09592_38_c1 | 3300050508 | Bacteria | 29351 |
| 734 | nmdc:mga0qj67_140903_c1 | 3300050509 | Bacteria | 1955 |
| 735 | nmdc:mga0qj67_31_c3 | 3300050509 | Bacteria | 66411 |
| 736 | nmdc:mga0qj67_510_c1 | 3300050509 | Bacteria | 26591 |
| 737 | nmdc:mga0qj67_54938_c1 | 3300050509 | Bacteria | 3154 |
| 738 | nmdc:mga06r32_101008_c1 | 3300050510 | Bacteria | 2830 |
| 739 | nmdc:mga06r32_19_c1 | 3300050510 | Bacteria | 98901 |
| 740 | nmdc:mga08y16_167590_c2 | 3300050511 | Bacteria | 1947 |
| 741 | nmdc:mga0n895_18105_c1 | 3300050512 | Bacteria | 6513 |
| 742 | nmdc:mga0n895_18118_c1 | 3300050512 | Bacteria | 6511 |
| 743 | nmdc:mga0rr50_109922_c1 | 3300050513 | Bacteria | 2180 |
| 744 | nmdc:mga0rr50_3275_c1 | 3300050513 | Bacteria | 9287 |
| 745 | nmdc:mga0rr50_41384_c1 | 3300050513 | Bacteria | 3357 |
| 746 | nmdc:mga08x19_17884_c1 | 3300050514 | Bacteria | 4339 |
| 747 | nmdc:mga0a205_136085_c1 | 3300050515 | Bacteria | 2357 |
| 748 | nmdc:mga0a205_257111_c1 | 3300050515 | Bacteria | 1625 |
| 749 | Ga0495601_0005123 | 3300053077 | Bacteria | 7615 |
| 750 | Ga0495601_0006429 | 3300053077 | Bacteria | 6872 |
| 751 | Ga0495601_0050977 | 3300053077 | Bacteria | 2612 |
| 752 | Ga0495601_0086072 | 3300053077 | Bacteria | 2019 |
| 753 | Ga0495601_0194897 | 3300053077 | Bacteria | 1324 |
| 754 | Ga0495612_0003720 | 3300053078 | Bacteria | 6336 |
| 755 | Ga0495612_0018161 | 3300053078 | Bacteria | 2815 |
| 756 | Ga0495595_0019153 | 3300053084 | Bacteria | 2967 |
| 757 | Ga0495619_0033314 | 3300053085 | Bacteria | 3345 |
| 758 | Ga0495619_0114985 | 3300053085 | Bacteria | 1841 |
| 759 | Ga0500569_009041 | 3300053109 | Bacteria | 2302 |
| 760 | Ga0500568_0028236 | 3300053139 | Bacteria | 2340 |
| 761 | Ga0501084_0060980 | 3300054114 | Bacteria | 3157 |
| 762 | Ga0590075_014495 | 3300059424 | Bacteria | 1927 |
| 763 | Ga0501082_0004653 | 3300060353 | Bacteria | 11971 |
| 764 | Ga0466962_0009013 | 3300061719 | Bacteria | 4778 |
| 765 | Ga0466962_0023041 | 3300061719 | Bacteria | 2994 |
| 766 | Ga0466962_0033888 | 3300061719 | Bacteria | 2444 |
| 767 | Ga0466962_0116840 | 3300061719 | Bacteria | 1286 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0022365 | Ga0395898_0022365_2902_3873 | 287 |
| 2 | 3300038443 | Ga0395901_0009517 | Ga0395901_0009517_2099_3070 | 287 |
| 3 | 3300031995 | Ga0307409_100237770 | Ga0307409_1002377702 | 296 |
| 4 | 3300009177 | Ga0105248_10241747 | Ga0105248_102417473 | 297 |
| 5 | 3300009553 | Ga0105249_10434944 | Ga0105249_104349441 | 297 |
| 6 | 3300010375 | Ga0105239_10467001 | Ga0105239_104670011 | 297 |
| 7 | 3300028381 | Ga0268264_10604206 | Ga0268264_106042061 | 297 |
| 8 | 3300048909 | Ga0496106_0365211 | Ga0496106_0365211_200_1093 | 297 |
| 9 | 3300048910 | Ga0496107_0289660 | Ga0496107_0289660_94_987 | 297 |
| 10 | 3300005335 | Ga0070666_10003339 | Ga0070666_100033395 | 299 |
| 11 | 3300005347 | Ga0070668_100014178 | Ga0070668_1000141785 | 299 |
| 12 | 3300005367 | Ga0070667_100009863 | Ga0070667_1000098636 | 299 |
| 13 | 3300005548 | Ga0070665_100065832 | Ga0070665_1000658323 | 299 |
| 14 | 3300005841 | Ga0068863_100290750 | Ga0068863_1002907502 | 299 |
| 15 | 3300005842 | Ga0068858_100052910 | Ga0068858_1000529102 | 299 |
| 16 | 3300005843 | Ga0068860_100000043 | Ga0068860_100000043144 | 299 |
| 17 | 3300025903 | Ga0207680_10049916 | Ga0207680_100499163 | 299 |
| 18 | 3300025931 | Ga0207644_10039462 | Ga0207644_100394623 | 299 |
| 19 | 3300025986 | Ga0207658_10012887 | Ga0207658_100128873 | 299 |
| 20 | 3300026088 | Ga0207641_10107073 | Ga0207641_101070732 | 299 |
| 21 | 3300028379 | Ga0268266_10001896 | Ga0268266_1000189623 | 299 |
| 22 | 3300028381 | Ga0268264_10000027 | Ga0268264_10000027355 | 299 |
| 23 | 3300031995 | Ga0307409_100241885 | Ga0307409_1002418852 | 299 |
| 24 | 3300005437 | Ga0070710_10000022 | Ga0070710_1000002225 | 300 |
| 25 | 3300025898 | Ga0207692_10000029 | Ga0207692_1000002935 | 300 |
| 26 | 3300044683 | Ga0466965_0071387 | Ga0466965_0071387_166_1119 | 300 |
| 27 | 3300030731 | Ga0316177_1035054 | Ga0316177_10350542 | 301 |
| 28 | 3300030732 | Ga0316176_1086942 | Ga0316176_10869422 | 301 |
| 29 | 3300030733 | Ga0314311_1071118 | Ga0314311_10711182 | 301 |
| 30 | 3300044656 | Ga0466969_0130717 | Ga0466969_0130717_168_1133 | 301 |
| 31 | 3300048922 | Ga0496119_0000287 | Ga0496119_0000287_19946_20941 | 304 |
| 32 | 3300048923 | Ga0496120_0023174 | Ga0496120_0023174_2134_3129 | 304 |
| 33 | 3300009098 | Ga0105245_10007214 | Ga0105245_100072148 | 306 |
| 34 | 3300025927 | Ga0207687_10038525 | Ga0207687_100385253 | 306 |
| 35 | 3300005616 | Ga0068852_100029337 | Ga0068852_1000293373 | 307 |
| 36 | 3300026142 | Ga0207698_10020599 | Ga0207698_100205993 | 307 |
| 37 | 3300005441 | Ga0070700_100000007 | Ga0070700_100000007165 | 308 |
| 38 | 3300006844 | Ga0075428_100008761 | Ga0075428_1000087618 | 308 |
| 39 | 3300026075 | Ga0207708_10000006 | Ga0207708_1000000613 | 308 |
| 40 | 3300013104 | Ga0157370_10147085 | Ga0157370_101470852 | 309 |
| 41 | 3300013306 | Ga0163162_10094019 | Ga0163162_100940191 | 309 |
| 42 | 3300037418 | Ga0395900_0073954 | Ga0395900_0073954_1403_2353 | 309 |
| 43 | 3300037466 | Ga0395898_0008364 | Ga0395898_0008364_9752_10702 | 309 |
| 44 | 3300037471 | Ga0395905_0078998 | Ga0395905_0078998_1872_2822 | 309 |
| 45 | 3300044693 | Ga0466961_0176004 | Ga0466961_0176004_116_1090 | 309 |
| 46 | 3300048906 | Ga0496103_0246750 | Ga0496103_0246750_77_1006 | 309 |
| 47 | 3300025913 | Ga0207695_10181850 | Ga0207695_101818502 | 310 |
| 48 | 3300039437 | Ga0436365_1288594 | Ga0436365_1288594_5230_6162 | 310 |
| 49 | 3300044693 | Ga0466961_0068137 | Ga0466961_0068137_551_1516 | 310 |
| 50 | 3300044765 | Ga0466970_0100269 | Ga0466970_0100269_271_1380 | 310 |
| 51 | 3300045976 | Ga0466967_0005551 | Ga0466967_0005551_5735_6712 | 310 |
| 52 | 3300005337 | Ga0070682_100278030 | Ga0070682_1002780302 | 311 |
| 53 | 3300005617 | Ga0068859_100020881 | Ga0068859_1000208813 | 311 |
| 54 | 3300005937 | Ga0081455_10005254 | Ga0081455_100052547 | 311 |
| 55 | 3300006846 | Ga0075430_100144651 | Ga0075430_1001446512 | 311 |
| 56 | 3300006931 | Ga0097620_100020881 | Ga0097620_1000208814 | 311 |
| 57 | 3300009093 | Ga0105240_10122614 | Ga0105240_101226144 | 311 |
| 58 | 3300011119 | Ga0105246_10079679 | Ga0105246_100796791 | 311 |
| 59 | 3300013307 | Ga0157372_10000025 | Ga0157372_1000002524 | 311 |
| 60 | 3300025913 | Ga0207695_10136819 | Ga0207695_101368193 | 311 |
| 61 | 3300032126 | Ga0307415_100107682 | Ga0307415_1001076822 | 311 |
| 62 | 3300050509 | nmdc:mga0qj67_140903_c1 | nmdc:mga0qj67_140903_c1_379_1371 | 311 |
| 63 | iso_pu_bacteria | 8056054917 | 8056059403 | 311 |
| 64 | 3300006847 | Ga0075431_100354599 | Ga0075431_1003545991 | 312 |
| 65 | 3300025904 | Ga0207647_10007928 | Ga0207647_100079282 | 312 |
| 66 | 3300026067 | Ga0207678_10250017 | Ga0207678_102500172 | 312 |
| 67 | 3300037853 | Ga0436364_0235358 | Ga0436364_0235358_17957_18925 | 312 |
| 68 | 3300048909 | Ga0496106_0332276 | Ga0496106_0332276_77_1057 | 312 |
| 69 | 3300009147 | Ga0114129_10001122 | Ga0114129_1000112213 | 313 |
| 70 | 3300031456 | Ga0307513_10000009 | Ga0307513_10000009272 | 313 |
| 71 | 3300041411 | Ga0439466_0022877 | Ga0439466_0022877_458_1426 | 313 |
| 72 | 3300042007 | Ga0439449_0004608 | Ga0439449_0004608_2440_3411 | 313 |
| 73 | 3300042007 | Ga0439449_0063996 | Ga0439449_0063996_245_1213 | 313 |
| 74 | 3300044706 | Ga0466964_0022535 | Ga0466964_0022535_930_1871 | 313 |
| 75 | 3300044901 | Ga0466960_0056586 | Ga0466960_0056586_823_1809 | 313 |
| 76 | 3300045976 | Ga0466967_0003203 | Ga0466967_0003203_3579_4520 | 313 |
| 77 | 3300050507 | nmdc:mga05p37_452_c1 | nmdc:mga05p37_452_c1_43551_44510 | 313 |
| 78 | iso_pu_bacteria | 2837268691 | 2837273153 | 313 |
| 79 | 3300044842 | Ga0466957_0339857 | Ga0466957_0339857_16_999 | 314 |
| 80 | 3300045976 | Ga0466967_0009756 | Ga0466967_0009756_3699_4676 | 314 |
| 81 | iso_pu_bacteria | 2582581312 | 2585301109 | 314 |
| 82 | iso_pu_bacteria | 2616644941 | 2616899408 | 314 |
| 83 | iso_pu_bacteria | 2818991463 | 2819694139 | 314 |
| 84 | 3300005937 | Ga0081455_10095721 | Ga0081455_100957211 | 315 |
| 85 | iso_pu_bacteria | 2731639228 | 2731908100 | 315 |
| 86 | iso_pu_bacteria | 2811994880 | 2812365468 | 315 |
| 87 | iso_pu_bacteria | 2884693830 | 2884697575 | 315 |
| 88 | iso_pu_bacteria | 2895427314 | 2895438137 | 315 |
| 89 | iso_pu_bacteria | 2895442618 | 2895447631 | 315 |
| 90 | 3300005445 | Ga0070708_100114315 | Ga0070708_1001143152 | 316 |
| 91 | 3300005468 | Ga0070707_100019784 | Ga0070707_1000197843 | 316 |
| 92 | 3300005468 | Ga0070707_100051387 | Ga0070707_1000513872 | 316 |
| 93 | 3300005468 | Ga0070707_100055841 | Ga0070707_1000558413 | 316 |
| 94 | 3300005468 | Ga0070707_100172948 | Ga0070707_1001729482 | 316 |
| 95 | 3300005518 | Ga0070699_100024969 | Ga0070699_1000249695 | 316 |
| 96 | 3300005563 | Ga0068855_100003671 | Ga0068855_10000367110 | 316 |
| 97 | 3300005578 | Ga0068854_100000894 | Ga0068854_1000008948 | 316 |
| 98 | 3300005937 | Ga0081455_10000249 | Ga0081455_1000024930 | 316 |
| 99 | 3300009545 | Ga0105237_10008476 | Ga0105237_100084767 | 316 |
| 100 | 3300009551 | Ga0105238_10006220 | Ga0105238_100062204 | 316 |
| 101 | 3300009993 | Ga0105028_104374 | Ga0105028_1043742 | 316 |
| 102 | 3300010375 | Ga0105239_10241209 | Ga0105239_102412092 | 316 |
| 103 | 3300020082 | Ga0206353_11687186 | Ga0206353_116871861 | 316 |
| 104 | 3300021388 | Ga0213875_10002941 | Ga0213875_100029418 | 316 |
| 105 | 3300021388 | Ga0213875_10030543 | Ga0213875_100305432 | 316 |
| 106 | 3300025904 | Ga0207647_10021834 | Ga0207647_100218343 | 316 |
| 107 | 3300025910 | Ga0207684_10011415 | Ga0207684_100114155 | 316 |
| 108 | 3300025910 | Ga0207684_10243727 | Ga0207684_102437272 | 316 |
| 109 | 3300025911 | Ga0207654_10025263 | Ga0207654_100252633 | 316 |
| 110 | 3300025913 | Ga0207695_10003521 | Ga0207695_1000352113 | 316 |
| 111 | 3300025914 | Ga0207671_10000142 | Ga0207671_1000014262 | 316 |
| 112 | 3300025922 | Ga0207646_10011082 | Ga0207646_100110826 | 316 |
| 113 | 3300025922 | Ga0207646_10024869 | Ga0207646_100248694 | 316 |
| 114 | 3300025922 | Ga0207646_10071417 | Ga0207646_100714173 | 316 |
| 115 | 3300025924 | Ga0207694_10000366 | Ga0207694_100003669 | 316 |
| 116 | 3300025949 | Ga0207667_10016776 | Ga0207667_100167765 | 316 |
| 117 | 3300026067 | Ga0207678_10298081 | Ga0207678_102980811 | 316 |
| 118 | 3300028379 | Ga0268266_10193091 | Ga0268266_101930911 | 316 |
| 119 | 3300031824 | Ga0307413_10211396 | Ga0307413_102113962 | 316 |
| 120 | 3300032126 | Ga0307415_100090991 | Ga0307415_1000909911 | 316 |
| 121 | 3300037853 | Ga0436364_0132832 | Ga0436364_0132832_1766_2737 | 316 |
| 122 | 3300037853 | Ga0436364_0805657 | Ga0436364_0805657_45443_46399 | 316 |
| 123 | 3300044765 | Ga0466970_0102994 | Ga0466970_0102994_105_1055 | 316 |
| 124 | 3300046462 | Ga0495651_0001465 | Ga0495651_0001465_6555_7505 | 316 |
| 125 | 3300046516 | Ga0495628_0009964 | Ga0495628_0009964_6516_7466 | 316 |
| 126 | 3300046529 | Ga0495652_0001004 | Ga0495652_0001004_31328_32278 | 316 |
| 127 | 3300046543 | Ga0495645_0057988 | Ga0495645_0057988_580_1530 | 316 |
| 128 | 3300046809 | Ga0495600_0018080 | Ga0495600_0018080_1244_2194 | 316 |
| 129 | iso_pu_bacteria | 2622736605 | 2623498599 | 316 |
| 130 | iso_pu_bacteria | 2675903058 | 2676476823 | 316 |
| 131 | iso_pu_bacteria | 2827628540 | 2827630087 | 316 |
| 132 | iso_pu_bacteria | 2984592036 | 2984594454 | 316 |
| 133 | iso_pu_bacteria | 8048127548 | 8048135539 | 316 |
| 134 | iso_pu_bacteria | 8057568493 | 8057568685 | 316 |
| 135 | 3300005329 | Ga0070683_100113636 | Ga0070683_1001136361 | 317 |
| 136 | 3300005338 | Ga0068868_100140987 | Ga0068868_1001409873 | 317 |
| 137 | 3300005339 | Ga0070660_100086181 | Ga0070660_1000861812 | 317 |
| 138 | 3300005343 | Ga0070687_100006098 | Ga0070687_1000060983 | 317 |
| 139 | 3300005345 | Ga0070692_10000835 | Ga0070692_100008353 | 317 |
| 140 | 3300005347 | Ga0070668_100053430 | Ga0070668_1000534303 | 317 |
| 141 | 3300005366 | Ga0070659_100044395 | Ga0070659_1000443953 | 317 |
| 142 | 3300005434 | Ga0070709_10093951 | Ga0070709_100939512 | 317 |
| 143 | 3300005435 | Ga0070714_100001732 | Ga0070714_10000173212 | 317 |
| 144 | 3300005435 | Ga0070714_100028640 | Ga0070714_1000286402 | 317 |
| 145 | 3300005435 | Ga0070714_100034845 | Ga0070714_1000348453 | 317 |
| 146 | 3300005435 | Ga0070714_100047156 | Ga0070714_1000471561 | 317 |
| 147 | 3300005436 | Ga0070713_100058884 | Ga0070713_1000588843 | 317 |
| 148 | 3300005437 | Ga0070710_10000728 | Ga0070710_100007284 | 317 |
| 149 | 3300005437 | Ga0070710_10005739 | Ga0070710_100057394 | 317 |
| 150 | 3300005437 | Ga0070710_10086755 | Ga0070710_100867552 | 317 |
| 151 | 3300005438 | Ga0070701_10002686 | Ga0070701_100026863 | 317 |
| 152 | 3300005438 | Ga0070701_10264921 | Ga0070701_102649211 | 317 |
| 153 | 3300005439 | Ga0070711_100003236 | Ga0070711_1000032363 | 317 |
| 154 | 3300005439 | Ga0070711_100068002 | Ga0070711_1000680023 | 317 |
| 155 | 3300005439 | Ga0070711_100085449 | Ga0070711_1000854492 | 317 |
| 156 | 3300005441 | Ga0070700_100003580 | Ga0070700_1000035802 | 317 |
| 157 | 3300005445 | Ga0070708_100005297 | Ga0070708_1000052978 | 317 |
| 158 | 3300005445 | Ga0070708_100015632 | Ga0070708_1000156322 | 317 |
| 159 | 3300005445 | Ga0070708_100452818 | Ga0070708_1004528181 | 317 |
| 160 | 3300005459 | Ga0068867_100059967 | Ga0068867_1000599673 | 317 |
| 161 | 3300005467 | Ga0070706_100001516 | Ga0070706_10000151612 | 317 |
| 162 | 3300005467 | Ga0070706_100004145 | Ga0070706_1000041458 | 317 |
| 163 | 3300005468 | Ga0070707_100000199 | Ga0070707_10000019947 | 317 |
| 164 | 3300005468 | Ga0070707_100001581 | Ga0070707_10000158116 | 317 |
| 165 | 3300005468 | Ga0070707_100005343 | Ga0070707_1000053436 | 317 |
| 166 | 3300005471 | Ga0070698_100000264 | Ga0070698_10000026411 | 317 |
| 167 | 3300005471 | Ga0070698_100011473 | Ga0070698_1000114734 | 317 |
| 168 | 3300005471 | Ga0070698_100098051 | Ga0070698_1000980512 | 317 |
| 169 | 3300005535 | Ga0070684_100070375 | Ga0070684_1000703753 | 317 |
| 170 | 3300005536 | Ga0070697_100103388 | Ga0070697_1001033882 | 317 |
| 171 | 3300005543 | Ga0070672_100001420 | Ga0070672_1000014202 | 317 |
| 172 | 3300005563 | Ga0068855_100053197 | Ga0068855_1000531972 | 317 |
| 173 | 3300005564 | Ga0070664_100161484 | Ga0070664_1001614842 | 317 |
| 174 | 3300005578 | Ga0068854_100020126 | Ga0068854_1000201263 | 317 |
| 175 | 3300005615 | Ga0070702_100008011 | Ga0070702_1000080111 | 317 |
| 176 | 3300005616 | Ga0068852_100020460 | Ga0068852_1000204606 | 317 |
| 177 | 3300005618 | Ga0068864_100178531 | Ga0068864_1001785312 | 317 |
| 178 | 3300005719 | Ga0068861_100002683 | Ga0068861_1000026834 | 317 |
| 179 | 3300005981 | Ga0081538_10001888 | Ga0081538_100018882 | 317 |
| 180 | 3300006028 | Ga0070717_10022992 | Ga0070717_100229922 | 317 |
| 181 | 3300006028 | Ga0070717_10030301 | Ga0070717_100303013 | 317 |
| 182 | 3300006028 | Ga0070717_10055214 | Ga0070717_100552141 | 317 |
| 183 | 3300006163 | Ga0070715_10014019 | Ga0070715_100140192 | 317 |
| 184 | 3300006163 | Ga0070715_10032780 | Ga0070715_100327801 | 317 |
| 185 | 3300006173 | Ga0070716_100001767 | Ga0070716_1000017673 | 317 |
| 186 | 3300006173 | Ga0070716_100010067 | Ga0070716_1000100673 | 317 |
| 187 | 3300006175 | Ga0070712_100066741 | Ga0070712_1000667413 | 317 |
| 188 | 3300006852 | Ga0075433_10027206 | Ga0075433_100272063 | 317 |
| 189 | 3300006871 | Ga0075434_100009265 | Ga0075434_1000092653 | 317 |
| 190 | 3300006881 | Ga0068865_100014097 | Ga0068865_1000140973 | 317 |
| 191 | 3300006914 | Ga0075436_100149571 | Ga0075436_1001495711 | 317 |
| 192 | 3300007076 | Ga0075435_100285399 | Ga0075435_1002853991 | 317 |
| 193 | 3300007076 | Ga0075435_100333893 | Ga0075435_1003338932 | 317 |
| 194 | 3300009147 | Ga0114129_10002252 | Ga0114129_100022524 | 317 |
| 195 | 3300009177 | Ga0105248_10522081 | Ga0105248_105220811 | 317 |
| 196 | 3300020069 | Ga0197907_11058319 | Ga0197907_110583191 | 317 |
| 197 | 3300021384 | Ga0213876_10062061 | Ga0213876_100620611 | 317 |
| 198 | 3300025898 | Ga0207692_10000976 | Ga0207692_100009764 | 317 |
| 199 | 3300025906 | Ga0207699_10001689 | Ga0207699_100016895 | 317 |
| 200 | 3300025906 | Ga0207699_10003631 | Ga0207699_100036311 | 317 |
| 201 | 3300025908 | Ga0207643_10000838 | Ga0207643_1000083813 | 317 |
| 202 | 3300025910 | Ga0207684_10001106 | Ga0207684_1000110625 | 317 |
| 203 | 3300025910 | Ga0207684_10001458 | Ga0207684_1000145813 | 317 |
| 204 | 3300025910 | Ga0207684_10010776 | Ga0207684_100107763 | 317 |
| 205 | 3300025910 | Ga0207684_10160734 | Ga0207684_101607342 | 317 |
| 206 | 3300025915 | Ga0207693_10011211 | Ga0207693_100112114 | 317 |
| 207 | 3300025916 | Ga0207663_10003895 | Ga0207663_100038956 | 317 |
| 208 | 3300025918 | Ga0207662_10094022 | Ga0207662_100940223 | 317 |
| 209 | 3300025921 | Ga0207652_10174042 | Ga0207652_101740422 | 317 |
| 210 | 3300025922 | Ga0207646_10000278 | Ga0207646_1000027845 | 317 |
| 211 | 3300025922 | Ga0207646_10002274 | Ga0207646_1000227423 | 317 |
| 212 | 3300025922 | Ga0207646_10010015 | Ga0207646_100100157 | 317 |
| 213 | 3300025922 | Ga0207646_10021539 | Ga0207646_100215394 | 317 |
| 214 | 3300025925 | Ga0207650_10389978 | Ga0207650_103899781 | 317 |
| 215 | 3300025927 | Ga0207687_10042281 | Ga0207687_100422813 | 317 |
| 216 | 3300025928 | Ga0207700_10007592 | Ga0207700_100075925 | 317 |
| 217 | 3300025928 | Ga0207700_10010224 | Ga0207700_100102244 | 317 |
| 218 | 3300025929 | Ga0207664_10003575 | Ga0207664_100035758 | 317 |
| 219 | 3300025929 | Ga0207664_10004798 | Ga0207664_100047985 | 317 |
| 220 | 3300025929 | Ga0207664_10009651 | Ga0207664_100096514 | 317 |
| 221 | 3300025929 | Ga0207664_10339085 | Ga0207664_103390851 | 317 |
| 222 | 3300025931 | Ga0207644_10178084 | Ga0207644_101780842 | 317 |
| 223 | 3300025932 | Ga0207690_10040624 | Ga0207690_100406242 | 317 |
| 224 | 3300025937 | Ga0207669_10028723 | Ga0207669_100287233 | 317 |
| 225 | 3300025938 | Ga0207704_10045180 | Ga0207704_100451803 | 317 |
| 226 | 3300025939 | Ga0207665_10009592 | Ga0207665_100095922 | 317 |
| 227 | 3300025939 | Ga0207665_10018899 | Ga0207665_100188993 | 317 |
| 228 | 3300025940 | Ga0207691_10002443 | Ga0207691_1000244311 | 317 |
| 229 | 3300025944 | Ga0207661_10106862 | Ga0207661_101068621 | 317 |
| 230 | 3300025945 | Ga0207679_10111292 | Ga0207679_101112923 | 317 |
| 231 | 3300025949 | Ga0207667_10354975 | Ga0207667_103549751 | 317 |
| 232 | 3300025972 | Ga0207668_10048668 | Ga0207668_100486684 | 317 |
| 233 | 3300026075 | Ga0207708_10000642 | Ga0207708_1000064216 | 317 |
| 234 | 3300026089 | Ga0207648_10004455 | Ga0207648_100044557 | 317 |
| 235 | 3300026118 | Ga0207675_100013277 | Ga0207675_1000132774 | 317 |
| 236 | 3300026142 | Ga0207698_10472419 | Ga0207698_104724192 | 317 |
| 237 | 3300028666 | Ga0265336_10014734 | Ga0265336_100147343 | 317 |
| 238 | 3300028800 | Ga0265338_10000827 | Ga0265338_1000082751 | 317 |
| 239 | 3300031548 | Ga0307408_100010119 | Ga0307408_1000101193 | 317 |
| 240 | 3300031728 | Ga0316578_10103480 | Ga0316578_101034801 | 317 |
| 241 | 3300031731 | Ga0307405_10087804 | Ga0307405_100878042 | 317 |
| 242 | 3300031824 | Ga0307413_10036858 | Ga0307413_100368582 | 317 |
| 243 | 3300031901 | Ga0307406_10063060 | Ga0307406_100630602 | 317 |
| 244 | 3300031911 | Ga0307412_10100726 | Ga0307412_101007262 | 317 |
| 245 | 3300032002 | Ga0307416_100000122 | Ga0307416_10000012223 | 317 |
| 246 | 3300032126 | Ga0307415_100000011 | Ga0307415_10000001126 | 317 |
| 247 | 3300035085 | Ga0373929_0008674 | Ga0373929_0008674_591_1550 | 317 |
| 248 | 3300035086 | Ga0373934_0000337 | Ga0373934_0000337_9053_10012 | 317 |
| 249 | 3300035086 | Ga0373934_0000541 | Ga0373934_0000541_1266_2225 | 317 |
| 250 | 3300035111 | Ga0373923_0017622 | Ga0373923_0017622_1099_2058 | 317 |
| 251 | 3300035111 | Ga0373923_0089844 | Ga0373923_0089844_250_1209 | 317 |
| 252 | 3300035115 | Ga0373941_0002222 | Ga0373941_0002222_3039_3998 | 317 |
| 253 | 3300035116 | Ga0373945_0010599 | Ga0373945_0010599_1019_1978 | 317 |
| 254 | 3300035117 | Ga0373953_0000759 | Ga0373953_0000759_7348_8307 | 317 |
| 255 | 3300035117 | Ga0373953_0009454 | Ga0373953_0009454_1776_2735 | 317 |
| 256 | 3300035118 | Ga0373954_0010264 | Ga0373954_0010264_1723_2682 | 317 |
| 257 | 3300035119 | Ga0373956_0001267 | Ga0373956_0001267_481_1440 | 317 |
| 258 | 3300035120 | Ga0373957_0000146 | Ga0373957_0000146_7751_8710 | 317 |
| 259 | 3300035120 | Ga0373957_0002029 | Ga0373957_0002029_959_1918 | 317 |
| 260 | 3300035120 | Ga0373957_0045538 | Ga0373957_0045538_592_1551 | 317 |
| 261 | 3300035170 | Ga0373943_0068439 | Ga0373943_0068439_266_1225 | 317 |
| 262 | 3300035171 | Ga0373946_0042214 | Ga0373946_0042214_814_1773 | 317 |
| 263 | 3300035172 | Ga0373955_0000024 | Ga0373955_0000024_50147_51106 | 317 |
| 264 | 3300035172 | Ga0373955_0004403 | Ga0373955_0004403_2272_3231 | 317 |
| 265 | 3300035172 | Ga0373955_0035955 | Ga0373955_0035955_326_1285 | 317 |
| 266 | 3300035410 | Ga0373924_0003094 | Ga0373924_0003094_3990_4949 | 317 |
| 267 | 3300035410 | Ga0373924_0018354 | Ga0373924_0018354_1668_2627 | 317 |
| 268 | 3300035692 | Ga0373935_0014464 | Ga0373935_0014464_355_1314 | 317 |
| 269 | 3300035724 | Ga0373933_0001020 | Ga0373933_0001020_9055_10014 | 317 |
| 270 | 3300035724 | Ga0373933_0057502 | Ga0373933_0057502_1358_2317 | 317 |
| 271 | 3300035724 | Ga0373933_0083274 | Ga0373933_0083274_329_1288 | 317 |
| 272 | 3300035725 | Ga0373947_0091340 | Ga0373947_0091340_519_1478 | 317 |
| 273 | 3300035725 | Ga0373947_0270788 | Ga0373947_0270788_52_1011 | 317 |
| 274 | 3300036401 | Ga0373937_0000333 | Ga0373937_0000333_34769_35728 | 317 |
| 275 | 3300036401 | Ga0373937_0007305 | Ga0373937_0007305_5328_6287 | 317 |
| 276 | 3300036401 | Ga0373937_0517706 | Ga0373937_0517706_44_1003 | 317 |
| 277 | 3300037068 | Ga0373925_0174248 | Ga0373925_0174248_60_1019 | 317 |
| 278 | 3300037068 | Ga0373925_0236618 | Ga0373925_0236618_482_1441 | 317 |
| 279 | 3300037853 | Ga0436364_1271055 | Ga0436364_1271055_785_1759 | 317 |
| 280 | 3300044658 | Ga0466972_0001796 | Ga0466972_0001796_6077_7030 | 317 |
| 281 | 3300044683 | Ga0466965_0027995 | Ga0466965_0027995_1312_2265 | 317 |
| 282 | 3300044901 | Ga0466960_0006158 | Ga0466960_0006158_949_1902 | 317 |
| 283 | 3300045976 | Ga0466967_0035877 | Ga0466967_0035877_2794_3771 | 317 |
| 284 | 3300045976 | Ga0466967_0249483 | Ga0466967_0249483_620_1573 | 317 |
| 285 | 3300046454 | Ga0495592_0000304 | Ga0495592_0000304_31494_32453 | 317 |
| 286 | 3300046454 | Ga0495592_0132341 | Ga0495592_0132341_583_1542 | 317 |
| 287 | 3300046461 | Ga0495641_0108185 | Ga0495641_0108185_182_1141 | 317 |
| 288 | 3300046462 | Ga0495651_0000252 | Ga0495651_0000252_31534_32493 | 317 |
| 289 | 3300046462 | Ga0495651_0018040 | Ga0495651_0018040_1711_2670 | 317 |
| 290 | 3300046463 | Ga0495653_0001371 | Ga0495653_0001371_12193_13152 | 317 |
| 291 | 3300046463 | Ga0495653_0009566 | Ga0495653_0009566_5965_6924 | 317 |
| 292 | 3300046463 | Ga0495653_0015034 | Ga0495653_0015034_836_1795 | 317 |
| 293 | 3300046473 | Ga0495582_0004181 | Ga0495582_0004181_6289_7248 | 317 |
| 294 | 3300046476 | Ga0495662_0030834 | Ga0495662_0030834_501_1460 | 317 |
| 295 | 3300046477 | Ga0495664_0008824 | Ga0495664_0008824_269_1228 | 317 |
| 296 | 3300046477 | Ga0495664_0070973 | Ga0495664_0070973_1051_2010 | 317 |
| 297 | 3300046477 | Ga0495664_0073784 | Ga0495664_0073784_312_1271 | 317 |
| 298 | 3300046511 | Ga0495608_0000101 | Ga0495608_0000101_9039_9998 | 317 |
| 299 | 3300046511 | Ga0495608_0073663 | Ga0495608_0073663_1024_1983 | 317 |
| 300 | 3300046514 | Ga0495618_0047408 | Ga0495618_0047408_1345_2304 | 317 |
| 301 | 3300046514 | Ga0495618_0060659 | Ga0495618_0060659_548_1507 | 317 |
| 302 | 3300046514 | Ga0495618_0127440 | Ga0495618_0127440_19_978 | 317 |
| 303 | 3300046516 | Ga0495628_0004884 | Ga0495628_0004884_1789_2748 | 317 |
| 304 | 3300046516 | Ga0495628_0010389 | Ga0495628_0010389_484_1443 | 317 |
| 305 | 3300046516 | Ga0495628_0029794 | Ga0495628_0029794_2458_3417 | 317 |
| 306 | 3300046516 | Ga0495628_0222350 | Ga0495628_0222350_444_1403 | 317 |
| 307 | 3300046517 | Ga0495630_0086753 | Ga0495630_0086753_1164_2123 | 317 |
| 308 | 3300046529 | Ga0495652_0002437 | Ga0495652_0002437_9021_9980 | 317 |
| 309 | 3300046529 | Ga0495652_0035206 | Ga0495652_0035206_3027_3986 | 317 |
| 310 | 3300046529 | Ga0495652_0036673 | Ga0495652_0036673_2427_3386 | 317 |
| 311 | 3300046529 | Ga0495652_0080402 | Ga0495652_0080402_657_1616 | 317 |
| 312 | 3300046531 | Ga0495665_0012035 | Ga0495665_0012035_3497_4456 | 317 |
| 313 | 3300046533 | Ga0495640_0033826 | Ga0495640_0033826_2540_3499 | 317 |
| 314 | 3300046533 | Ga0495640_0039427 | Ga0495640_0039427_1415_2374 | 317 |
| 315 | 3300046533 | Ga0495640_0157321 | Ga0495640_0157321_10_969 | 317 |
| 316 | 3300046536 | Ga0495587_0000228 | Ga0495587_0000228_31521_32480 | 317 |
| 317 | 3300046536 | Ga0495587_0015528 | Ga0495587_0015528_243_1202 | 317 |
| 318 | 3300046543 | Ga0495645_0012873 | Ga0495645_0012873_2385_3344 | 317 |
| 319 | 3300046543 | Ga0495645_0016317 | Ga0495645_0016317_490_1449 | 317 |
| 320 | 3300046543 | Ga0495645_0093623 | Ga0495645_0093623_357_1316 | 317 |
| 321 | 3300046543 | Ga0495645_0133386 | Ga0495645_0133386_658_1617 | 317 |
| 322 | 3300046543 | Ga0495645_0146232 | Ga0495645_0146232_488_1447 | 317 |
| 323 | 3300046543 | Ga0495645_0179584 | Ga0495645_0179584_358_1317 | 317 |
| 324 | 3300046559 | Ga0495667_0000396 | Ga0495667_0000396_9055_10014 | 317 |
| 325 | 3300046559 | Ga0495667_0015810 | Ga0495667_0015810_1585_2544 | 317 |
| 326 | 3300046559 | Ga0495667_0065960 | Ga0495667_0065960_1054_2013 | 317 |
| 327 | 3300046642 | Ga0495634_0041873 | Ga0495634_0041873_1215_2174 | 317 |
| 328 | 3300046663 | Ga0495635_0075014 | Ga0495635_0075014_681_1640 | 317 |
| 329 | 3300046663 | Ga0495635_0097321 | Ga0495635_0097321_521_1480 | 317 |
| 330 | 3300046675 | Ga0495657_0000156 | Ga0495657_0000156_51689_52648 | 317 |
| 331 | 3300046675 | Ga0495657_0016689 | Ga0495657_0016689_1747_2706 | 317 |
| 332 | 3300046678 | Ga0495599_0000097 | Ga0495599_0000097_9027_9986 | 317 |
| 333 | 3300046678 | Ga0495599_0024650 | Ga0495599_0024650_310_1269 | 317 |
| 334 | 3300046678 | Ga0495599_0029592 | Ga0495599_0029592_941_1900 | 317 |
| 335 | 3300046679 | Ga0495623_0000598 | Ga0495623_0000598_9055_10014 | 317 |
| 336 | 3300046679 | Ga0495623_0009845 | Ga0495623_0009845_906_1865 | 317 |
| 337 | 3300046680 | Ga0495646_0010719 | Ga0495646_0010719_2465_3424 | 317 |
| 338 | 3300046680 | Ga0495646_0019048 | Ga0495646_0019048_709_1668 | 317 |
| 339 | 3300046683 | Ga0495658_0035192 | Ga0495658_0035192_1173_2132 | 317 |
| 340 | 3300046690 | Ga0495624_0086786 | Ga0495624_0086786_440_1399 | 317 |
| 341 | 3300046809 | Ga0495600_0012217 | Ga0495600_0012217_3709_4668 | 317 |
| 342 | 3300047317 | Ga0495604_0000196 | Ga0495604_0000196_45972_46931 | 317 |
| 343 | 3300047317 | Ga0495604_0040446 | Ga0495604_0040446_560_1519 | 317 |
| 344 | 3300047319 | Ga0495674_0014152 | Ga0495674_0014152_153_1112 | 317 |
| 345 | 3300047319 | Ga0495674_0033589 | Ga0495674_0033589_181_1140 | 317 |
| 346 | 3300047319 | Ga0495674_0039058 | Ga0495674_0039058_757_1716 | 317 |
| 347 | 3300047319 | Ga0495674_0067157 | Ga0495674_0067157_941_1900 | 317 |
| 348 | 3300047322 | Ga0495680_0000226 | Ga0495680_0000226_51660_52619 | 317 |
| 349 | 3300047322 | Ga0495680_0003937 | Ga0495680_0003937_6234_7193 | 317 |
| 350 | 3300047322 | Ga0495680_0013697 | Ga0495680_0013697_6076_7035 | 317 |
| 351 | 3300047322 | Ga0495680_0017763 | Ga0495680_0017763_1110_2069 | 317 |
| 352 | 3300047444 | Ga0495675_0000536 | Ga0495675_0000536_3437_4396 | 317 |
| 353 | 3300047444 | Ga0495675_0030117 | Ga0495675_0030117_885_1844 | 317 |
| 354 | 3300047471 | Ga0495684_0011554 | Ga0495684_0011554_1021_1980 | 317 |
| 355 | 3300047471 | Ga0495684_0049281 | Ga0495684_0049281_395_1354 | 317 |
| 356 | 3300047673 | Ga0495593_0023845 | Ga0495593_0023845_2219_3274 | 317 |
| 357 | 3300048088 | Ga0495602_0000172 | Ga0495602_0000172_51533_52492 | 317 |
| 358 | 3300048088 | Ga0495602_0037737 | Ga0495602_0037737_2579_3538 | 317 |
| 359 | 3300048904 | Ga0496101_0025918 | Ga0496101_0025918_1834_2793 | 317 |
| 360 | 3300048904 | Ga0496101_0158094 | Ga0496101_0158094_75_1034 | 317 |
| 361 | 3300048905 | Ga0496102_0204942 | Ga0496102_0204942_579_1538 | 317 |
| 362 | 3300048907 | Ga0496104_0000813 | Ga0496104_0000813_5310_6269 | 317 |
| 363 | 3300048908 | Ga0496105_0036185 | Ga0496105_0036185_1213_2172 | 317 |
| 364 | 3300048908 | Ga0496105_0164025 | Ga0496105_0164025_225_1184 | 317 |
| 365 | 3300048909 | Ga0496106_0267091 | Ga0496106_0267091_390_1349 | 317 |
| 366 | 3300048910 | Ga0496107_0111748 | Ga0496107_0111748_208_1167 | 317 |
| 367 | 3300048911 | Ga0496108_0003404 | Ga0496108_0003404_11691_12650 | 317 |
| 368 | 3300048911 | Ga0496108_0004785 | Ga0496108_0004785_6547_7500 | 317 |
| 369 | 3300048912 | Ga0496109_0009814 | Ga0496109_0009814_4797_5750 | 317 |
| 370 | 3300048912 | Ga0496109_0033320 | Ga0496109_0033320_1037_1996 | 317 |
| 371 | 3300048912 | Ga0496109_0112040 | Ga0496109_0112040_1354_2313 | 317 |
| 372 | 3300048913 | Ga0496110_0007345 | Ga0496110_0007345_2232_3185 | 317 |
| 373 | 3300048913 | Ga0496110_0057829 | Ga0496110_0057829_509_1486 | 317 |
| 374 | 3300048914 | Ga0496111_0155115 | Ga0496111_0155115_111_1070 | 317 |
| 375 | 3300048914 | Ga0496111_0164307 | Ga0496111_0164307_175_1134 | 317 |
| 376 | 3300048916 | Ga0496113_0044748 | Ga0496113_0044748_1295_2248 | 317 |
| 377 | 3300048916 | Ga0496113_0096616 | Ga0496113_0096616_444_1403 | 317 |
| 378 | 3300048917 | Ga0496114_0026532 | Ga0496114_0026532_1311_2288 | 317 |
| 379 | 3300048918 | Ga0496115_0003858 | Ga0496115_0003858_1894_2853 | 317 |
| 380 | 3300048918 | Ga0496115_0024030 | Ga0496115_0024030_3644_4603 | 317 |
| 381 | 3300049824 | Ga0501045_0224068 | Ga0501045_0224068_25_978 | 317 |
| 382 | 3300050507 | nmdc:mga05p37_2542_c1 | nmdc:mga05p37_2542_c1_9360_10319 | 317 |
| 383 | 3300050507 | nmdc:mga05p37_456139_c1 | nmdc:mga05p37_456139_c1_174_1196 | 317 |
| 384 | 3300050512 | nmdc:mga0n895_18105_c1 | nmdc:mga0n895_18105_c1_390_1349 | 317 |
| 385 | 3300050512 | nmdc:mga0n895_18118_c1 | nmdc:mga0n895_18118_c1_3736_4695 | 317 |
| 386 | 3300050513 | nmdc:mga0rr50_109922_c1 | nmdc:mga0rr50_109922_c1_1089_2048 | 317 |
| 387 | 3300050513 | nmdc:mga0rr50_3275_c1 | nmdc:mga0rr50_3275_c1_2921_3880 | 317 |
| 388 | 3300050514 | nmdc:mga08x19_17884_c1 | nmdc:mga08x19_17884_c1_1893_2852 | 317 |
| 389 | 3300050515 | nmdc:mga0a205_136085_c1 | nmdc:mga0a205_136085_c1_1214_2173 | 317 |
| 390 | 3300050515 | nmdc:mga0a205_257111_c1 | nmdc:mga0a205_257111_c1_543_1502 | 317 |
| 391 | 3300053077 | Ga0495601_0006429 | Ga0495601_0006429_1559_2518 | 317 |
| 392 | 3300053077 | Ga0495601_0086072 | Ga0495601_0086072_575_1534 | 317 |
| 393 | 3300053077 | Ga0495601_0194897 | Ga0495601_0194897_295_1254 | 317 |
| 394 | 3300053078 | Ga0495612_0018161 | Ga0495612_0018161_1576_2535 | 317 |
| 395 | 3300053084 | Ga0495595_0019153 | Ga0495595_0019153_778_1737 | 317 |
| 396 | 3300053085 | Ga0495619_0114985 | Ga0495619_0114985_737_1792 | 317 |
| 397 | iso_pu_bacteria | 2795385472 | 2795795946 | 317 |
| 398 | iso_pu_bacteria | 8055066027 | 8055067368 | 317 |
| 399 | iso_pu_bacteria | 8055172936 | 8055179736 | 317 |
| 400 | 3300003578 | Ga0006562J51391_1086514 | Ga0006562J51391_10865142 | 318 |
| 401 | 3300005617 | Ga0068859_100129742 | Ga0068859_1001297423 | 318 |
| 402 | 3300006847 | Ga0075431_100117543 | Ga0075431_1001175433 | 318 |
| 403 | 3300006931 | Ga0097620_100129742 | Ga0097620_1001297423 | 318 |
| 404 | 3300009101 | Ga0105247_10026238 | Ga0105247_100262383 | 318 |
| 405 | 3300020082 | Ga0206353_10075764 | Ga0206353_100757641 | 318 |
| 406 | 3300026089 | Ga0207648_10317313 | Ga0207648_103173132 | 318 |
| 407 | 3300031548 | Ga0307408_100013173 | Ga0307408_1000131733 | 318 |
| 408 | 3300031649 | Ga0307514_10005913 | Ga0307514_100059135 | 318 |
| 409 | 3300031730 | Ga0307516_10188493 | Ga0307516_101884932 | 318 |
| 410 | 3300031911 | Ga0307412_10090223 | Ga0307412_100902232 | 318 |
| 411 | 3300031995 | Ga0307409_100085717 | Ga0307409_1000857173 | 318 |
| 412 | 3300032002 | Ga0307416_100119027 | Ga0307416_1001190272 | 318 |
| 413 | 3300032005 | Ga0307411_10059567 | Ga0307411_100595671 | 318 |
| 414 | 3300032005 | Ga0307411_10347917 | Ga0307411_103479171 | 318 |
| 415 | 3300046455 | Ga0495603_0011591 | Ga0495603_0011591_490_1455 | 318 |
| 416 | 3300046459 | Ga0495629_0003034 | Ga0495629_0003034_6345_7310 | 318 |
| 417 | 3300046459 | Ga0495629_0026903 | Ga0495629_0026903_2583_3548 | 318 |
| 418 | 3300046492 | Ga0495585_0119637 | Ga0495585_0119637_260_1225 | 318 |
| 419 | 3300046499 | Ga0495594_0000668 | Ga0495594_0000668_5930_6895 | 318 |
| 420 | 3300046557 | Ga0495622_0033129 | Ga0495622_0033129_368_1333 | 318 |
| 421 | 3300046648 | Ga0495611_0014403 | Ga0495611_0014403_2127_3092 | 318 |
| 422 | 3300046689 | Ga0495613_0002133 | Ga0495613_0002133_6375_7340 | 318 |
| 423 | 3300047321 | Ga0495676_0007067 | Ga0495676_0007067_8616_9581 | 318 |
| 424 | 3300047323 | Ga0495683_0086216 | Ga0495683_0086216_276_1241 | 318 |
| 425 | 3300048089 | Ga0495614_0002029 | Ga0495614_0002029_4804_5769 | 318 |
| 426 | 3300048905 | Ga0496102_0000072 | Ga0496102_0000072_107543_108541 | 318 |
| 427 | 3300048906 | Ga0496103_0000053 | Ga0496103_0000053_104277_105275 | 318 |
| 428 | 3300048909 | Ga0496106_0043439 | Ga0496106_0043439_2233_3198 | 318 |
| 429 | 3300048921 | Ga0496118_0012761 | Ga0496118_0012761_6424_7422 | 318 |
| 430 | 3300048922 | Ga0496119_0110024 | Ga0496119_0110024_321_1319 | 318 |
| 431 | 3300048923 | Ga0496120_0050532 | Ga0496120_0050532_1232_2230 | 318 |
| 432 | 3300049570 | Ga0501033_0060395 | Ga0501033_0060395_455_1459 | 318 |
| 433 | 3300049571 | Ga0501034_0051470 | Ga0501034_0051470_2573_3577 | 318 |
| 434 | 3300049572 | Ga0501036_0112079 | Ga0501036_0112079_792_1796 | 318 |
| 435 | 3300049574 | Ga0501038_0078455 | Ga0501038_0078455_698_1702 | 318 |
| 436 | 3300049580 | Ga0501046_0012457 | Ga0501046_0012457_5707_6711 | 318 |
| 437 | 3300049583 | Ga0501067_0042551 | Ga0501067_0042551_314_1318 | 318 |
| 438 | 3300049822 | Ga0501035_0007550 | Ga0501035_0007550_4255_5259 | 318 |
| 439 | 3300049823 | Ga0501044_0067276 | Ga0501044_0067276_1444_2448 | 318 |
| 440 | iso_pu_bacteria | 2690315906 | 2691513562 | 318 |
| 441 | iso_pu_bacteria | 2767802112 | 2768646886 | 318 |
| 442 | iso_pu_bacteria | 2775506735 | 2775656117 | 318 |
| 443 | iso_pu_bacteria | 2799112218 | 2799186132 | 318 |
| 444 | iso_pu_bacteria | 2808606357 | 2808830817 | 318 |
| 445 | iso_pu_bacteria | 2808606360 | 2808852005 | 318 |
| 446 | iso_pu_bacteria | 2811994871 | 2812321630 | 318 |
| 447 | iso_pu_bacteria | 2862705112 | 2862708036 | 318 |
| 448 | iso_pu_bacteria | 2919051321 | 2919051644 | 318 |
| 449 | iso_pu_bacteria | 2945916053 | 2945919497 | 318 |
| 450 | iso_pu_bacteria | 8008485437 | 8008489542 | 318 |
| 451 | iso_pu_bacteria | 8025524527 | 8025528882 | 318 |
| 452 | 3300005535 | Ga0070684_100063193 | Ga0070684_1000631933 | 319 |
| 453 | 3300006846 | Ga0075430_100000322 | Ga0075430_1000003224 | 319 |
| 454 | 3300006847 | Ga0075431_100015152 | Ga0075431_1000151524 | 319 |
| 455 | 3300006880 | Ga0075429_100065389 | Ga0075429_1000653892 | 319 |
| 456 | 3300009147 | Ga0114129_10000059 | Ga0114129_1000005962 | 319 |
| 457 | 3300022467 | Ga0224712_10031661 | Ga0224712_100316612 | 319 |
| 458 | 3300031901 | Ga0307406_10070007 | Ga0307406_100700073 | 319 |
| 459 | 3300032002 | Ga0307416_100662300 | Ga0307416_1006623002 | 319 |
| 460 | 3300032126 | Ga0307415_100026569 | Ga0307415_1000265693 | 319 |
| 461 | 3300035086 | Ga0373934_0082708 | Ga0373934_0082708_194_1213 | 319 |
| 462 | 3300035119 | Ga0373956_0068256 | Ga0373956_0068256_522_1541 | 319 |
| 463 | 3300037312 | Ga0395899_0002931 | Ga0395899_0002931_8560_9525 | 319 |
| 464 | 3300044684 | Ga0466966_0003006 | Ga0466966_0003006_1731_2690 | 319 |
| 465 | 3300044693 | Ga0466961_0017088 | Ga0466961_0017088_1660_2619 | 319 |
| 466 | 3300044694 | Ga0466963_0002403 | Ga0466963_0002403_1089_2060 | 319 |
| 467 | 3300044694 | Ga0466963_0279000 | Ga0466963_0279000_125_1096 | 319 |
| 468 | 3300044706 | Ga0466964_0058322 | Ga0466964_0058322_158_1129 | 319 |
| 469 | 3300044719 | Ga0466971_0064055 | Ga0466971_0064055_186_1157 | 319 |
| 470 | 3300045836 | Ga0466958_0009011 | Ga0466958_0009011_3790_4761 | 319 |
| 471 | 3300045976 | Ga0466967_0022348 | Ga0466967_0022348_2568_3539 | 319 |
| 472 | 3300045976 | Ga0466967_0118942 | Ga0466967_0118942_968_1939 | 319 |
| 473 | 3300045976 | Ga0466967_0476315 | Ga0466967_0476315_214_1188 | 319 |
| 474 | 3300048088 | Ga0495602_0104695 | Ga0495602_0104695_1166_2185 | 319 |
| 475 | 3300048915 | Ga0496112_0247362 | Ga0496112_0247362_667_1659 | 319 |
| 476 | 3300050507 | nmdc:mga05p37_183_c1 | nmdc:mga05p37_183_c1_31209_32270 | 319 |
| 477 | 3300050507 | nmdc:mga05p37_667219_c1 | nmdc:mga05p37_667219_c1_21_1094 | 319 |
| 478 | 3300050508 | nmdc:mga09592_114343_c1 | nmdc:mga09592_114343_c1_807_1766 | 319 |
| 479 | 3300050508 | nmdc:mga09592_38_c1 | nmdc:mga09592_38_c1_27546_28607 | 319 |
| 480 | 3300050509 | nmdc:mga0qj67_31_c3 | nmdc:mga0qj67_31_c3_32220_33281 | 319 |
| 481 | 3300050510 | nmdc:mga06r32_19_c1 | nmdc:mga06r32_19_c1_33005_34066 | 319 |
| 482 | 3300053077 | Ga0495601_0050977 | Ga0495601_0050977_533_1492 | 319 |
| 483 | 3300053085 | Ga0495619_0033314 | Ga0495619_0033314_2128_3111 | 319 |
| 484 | iso_pu_bacteria | 2775506925 | 2776369877 | 319 |
| 485 | iso_pu_bacteria | 2863067949 | 2863071258 | 319 |
| 486 | iso_pu_bacteria | 2867475112 | 2867477150 | 319 |
| 487 | iso_pu_bacteria | 3006321560 | 3006322413 | 319 |
| 488 | iso_pu_bacteria | 8056207758 | 8056212202 | 319 |
| 489 | 3300006353 | Ga0075370_10072465 | Ga0075370_100724652 | 320 |
| 490 | 3300031548 | Ga0307408_100379316 | Ga0307408_1003793162 | 320 |
| 491 | 3300031727 | Ga0316576_10072127 | Ga0316576_100721273 | 320 |
| 492 | 3300031731 | Ga0307405_10030861 | Ga0307405_100308611 | 320 |
| 493 | 3300031903 | Ga0307407_10096187 | Ga0307407_100961871 | 320 |
| 494 | 3300031995 | Ga0307409_100010914 | Ga0307409_1000109143 | 320 |
| 495 | 3300031995 | Ga0307409_100018424 | Ga0307409_1000184242 | 320 |
| 496 | 3300032002 | Ga0307416_100011768 | Ga0307416_1000117683 | 320 |
| 497 | 3300032126 | Ga0307415_100077829 | Ga0307415_1000778291 | 320 |
| 498 | 3300036712 | Ga0316584_0047585 | Ga0316584_0047585_1492_2460 | 320 |
| 499 | 3300037418 | Ga0395900_0091057 | Ga0395900_0091057_331_1308 | 320 |
| 500 | 3300042006 | Ga0439432_049534 | Ga0439432_049534_114_1076 | 320 |
| 501 | 3300044693 | Ga0466961_0018613 | Ga0466961_0018613_2674_3642 | 320 |
| 502 | 3300044693 | Ga0466961_0027860 | Ga0466961_0027860_2589_3557 | 320 |
| 503 | 3300044694 | Ga0466963_0010690 | Ga0466963_0010690_1511_2482 | 320 |
| 504 | 3300044694 | Ga0466963_0200568 | Ga0466963_0200568_69_1040 | 320 |
| 505 | 3300044842 | Ga0466957_0181777 | Ga0466957_0181777_198_1175 | 320 |
| 506 | 3300045976 | Ga0466967_0022174 | Ga0466967_0022174_3849_4826 | 320 |
| 507 | 3300050513 | nmdc:mga0rr50_41384_c1 | nmdc:mga0rr50_41384_c1_318_1424 | 320 |
| 508 | 3300059424 | Ga0590075_014495 | Ga0590075_014495_93_1067 | 320 |
| 509 | 3300061719 | Ga0466962_0023041 | Ga0466962_0023041_905_1876 | 320 |
| 510 | iso_pu_bacteria | 2870782633 | 2870789740 | 320 |
| 511 | iso_pu_bacteria | 2915358134 | 2915363580 | 320 |
| 512 | iso_pu_bacteria | 8002775197 | 8002777147 | 320 |
| 513 | iso_pu_bacteria | 8056060235 | 8056066416 | 320 |
| 514 | 3300005468 | Ga0070707_100163356 | Ga0070707_1001633563 | 321 |
| 515 | 3300005563 | Ga0068855_100079107 | Ga0068855_1000791073 | 321 |
| 516 | 3300005614 | Ga0068856_100070122 | Ga0068856_1000701223 | 321 |
| 517 | 3300009093 | Ga0105240_10003563 | Ga0105240_1000356310 | 321 |
| 518 | 3300013104 | Ga0157370_10006131 | Ga0157370_100061319 | 321 |
| 519 | 3300013105 | Ga0157369_10109792 | Ga0157369_101097923 | 321 |
| 520 | 3300020069 | Ga0197907_11375361 | Ga0197907_113753612 | 321 |
| 521 | 3300025949 | Ga0207667_10024935 | Ga0207667_100249352 | 321 |
| 522 | 3300026078 | Ga0207702_10008585 | Ga0207702_100085856 | 321 |
| 523 | 3300026078 | Ga0207702_10217992 | Ga0207702_102179921 | 321 |
| 524 | 3300026142 | Ga0207698_10146859 | Ga0207698_101468591 | 321 |
| 525 | 3300031616 | Ga0307508_10138946 | Ga0307508_101389462 | 321 |
| 526 | 3300031616 | Ga0307508_10212060 | Ga0307508_102120601 | 321 |
| 527 | 3300031995 | Ga0307409_100111607 | Ga0307409_1001116072 | 321 |
| 528 | 3300035113 | Ga0373936_0000174 | Ga0373936_0000174_14203_15252 | 321 |
| 529 | 3300035117 | Ga0373953_0001469 | Ga0373953_0001469_2057_3106 | 321 |
| 530 | 3300035119 | Ga0373956_0006486 | Ga0373956_0006486_3609_4658 | 321 |
| 531 | 3300035120 | Ga0373957_0009326 | Ga0373957_0009326_1182_2231 | 321 |
| 532 | 3300035692 | Ga0373935_0009209 | Ga0373935_0009209_3797_4846 | 321 |
| 533 | 3300037068 | Ga0373925_0095506 | Ga0373925_0095506_383_1432 | 321 |
| 534 | 3300037418 | Ga0395900_0212618 | Ga0395900_0212618_841_1812 | 321 |
| 535 | 3300044656 | Ga0466969_0003516 | Ga0466969_0003516_440_1411 | 321 |
| 536 | 3300044684 | Ga0466966_0213904 | Ga0466966_0213904_37_1008 | 321 |
| 537 | 3300044693 | Ga0466961_0072650 | Ga0466961_0072650_491_1465 | 321 |
| 538 | 3300044842 | Ga0466957_0098828 | Ga0466957_0098828_588_1559 | 321 |
| 539 | 3300045049 | Ga0466959_0004080 | Ga0466959_0004080_5003_5974 | 321 |
| 540 | 3300045049 | Ga0466959_0136498 | Ga0466959_0136498_621_1592 | 321 |
| 541 | 3300045836 | Ga0466958_0020687 | Ga0466958_0020687_417_1388 | 321 |
| 542 | 3300046454 | Ga0495592_0059696 | Ga0495592_0059696_1031_2080 | 321 |
| 543 | 3300046454 | Ga0495592_0253053 | Ga0495592_0253053_134_1138 | 321 |
| 544 | 3300046459 | Ga0495629_0029254 | Ga0495629_0029254_1984_3033 | 321 |
| 545 | 3300046461 | Ga0495641_0014739 | Ga0495641_0014739_778_1827 | 321 |
| 546 | 3300046475 | Ga0495639_0023641 | Ga0495639_0023641_869_1918 | 321 |
| 547 | 3300046476 | Ga0495662_0033767 | Ga0495662_0033767_801_1850 | 321 |
| 548 | 3300046477 | Ga0495664_0009068 | Ga0495664_0009068_3481_4530 | 321 |
| 549 | 3300046511 | Ga0495608_0077131 | Ga0495608_0077131_329_1333 | 321 |
| 550 | 3300046529 | Ga0495652_0108556 | Ga0495652_0108556_645_1757 | 321 |
| 551 | 3300046529 | Ga0495652_0151072 | Ga0495652_0151072_126_1175 | 321 |
| 552 | 3300046531 | Ga0495665_0002038 | Ga0495665_0002038_9272_10321 | 321 |
| 553 | 3300046533 | Ga0495640_0011285 | Ga0495640_0011285_97_1146 | 321 |
| 554 | 3300046535 | Ga0495586_0003009 | Ga0495586_0003009_1859_2908 | 321 |
| 555 | 3300046559 | Ga0495667_0006408 | Ga0495667_0006408_4146_5195 | 321 |
| 556 | 3300046559 | Ga0495667_0010402 | Ga0495667_0010402_1855_2892 | 321 |
| 557 | 3300046675 | Ga0495657_0083947 | Ga0495657_0083947_32_1081 | 321 |
| 558 | 3300046675 | Ga0495657_0097031 | Ga0495657_0097031_96_1100 | 321 |
| 559 | 3300046678 | Ga0495599_0025075 | Ga0495599_0025075_230_1267 | 321 |
| 560 | 3300046678 | Ga0495599_0070310 | Ga0495599_0070310_44_1093 | 321 |
| 561 | 3300046689 | Ga0495613_0007752 | Ga0495613_0007752_6172_7221 | 321 |
| 562 | 3300046690 | Ga0495624_0003732 | Ga0495624_0003732_4703_5752 | 321 |
| 563 | 3300047315 | Ga0495581_0001296 | Ga0495581_0001296_6153_7202 | 321 |
| 564 | 3300047317 | Ga0495604_0031980 | Ga0495604_0031980_1066_2115 | 321 |
| 565 | 3300047317 | Ga0495604_0053482 | Ga0495604_0053482_1459_2496 | 321 |
| 566 | 3300047444 | Ga0495675_0000758 | Ga0495675_0000758_12377_13426 | 321 |
| 567 | 3300047444 | Ga0495675_0212295 | Ga0495675_0212295_33_1145 | 321 |
| 568 | 3300047471 | Ga0495684_0168873 | Ga0495684_0168873_501_1613 | 321 |
| 569 | 3300047673 | Ga0495593_0012847 | Ga0495593_0012847_681_1730 | 321 |
| 570 | 3300048088 | Ga0495602_0158965 | Ga0495602_0158965_44_1093 | 321 |
| 571 | 3300048905 | Ga0496102_0113320 | Ga0496102_0113320_115_1086 | 321 |
| 572 | 3300049568 | Ga0501031_0030747 | Ga0501031_0030747_781_1749 | 321 |
| 573 | 3300049569 | Ga0501032_0169478 | Ga0501032_0169478_237_1301 | 321 |
| 574 | 3300053077 | Ga0495601_0005123 | Ga0495601_0005123_1024_2073 | 321 |
| 575 | 3300053139 | Ga0500568_0028236 | Ga0500568_0028236_373_1353 | 321 |
| 576 | 3300061719 | Ga0466962_0116840 | Ga0466962_0116840_86_1060 | 321 |
| 577 | iso_pu_bacteria | 2861520306 | 2861520916 | 321 |
| 578 | iso_pu_bacteria | 2873314349 | 2873320791 | 321 |
| 579 | iso_pu_bacteria | 8054472261 | 8054476785 | 321 |
| 580 | 3300005327 | Ga0070658_10075564 | Ga0070658_100755643 | 322 |
| 581 | 3300005435 | Ga0070714_100000077 | Ga0070714_10000007736 | 322 |
| 582 | 3300005530 | Ga0070679_100038665 | Ga0070679_1000386653 | 322 |
| 583 | 3300005563 | Ga0068855_100011741 | Ga0068855_1000117413 | 322 |
| 584 | 3300005614 | Ga0068856_100048202 | Ga0068856_1000482023 | 322 |
| 585 | 3300005985 | Ga0081539_10005729 | Ga0081539_100057294 | 322 |
| 586 | 3300006846 | Ga0075430_100000551 | Ga0075430_10000055116 | 322 |
| 587 | 3300009093 | Ga0105240_10251875 | Ga0105240_102518752 | 322 |
| 588 | 3300010375 | Ga0105239_10278201 | Ga0105239_102782011 | 322 |
| 589 | 3300025302 | Ga0207426_1005901 | Ga0207426_10059014 | 322 |
| 590 | 3300025302 | Ga0207426_1012389 | Ga0207426_10123891 | 322 |
| 591 | 3300025913 | Ga0207695_10050307 | Ga0207695_100503072 | 322 |
| 592 | 3300025914 | Ga0207671_10246197 | Ga0207671_102461972 | 322 |
| 593 | 3300025919 | Ga0207657_10206570 | Ga0207657_102065702 | 322 |
| 594 | 3300025929 | Ga0207664_10000091 | Ga0207664_1000009147 | 322 |
| 595 | 3300026067 | Ga0207678_10203817 | Ga0207678_102038172 | 322 |
| 596 | 3300028794 | Ga0307515_10048042 | Ga0307515_100480424 | 322 |
| 597 | 3300031730 | Ga0307516_10120313 | Ga0307516_101203132 | 322 |
| 598 | 3300035112 | Ga0373932_0007932 | Ga0373932_0007932_938_1993 | 322 |
| 599 | 3300037418 | Ga0395900_0035135 | Ga0395900_0035135_3170_4171 | 322 |
| 600 | 3300037466 | Ga0395898_0021174 | Ga0395898_0021174_4898_5899 | 322 |
| 601 | 3300037471 | Ga0395905_0183251 | Ga0395905_0183251_43_1044 | 322 |
| 602 | 3300038443 | Ga0395901_0137614 | Ga0395901_0137614_857_1858 | 322 |
| 603 | 3300044683 | Ga0466965_0013634 | Ga0466965_0013634_783_1766 | 322 |
| 604 | 3300044684 | Ga0466966_0007315 | Ga0466966_0007315_3863_4846 | 322 |
| 605 | 3300044684 | Ga0466966_0027334 | Ga0466966_0027334_2241_3242 | 322 |
| 606 | 3300044684 | Ga0466966_0050017 | Ga0466966_0050017_457_1440 | 322 |
| 607 | 3300044684 | Ga0466966_0053353 | Ga0466966_0053353_223_1218 | 322 |
| 608 | 3300044693 | Ga0466961_0014013 | Ga0466961_0014013_2659_3642 | 322 |
| 609 | 3300044693 | Ga0466961_0048556 | Ga0466961_0048556_713_1690 | 322 |
| 610 | 3300044694 | Ga0466963_0004099 | Ga0466963_0004099_3266_4249 | 322 |
| 611 | 3300044694 | Ga0466963_0013515 | Ga0466963_0013515_3765_4751 | 322 |
| 612 | 3300044694 | Ga0466963_0014379 | Ga0466963_0014379_3708_4685 | 322 |
| 613 | 3300044719 | Ga0466971_0019544 | Ga0466971_0019544_678_1661 | 322 |
| 614 | 3300044719 | Ga0466971_0028152 | Ga0466971_0028152_867_1844 | 322 |
| 615 | 3300044842 | Ga0466957_0019200 | Ga0466957_0019200_1835_2818 | 322 |
| 616 | 3300045049 | Ga0466959_0017053 | Ga0466959_0017053_3996_4979 | 322 |
| 617 | 3300045049 | Ga0466959_0089157 | Ga0466959_0089157_142_1137 | 322 |
| 618 | 3300045049 | Ga0466959_0136079 | Ga0466959_0136079_448_1443 | 322 |
| 619 | 3300045976 | Ga0466967_0015327 | Ga0466967_0015327_946_1920 | 322 |
| 620 | 3300045976 | Ga0466967_0027436 | Ga0466967_0027436_3224_4207 | 322 |
| 621 | 3300045976 | Ga0466967_0073021 | Ga0466967_0073021_1133_2140 | 322 |
| 622 | 3300045976 | Ga0466967_0126708 | Ga0466967_0126708_630_1604 | 322 |
| 623 | 3300045976 | Ga0466967_0168653 | Ga0466967_0168653_534_1511 | 322 |
| 624 | 3300045976 | Ga0466967_0435926 | Ga0466967_0435926_287_1261 | 322 |
| 625 | 3300045976 | Ga0466967_0521250 | Ga0466967_0521250_44_1039 | 322 |
| 626 | 3300048911 | Ga0496108_0000130 | Ga0496108_0000130_29373_30425 | 322 |
| 627 | 3300050509 | nmdc:mga0qj67_510_c1 | nmdc:mga0qj67_510_c1_23159_24355 | 322 |
| 628 | 3300050510 | nmdc:mga06r32_101008_c1 | nmdc:mga06r32_101008_c1_308_1363 | 322 |
| 629 | 3300061719 | Ga0466962_0009013 | Ga0466962_0009013_3155_4138 | 322 |
| 630 | iso_pu_bacteria | 2675903059 | 2676483557 | 322 |
| 631 | iso_pu_bacteria | 2816332139 | 2816504211 | 322 |
| 632 | 3300005329 | Ga0070683_100268382 | Ga0070683_1002683821 | 323 |
| 633 | 3300005336 | Ga0070680_100000165 | Ga0070680_10000016529 | 323 |
| 634 | 3300005458 | Ga0070681_10000004 | Ga0070681_1000000478 | 323 |
| 635 | 3300005530 | Ga0070679_100000012 | Ga0070679_10000001248 | 323 |
| 636 | 3300005539 | Ga0068853_100029276 | Ga0068853_1000292762 | 323 |
| 637 | 3300005564 | Ga0070664_100108075 | Ga0070664_1001080752 | 323 |
| 638 | 3300005618 | Ga0068864_100092941 | Ga0068864_1000929412 | 323 |
| 639 | 3300005841 | Ga0068863_100038366 | Ga0068863_1000383662 | 323 |
| 640 | 3300005983 | Ga0081540_1045035 | Ga0081540_10450352 | 323 |
| 641 | 3300006846 | Ga0075430_100022754 | Ga0075430_1000227544 | 323 |
| 642 | 3300009147 | Ga0114129_10027718 | Ga0114129_100277186 | 323 |
| 643 | 3300009551 | Ga0105238_10354606 | Ga0105238_103546062 | 323 |
| 644 | 3300025912 | Ga0207707_10000159 | Ga0207707_1000015949 | 323 |
| 645 | 3300025917 | Ga0207660_10000172 | Ga0207660_1000017230 | 323 |
| 646 | 3300025921 | Ga0207652_10000106 | Ga0207652_1000010639 | 323 |
| 647 | 3300025944 | Ga0207661_10322789 | Ga0207661_103227891 | 323 |
| 648 | 3300026041 | Ga0207639_10024579 | Ga0207639_100245792 | 323 |
| 649 | 3300026095 | Ga0207676_10116654 | Ga0207676_101166542 | 323 |
| 650 | 3300028786 | Ga0307517_10107630 | Ga0307517_101076301 | 323 |
| 651 | 3300028794 | Ga0307515_10126190 | Ga0307515_101261902 | 323 |
| 652 | 3300030522 | Ga0307512_10049354 | Ga0307512_100493542 | 323 |
| 653 | 3300031456 | Ga0307513_10096748 | Ga0307513_100967482 | 323 |
| 654 | 3300031616 | Ga0307508_10236146 | Ga0307508_102361462 | 323 |
| 655 | 3300031665 | Ga0316575_10018726 | Ga0316575_100187262 | 323 |
| 656 | 3300031691 | Ga0316579_10022448 | Ga0316579_100224482 | 323 |
| 657 | 3300031727 | Ga0316576_10003083 | Ga0316576_100030834 | 323 |
| 658 | 3300032133 | Ga0316583_10018382 | Ga0316583_100183822 | 323 |
| 659 | 3300032139 | Ga0316580_10031369 | Ga0316580_100313692 | 323 |
| 660 | 3300035398 | Ga0316574_0120034 | Ga0316574_0120034_372_1346 | 323 |
| 661 | 3300036647 | Ga0316582_0008389 | Ga0316582_0008389_2124_3098 | 323 |
| 662 | 3300036712 | Ga0316584_0009878 | Ga0316584_0009878_348_1322 | 323 |
| 663 | 3300044694 | Ga0466963_0296111 | Ga0466963_0296111_22_993 | 323 |
| 664 | 3300048905 | Ga0496102_0005012 | Ga0496102_0005012_3239_4222 | 323 |
| 665 | 3300049568 | Ga0501031_0024088 | Ga0501031_0024088_674_1651 | 323 |
| 666 | 3300049569 | Ga0501032_0007658 | Ga0501032_0007658_6131_7108 | 323 |
| 667 | 3300049571 | Ga0501034_0005719 | Ga0501034_0005719_11702_12679 | 323 |
| 668 | 3300049572 | Ga0501036_0001806 | Ga0501036_0001806_4301_5278 | 323 |
| 669 | 3300049573 | Ga0501037_0014110 | Ga0501037_0014110_473_1450 | 323 |
| 670 | 3300049574 | Ga0501038_0005464 | Ga0501038_0005464_2321_3298 | 323 |
| 671 | 3300049575 | Ga0501039_0128598 | Ga0501039_0128598_183_1160 | 323 |
| 672 | 3300049576 | Ga0501040_0064002 | Ga0501040_0064002_771_1748 | 323 |
| 673 | 3300049577 | Ga0501041_0001046 | Ga0501041_0001046_13198_14175 | 323 |
| 674 | 3300049578 | Ga0501042_0002964 | Ga0501042_0002964_576_1610 | 323 |
| 675 | 3300049579 | Ga0501043_0000455 | Ga0501043_0000455_4429_5406 | 323 |
| 676 | 3300049580 | Ga0501046_0015268 | Ga0501046_0015268_3842_4819 | 323 |
| 677 | 3300049581 | Ga0501047_0001178 | Ga0501047_0001178_17067_18044 | 323 |
| 678 | 3300049582 | Ga0501048_0057694 | Ga0501048_0057694_264_1241 | 323 |
| 679 | 3300049583 | Ga0501067_0009126 | Ga0501067_0009126_802_1779 | 323 |
| 680 | 3300049584 | Ga0501068_0001299 | Ga0501068_0001299_511_1488 | 323 |
| 681 | 3300049585 | Ga0501069_0005490 | Ga0501069_0005490_5037_6014 | 323 |
| 682 | 3300049587 | Ga0501071_0000279 | Ga0501071_0000279_16910_17887 | 323 |
| 683 | 3300049588 | Ga0501072_0013377 | Ga0501072_0013377_485_1462 | 323 |
| 684 | 3300049589 | Ga0501073_0019654 | Ga0501073_0019654_2586_3563 | 323 |
| 685 | 3300049742 | Ga0501080_0042678 | Ga0501080_0042678_2171_3148 | 323 |
| 686 | 3300049744 | Ga0501083_0002070 | Ga0501083_0002070_11995_12972 | 323 |
| 687 | 3300049822 | Ga0501035_0000635 | Ga0501035_0000635_25212_26189 | 323 |
| 688 | 3300049823 | Ga0501044_0000558 | Ga0501044_0000558_32928_33905 | 323 |
| 689 | 3300049824 | Ga0501045_0038258 | Ga0501045_0038258_1538_2515 | 323 |
| 690 | 3300050507 | nmdc:mga05p37_29681_c1 | nmdc:mga05p37_29681_c1_845_1915 | 323 |
| 691 | 3300050509 | nmdc:mga0qj67_54938_c1 | nmdc:mga0qj67_54938_c1_2062_3132 | 323 |
| 692 | 3300053109 | Ga0500569_009041 | Ga0500569_009041_1023_2093 | 323 |
| 693 | 3300054114 | Ga0501084_0060980 | Ga0501084_0060980_978_1955 | 323 |
| 694 | 3300060353 | Ga0501082_0004653 | Ga0501082_0004653_9394_10371 | 323 |
| 695 | iso_pu_bacteria | 2866552031 | 2866552517 | 323 |
| 696 | 3300005344 | Ga0070661_100075150 | Ga0070661_1000751502 | 324 |
| 697 | 3300005347 | Ga0070668_100069223 | Ga0070668_1000692233 | 324 |
| 698 | 3300005841 | Ga0068863_100320032 | Ga0068863_1003200322 | 324 |
| 699 | 3300009551 | Ga0105238_10030284 | Ga0105238_100302845 | 324 |
| 700 | 3300014968 | Ga0157379_10020602 | Ga0157379_100206024 | 324 |
| 701 | 3300025972 | Ga0207668_10274658 | Ga0207668_102746581 | 324 |
| 702 | 3300026088 | Ga0207641_10002763 | Ga0207641_1000276316 | 324 |
| 703 | 3300028794 | Ga0307515_10053893 | Ga0307515_100538932 | 324 |
| 704 | 3300032139 | Ga0316580_10002028 | Ga0316580_100020284 | 324 |
| 705 | 3300036647 | Ga0316582_0002093 | Ga0316582_0002093_7977_8954 | 324 |
| 706 | 3300044656 | Ga0466969_0006780 | Ga0466969_0006780_98_1075 | 324 |
| 707 | 3300048903 | Ga0496100_0002693 | Ga0496100_0002693_472_1446 | 324 |
| 708 | 3300048904 | Ga0496101_0003317 | Ga0496101_0003317_1442_2416 | 324 |
| 709 | 3300048905 | Ga0496102_0000018 | Ga0496102_0000018_7693_8667 | 324 |
| 710 | 3300048906 | Ga0496103_0001801 | Ga0496103_0001801_5282_6256 | 324 |
| 711 | 3300048908 | Ga0496105_0043052 | Ga0496105_0043052_433_1407 | 324 |
| 712 | 3300048908 | Ga0496105_0175902 | Ga0496105_0175902_482_1459 | 324 |
| 713 | 3300048912 | Ga0496109_0028190 | Ga0496109_0028190_1048_2025 | 324 |
| 714 | 3300048912 | Ga0496109_0194740 | Ga0496109_0194740_207_1181 | 324 |
| 715 | 3300048913 | Ga0496110_0047416 | Ga0496110_0047416_551_1528 | 324 |
| 716 | 3300048913 | Ga0496110_0118394 | Ga0496110_0118394_788_1762 | 324 |
| 717 | 3300048914 | Ga0496111_0058995 | Ga0496111_0058995_849_1826 | 324 |
| 718 | 3300048917 | Ga0496114_0006308 | Ga0496114_0006308_2559_3536 | 324 |
| 719 | 3300048919 | Ga0496116_0000235 | Ga0496116_0000235_92885_93859 | 324 |
| 720 | 3300048920 | Ga0496117_0000236 | Ga0496117_0000236_74220_75194 | 324 |
| 721 | 3300048921 | Ga0496118_0000100 | Ga0496118_0000100_66319_67293 | 324 |
| 722 | 3300048922 | Ga0496119_0004320 | Ga0496119_0004320_7678_8652 | 324 |
| 723 | 3300048923 | Ga0496120_0013256 | Ga0496120_0013256_4572_5546 | 324 |
| 724 | 3300048924 | Ga0496121_0046206 | Ga0496121_0046206_1415_2389 | 324 |
| 725 | 3300048926 | Ga0496123_0132360 | Ga0496123_0132360_85_1059 | 324 |
| 726 | 3300048927 | Ga0496124_0033648 | Ga0496124_0033648_3363_4337 | 324 |
| 727 | 3300048928 | Ga0496125_0065010 | Ga0496125_0065010_1448_2422 | 324 |
| 728 | 3300048929 | Ga0496126_0000327 | Ga0496126_0000327_92840_93814 | 324 |
| 729 | 3300049569 | Ga0501032_0002522 | Ga0501032_0002522_2797_3777 | 324 |
| 730 | 3300049571 | Ga0501034_0015342 | Ga0501034_0015342_6712_7692 | 324 |
| 731 | 3300049572 | Ga0501036_0056168 | Ga0501036_0056168_2315_3295 | 324 |
| 732 | 3300049574 | Ga0501038_0014231 | Ga0501038_0014231_623_1603 | 324 |
| 733 | 3300049581 | Ga0501047_0005117 | Ga0501047_0005117_2363_3343 | 324 |
| 734 | 3300049822 | Ga0501035_0007116 | Ga0501035_0007116_4527_5507 | 324 |
| 735 | iso_pu_bacteria | 2919446982 | 2919450736 | 324 |
| 736 | 3300005355 | Ga0070671_100015500 | Ga0070671_1000155005 | 325 |
| 737 | 3300005548 | Ga0070665_100003626 | Ga0070665_1000036262 | 325 |
| 738 | 3300005841 | Ga0068863_100092850 | Ga0068863_1000928503 | 325 |
| 739 | 3300005843 | Ga0068860_100008606 | Ga0068860_1000086065 | 325 |
| 740 | 3300006175 | Ga0070712_100109128 | Ga0070712_1001091282 | 325 |
| 741 | 3300009147 | Ga0114129_10037952 | Ga0114129_100379523 | 325 |
| 742 | 3300009147 | Ga0114129_10096580 | Ga0114129_100965803 | 325 |
| 743 | 3300025931 | Ga0207644_10010249 | Ga0207644_100102495 | 325 |
| 744 | 3300026088 | Ga0207641_10039463 | Ga0207641_100394633 | 325 |
| 745 | 3300028379 | Ga0268266_10094334 | Ga0268266_100943343 | 325 |
| 746 | 3300028381 | Ga0268264_10006109 | Ga0268264_100061095 | 325 |
| 747 | 3300031901 | Ga0307406_10180758 | Ga0307406_101807581 | 325 |
| 748 | 3300050508 | nmdc:mga09592_134899_c1 | nmdc:mga09592_134899_c1_146_1216 | 325 |
| 749 | 3300005366 | Ga0070659_100106343 | Ga0070659_1001063432 | 327 |
| 750 | 3300005616 | Ga0068852_100015872 | Ga0068852_1000158725 | 327 |
| 751 | 3300005618 | Ga0068864_100125488 | Ga0068864_1001254882 | 327 |
| 752 | 3300005834 | Ga0068851_10096977 | Ga0068851_100969771 | 327 |
| 753 | 3300009094 | Ga0111539_10277612 | Ga0111539_102776122 | 327 |
| 754 | 3300010375 | Ga0105239_10502873 | Ga0105239_105028731 | 327 |
| 755 | 3300025908 | Ga0207643_10023047 | Ga0207643_100230472 | 327 |
| 756 | 3300025927 | Ga0207687_10075966 | Ga0207687_100759662 | 327 |
| 757 | 3300025942 | Ga0207689_10039700 | Ga0207689_100397001 | 327 |
| 758 | 3300026142 | Ga0207698_10166906 | Ga0207698_101669061 | 327 |
| 759 | 3300028379 | Ga0268266_10307629 | Ga0268266_103076291 | 327 |
| 760 | 3300049570 | Ga0501033_0036701 | Ga0501033_0036701_775_1812 | 327 |
| 761 | 3300049573 | Ga0501037_0005665 | Ga0501037_0005665_1743_2780 | 327 |
| 762 | 3300049574 | Ga0501038_0137555 | Ga0501038_0137555_530_1567 | 327 |
| 763 | 3300049578 | Ga0501042_0003678 | Ga0501042_0003678_38_1075 | 327 |
| 764 | 3300049579 | Ga0501043_0001998 | Ga0501043_0001998_7169_8206 | 327 |
| 765 | 3300049580 | Ga0501046_0015991 | Ga0501046_0015991_2783_3820 | 327 |
| 766 | 3300049581 | Ga0501047_0019871 | Ga0501047_0019871_1109_2128 | 327 |
| 767 | 3300049581 | Ga0501047_0048994 | Ga0501047_0048994_667_1704 | 327 |
| 768 | 3300049823 | Ga0501044_0060463 | Ga0501044_0060463_1844_2863 | 327 |
| 769 | 3300050511 | nmdc:mga08y16_167590_c2 | nmdc:mga08y16_167590_c2_807_1799 | 327 |
| 770 | 3300053078 | Ga0495612_0003720 | Ga0495612_0003720_947_1942 | 327 |
| 771 | 3300061719 | Ga0466962_0033888 | Ga0466962_0033888_378_1382 | 327 |
| 772 | iso_pu_bacteria | 2802429296 | 2804844375 | 327 |
| 773 | iso_pu_bacteria | 8025413630 | 8025414017 | 327 |
| 774 | 3300020082 | Ga0206353_11385583 | Ga0206353_113855833 | 328 |
| 775 | 3300038443 | Ga0395901_0254389 | Ga0395901_0254389_699_1691 | 328 |
| 776 | 3300046689 | Ga0495613_0062317 | Ga0495613_0062317_1186_2193 | 328 |
| 777 | 3300005577 | Ga0068857_100197575 | Ga0068857_1001975751 | 330 |
| 778 | 3300005435 | Ga0070714_100402082 | Ga0070714_1004020821 | 331 |
| 779 | 3300002073 | JGI24745J21846_1003443 | JGI24745J21846_10034432 | 334 |
| 780 | 3300005327 | Ga0070658_10111036 | Ga0070658_101110361 | 334 |
| 781 | 3300005328 | Ga0070676_10049955 | Ga0070676_100499553 | 334 |
| 782 | 3300005329 | Ga0070683_100120469 | Ga0070683_1001204692 | 334 |
| 783 | 3300005335 | Ga0070666_10303287 | Ga0070666_103032871 | 334 |
| 784 | 3300005337 | Ga0070682_100169583 | Ga0070682_1001695832 | 334 |
| 785 | 3300005339 | Ga0070660_100106717 | Ga0070660_1001067172 | 334 |
| 786 | 3300005345 | Ga0070692_10161107 | Ga0070692_101611071 | 334 |
| 787 | 3300005353 | Ga0070669_100074213 | Ga0070669_1000742131 | 334 |
| 788 | 3300005364 | Ga0070673_100085900 | Ga0070673_1000859001 | 334 |
| 789 | 3300005366 | Ga0070659_100041462 | Ga0070659_1000414622 | 334 |
| 790 | 3300005544 | Ga0070686_100281578 | Ga0070686_1002815781 | 334 |
| 791 | 3300005564 | Ga0070664_100458929 | Ga0070664_1004589291 | 334 |
| 792 | 3300005577 | Ga0068857_100054200 | Ga0068857_1000542004 | 334 |
| 793 | 3300005840 | Ga0068870_10120196 | Ga0068870_101201961 | 334 |
| 794 | 3300005843 | Ga0068860_100223509 | Ga0068860_1002235093 | 334 |
| 795 | 3300005844 | Ga0068862_100103060 | Ga0068862_1001030602 | 334 |
| 796 | 3300006881 | Ga0068865_100145608 | Ga0068865_1001456082 | 334 |
| 797 | 3300025901 | Ga0207688_10086651 | Ga0207688_100866512 | 334 |
| 798 | 3300025903 | Ga0207680_10149824 | Ga0207680_101498241 | 334 |
| 799 | 3300025904 | Ga0207647_10052615 | Ga0207647_100526152 | 334 |
| 800 | 3300025907 | Ga0207645_10054541 | Ga0207645_100545413 | 334 |
| 801 | 3300025908 | Ga0207643_10010223 | Ga0207643_100102234 | 334 |
| 802 | 3300025911 | Ga0207654_10049754 | Ga0207654_100497542 | 334 |
| 803 | 3300025919 | Ga0207657_10019188 | Ga0207657_100191886 | 334 |
| 804 | 3300025927 | Ga0207687_10248607 | Ga0207687_102486072 | 334 |
| 805 | 3300025934 | Ga0207686_10080558 | Ga0207686_100805582 | 334 |
| 806 | 3300025938 | Ga0207704_10174904 | Ga0207704_101749041 | 334 |
| 807 | 3300025942 | Ga0207689_10012739 | Ga0207689_100127394 | 334 |
| 808 | 3300025972 | Ga0207668_10239407 | Ga0207668_102394071 | 334 |
| 809 | 3300025981 | Ga0207640_10160172 | Ga0207640_101601721 | 334 |
| 810 | 3300026075 | Ga0207708_10006719 | Ga0207708_100067195 | 334 |
| 811 | 3300026089 | Ga0207648_10067186 | Ga0207648_100671862 | 334 |
| 812 | 3300026116 | Ga0207674_10168140 | Ga0207674_101681401 | 334 |
| 813 | 3300026118 | Ga0207675_100013486 | Ga0207675_1000134865 | 334 |
| 814 | 3300026121 | Ga0207683_10129369 | Ga0207683_101293693 | 334 |
| 815 | 3300028379 | Ga0268266_10190410 | Ga0268266_101904102 | 334 |
| 816 | 3300028380 | Ga0268265_10061631 | Ga0268265_100616313 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9547 | 15 | 322 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9448 | 15 | 322 |
| 1n2x-assembly2.cif.gz_B | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9446 | 15 | 320 |
| 1n2x-assembly2.cif.gz_B | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9413 | 15 | 320 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.9393 | 15 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJP1_66_380_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9849 | 16 | 322 | 3.40.50.150 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9702 | 125 | 227 | 1.10.150.170 |
| af_P60393_12_309_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.958 | 24 | 320 | 3.40.50.1000 |
| af_P9WJP1_66_380_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9572 | 16 | 322 | 3.40.50.150 |
| af_P60393_12_309_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9486 | 24 | 320 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0V8T956-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9898 | 13 | 322 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A249LHL9-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9879 | 20 | 323 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A7G1NDW5-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9878 | 20 | 324 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A1Q7W154-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase | 0.987 | 12 | 199 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A4Y8JTZ1-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9869 | 9 | 322 |
GO:0005737
GO:0070475 GO:0071424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar