F482087

General Info

Members Datasets Scaffolds Average Seq Length
817 327 1634 127

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10272665|Ga0070717_102726653
Length 149
Sequence MDHEWNDSQPIYRQLRDRVVAMILDGVLKEGDSLPSVRTVAAEYRVNPLTVLKGYQQLVDEGLVETKRGRGMFINSGARNLLMQGERQKFLAEEWPRVQATIQRLGLSTKELLDANGSGNSHLSQNRGEVGHPTSKETLAKSKDDEEER

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
121 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
236 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
237 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
238 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
241 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
242 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
243 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
244 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
302 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
322 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 3.79
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 6.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10272665 3300006028 Bacteria 1499
2 rootH1_10018790 3300003316 Bacteria 3790
3 rootH2_10031538 3300003320 Bacteria 3383
4 JGI26141J51220_1004901 3300003503 Bacteria 834
5 Ga0065712_10277471 3300005290 Archaea 903
6 Ga0065715_10102278 3300005293 Bacteria 3128
7 Ga0065715_10117509 3300005293 Bacteria 2346
8 Ga0065707_10130176 3300005295 Unclassified 1934
9 Ga0070658_10015984 3300005327 Bacteria 6003
10 Ga0070658_10209693 3300005327 Bacteria 1646
11 Ga0070658_10681303 3300005327 Bacteria 892
12 Ga0070683_100038334 3300005329 Bacteria 4392
13 Ga0070683_100155325 3300005329 Bacteria 2170
14 Ga0070683_100647723 3300005329 Bacteria 1011
15 Ga0070670_100233041 3300005331 Bacteria 1602
16 Ga0070670_100249168 3300005331 Bacteria 1547
17 Ga0070670_100333234 3300005331 Bacteria 1331
18 Ga0068869_100110287 3300005334 Bacteria 2092
19 Ga0068869_101491563 3300005334 Bacteria 600
20 Ga0070666_10042227 3300005335 Bacteria 3050
21 Ga0070666_10246923 3300005335 Bacteria 1263
22 Ga0070680_100193388 3300005336 Bacteria 1715
23 Ga0070682_100245733 3300005337 Bacteria 1287
24 Ga0070682_100415924 3300005337 Bacteria 1021
25 Ga0070682_100549859 3300005337 Bacteria 903
26 Ga0068868_100956676 3300005338 Unclassified 781
27 Ga0068868_101171718 3300005338 Bacteria 709
28 Ga0070660_100889573 3300005339 Bacteria 751
29 Ga0070689_100000480 3300005340 Bacteria 23568
30 Ga0070689_100101356 3300005340 Bacteria 2279
31 Ga0070689_100123827 3300005340 Bacteria 2067
32 Ga0070691_10008089 3300005341 Bacteria 4814
33 Ga0070691_10024905 3300005341 Bacteria 2784
34 Ga0070691_10669854 3300005341 Unclassified 620
35 Ga0070661_100071859 3300005344 Bacteria 2546
36 Ga0070692_10314403 3300005345 Unclassified 961
37 Ga0070692_10456590 3300005345 Bacteria 819
38 Ga0070692_10494541 3300005345 Unclassified 791
39 Ga0070668_101303062 3300005347 Bacteria 660
40 Ga0070669_101463116 3300005353 Bacteria 593
41 Ga0070671_100120594 3300005355 Bacteria 2206
42 Ga0070671_100178302 3300005355 Bacteria 1798
43 Ga0070671_101475007 3300005355 Bacteria 602
44 Ga0070674_100153299 3300005356 Bacteria 1741
45 Ga0070673_100008341 3300005364 Bacteria 6882
46 Ga0070673_100081135 3300005364 Bacteria 2630
47 Ga0070673_100397708 3300005364 Bacteria 1231
48 Ga0070688_101643572 3300005365 Unclassified 525
49 Ga0070659_100953161 3300005366 Bacteria 752
50 Ga0070659_101576439 3300005366 Bacteria 586
51 Ga0070703_10122993 3300005406 Bacteria 944
52 Ga0070709_10039516 3300005434 Bacteria 2895
53 Ga0070709_10142154 3300005434 Bacteria 1650
54 Ga0070709_10558632 3300005434 Bacteria 877
55 Ga0070714_100001369 3300005435 Bacteria 17647
56 Ga0070714_100300798 3300005435 Bacteria 1495
57 Ga0070714_100965041 3300005435 Bacteria 829
58 Ga0070714_101085226 3300005435 Bacteria 780
59 Ga0070714_101779622 3300005435 Unclassified 602
60 Ga0070713_100045416 3300005436 Bacteria 3600
61 Ga0070713_100079911 3300005436 Unclassified 2787
62 Ga0070713_100471429 3300005436 Bacteria 1182
63 Ga0070713_100663584 3300005436 Bacteria 994
64 Ga0070713_100702328 3300005436 Bacteria 966
65 Ga0070713_101976886 3300005436 Bacteria 566
66 Ga0070710_10051719 3300005437 Bacteria 2308
67 Ga0070710_10106701 3300005437 Bacteria 1676
68 Ga0070710_10644671 3300005437 Unclassified 742
69 Ga0070701_10009097 3300005438 Bacteria 4338
70 Ga0070701_11079831 3300005438 Bacteria 564
71 Ga0070711_100144755 3300005439 Bacteria 1786
72 Ga0070711_100301186 3300005439 Unclassified 1275
73 Ga0070711_100377213 3300005439 Unclassified 1146
74 Ga0070711_100463236 3300005439 Bacteria 1039
75 Ga0070711_100714502 3300005439 Bacteria 844
76 Ga0070711_100771553 3300005439 Unclassified 814
77 Ga0070711_101990762 3300005439 Bacteria 511
78 Ga0070705_100000318 3300005440 Bacteria 28502
79 Ga0070705_100767469 3300005440 Bacteria 764
80 Ga0070700_100454192 3300005441 Bacteria 976
81 Ga0070700_100543650 3300005441 Bacteria 901
82 Ga0070700_101858422 3300005441 Bacteria 520
83 Ga0070694_100009496 3300005444 Bacteria 5965
84 Ga0070694_101260113 3300005444 Bacteria 621
85 Ga0070708_100073918 3300005445 Bacteria 3073
86 Ga0070708_100924796 3300005445 Bacteria 818
87 Ga0070708_101245173 3300005445 Bacteria 696
88 Ga0070708_101720513 3300005445 Bacteria 583
89 Ga0070708_101765480 3300005445 Bacteria 574
90 Ga0070663_100184638 3300005455 Bacteria 1620
91 Ga0070663_101087722 3300005455 Bacteria 698
92 Ga0070663_102161206 3300005455 Bacteria 502
93 Ga0070678_100459278 3300005456 Bacteria 1117
94 Ga0070681_10031513 3300005458 Bacteria 5323
95 Ga0070681_10065939 3300005458 Bacteria 3589
96 Ga0070681_11821283 3300005458 Bacteria 536
97 Ga0068867_100370149 3300005459 Bacteria 1201
98 Ga0068867_100435693 3300005459 Bacteria 1113
99 Ga0068867_100959455 3300005459 Unclassified 773
100 Ga0068867_101766558 3300005459 Bacteria 581
101 Ga0070685_10005965 3300005466 Bacteria 6202
102 Ga0070685_10378068 3300005466 Bacteria 975
103 Ga0070706_100035133 3300005467 Bacteria 4628
104 Ga0070706_100131510 3300005467 Bacteria 2335
105 Ga0070706_100428575 3300005467 Bacteria 1231
106 Ga0070706_100543534 3300005467 Bacteria 1081
107 Ga0070706_100710742 3300005467 Bacteria 932
108 Ga0070706_101674422 3300005467 Bacteria 579
109 Ga0070707_100013869 3300005468 Bacteria 7546
110 Ga0070707_100030408 3300005468 Bacteria 5141
111 Ga0070707_100031435 3300005468 Bacteria 5057
112 Ga0070698_100000117 3300005471 Bacteria 67940
113 Ga0070698_100055527 3300005471 Bacteria 4015
114 Ga0070698_100106735 3300005471 Bacteria 2769
115 Ga0070698_100136780 3300005471 Bacteria 2404
116 Ga0070698_100269060 3300005471 Bacteria 1636
117 Ga0070698_100397703 3300005471 Bacteria 1311
118 Ga0070698_100996236 3300005471 Bacteria 785
119 Ga0070699_100167296 3300005518 Bacteria 1948
120 Ga0070699_100263867 3300005518 Bacteria 1540
121 Ga0070699_100414016 3300005518 Bacteria 1220
122 Ga0070699_100992279 3300005518 Bacteria 770
123 Ga0070684_100059640 3300005535 Bacteria 3336
124 Ga0070684_100066871 3300005535 Bacteria 3155
125 Ga0070684_100198194 3300005535 Bacteria 1829
126 Ga0070684_100603476 3300005535 Bacteria 1021
127 Ga0070697_100002643 3300005536 Bacteria 13785
128 Ga0070697_100103468 3300005536 Bacteria 2367
129 Ga0070697_100418303 3300005536 Bacteria 1164
130 Ga0070697_100946234 3300005536 Bacteria 765
131 Ga0068853_100006054 3300005539 Bacteria 9571
132 Ga0068853_100019735 3300005539 Bacteria 5596
133 Ga0068853_100144625 3300005539 Bacteria 2136
134 Ga0070686_100386867 3300005544 Bacteria 1060
135 Ga0070695_100000749 3300005545 Bacteria 17403
136 Ga0070695_100023355 3300005545 Bacteria 3799
137 Ga0070695_100052003 3300005545 Bacteria 2631
138 Ga0070695_101078807 3300005545 Unclassified 656
139 Ga0070695_101317319 3300005545 Bacteria 597
140 Ga0070695_101533688 3300005545 Bacteria 555
141 Ga0070696_100003548 3300005546 Bacteria 10387
142 Ga0070696_100278623 3300005546 Bacteria 1274
143 Ga0070696_101793316 3300005546 Bacteria 530
144 Ga0070693_100013022 3300005547 Bacteria 4226
145 Ga0070665_100156282 3300005548 Bacteria 2282
146 Ga0070704_100123133 3300005549 Bacteria 1996
147 Ga0070704_100165882 3300005549 Unclassified 1751
148 Ga0070704_100369263 3300005549 Bacteria 1216
149 Ga0068855_100155080 3300005563 Bacteria 2602
150 Ga0068855_100187620 3300005563 Bacteria 2334
151 Ga0068855_100237382 3300005563 Bacteria 2038
152 Ga0068855_100237798 3300005563 Bacteria 2036
153 Ga0068855_100326552 3300005563 Bacteria 1694
154 Ga0070664_100148240 3300005564 Bacteria 2070
155 Ga0070664_100184067 3300005564 Bacteria 1858
156 Ga0070664_100392457 3300005564 Bacteria 1268
157 Ga0070664_100482514 3300005564 Bacteria 1141
158 Ga0068857_100003301 3300005577 Bacteria 13403
159 Ga0068857_100005814 3300005577 Bacteria 10539
160 Ga0068857_100164957 3300005577 Bacteria 2011
161 Ga0068857_101693921 3300005577 Unclassified 618
162 Ga0068857_102361741 3300005577 Bacteria 522
163 Ga0068854_100332717 3300005578 Bacteria 1238
164 Ga0068854_100400610 3300005578 Bacteria 1135
165 Ga0068854_101633853 3300005578 Bacteria 588
166 Ga0068854_101859654 3300005578 Bacteria 553
167 Ga0068856_100001825 3300005614 Bacteria 22258
168 Ga0068856_100006323 3300005614 Bacteria 11618
169 Ga0068856_100048310 3300005614 Bacteria 4192
170 Ga0068856_100119983 3300005614 Bacteria 2631
171 Ga0068856_100217333 3300005614 Bacteria 1926
172 Ga0068856_100432350 3300005614 Bacteria 1336
173 Ga0068856_101211655 3300005614 Unclassified 771
174 Ga0068852_100003132 3300005616 Bacteria 11523
175 Ga0068852_101468201 3300005616 Bacteria 704
176 Ga0068859_100828545 3300005617 Bacteria 1012
177 Ga0068859_101814004 3300005617 Bacteria 674
178 Ga0068864_100169381 3300005618 Bacteria 1990
179 Ga0068864_101462819 3300005618 Bacteria 686
180 Ga0068861_101410936 3300005719 Unclassified 680
181 Ga0068861_102224289 3300005719 Bacteria 550
182 Ga0068851_10071334 3300005834 Bacteria 1797
183 Ga0068851_10944457 3300005834 Bacteria 542
184 Ga0068863_100018982 3300005841 Bacteria 6581
185 Ga0068863_100158958 3300005841 Bacteria 2164
186 Ga0068858_100000160 3300005842 Bacteria 71436
187 Ga0068858_100128086 3300005842 Bacteria 2379
188 Ga0068858_101663457 3300005842 Unclassified 630
189 Ga0068860_100003462 3300005843 Bacteria 16234
190 Ga0068860_101562690 3300005843 Bacteria 681
191 Ga0068862_100642661 3300005844 Bacteria 1023
192 Ga0081540_1039923 3300005983 Bacteria 2454
193 Ga0070717_10000241 3300006028 Bacteria 37544
194 Ga0070717_10002171 3300006028 Bacteria 13756
195 Ga0070717_10036741 3300006028 Bacteria 3975
196 Ga0070717_10054433 3300006028 Bacteria 3299
197 Ga0070717_10103613 3300006028 Bacteria 2419
198 Ga0070717_10432922 3300006028 Bacteria 1184
199 Ga0070717_10494474 3300006028 Unclassified 1105
200 Ga0075363_100548729 3300006048 Bacteria 689
201 Ga0070716_100000132 3300006173 Bacteria 29801
202 Ga0070716_100136638 3300006173 Bacteria 1558
203 Ga0070716_100177142 3300006173 Bacteria 1397
204 Ga0070716_100483743 3300006173 Bacteria 910
205 Ga0070716_100636085 3300006173 Bacteria 807
206 Ga0070716_100872754 3300006173 Bacteria 702
207 Ga0070716_101084917 3300006173 Unclassified 638
208 Ga0070712_100032170 3300006175 Bacteria 3539
209 Ga0070712_100092613 3300006175 Bacteria 2216
210 Ga0070712_100446521 3300006175 Bacteria 1076
211 Ga0070712_100631163 3300006175 Bacteria 909
212 Ga0097621_100047191 3300006237 Bacteria 3489
213 Ga0097621_100098562 3300006237 Bacteria 2455
214 Ga0097621_100114161 3300006237 Bacteria 2285
215 Ga0097621_100165170 3300006237 Bacteria 1905
216 Ga0075370_10021737 3300006353 Bacteria 3516
217 Ga0068871_100638680 3300006358 Bacteria 971
218 Ga0068871_101215719 3300006358 Bacteria 707
219 Ga0068871_101492683 3300006358 Bacteria 638
220 Ga0068871_101612013 3300006358 Bacteria 614
221 Ga0068871_102007635 3300006358 Bacteria 550
222 Ga0075430_100659083 3300006846 Bacteria 863
223 Ga0075431_100000264 3300006847 Bacteria 40417
224 Ga0075431_100057961 3300006847 Bacteria 3995
225 Ga0075431_100103854 3300006847 Bacteria 2933
226 Ga0075431_101973893 3300006847 Bacteria 539
227 Ga0075433_10028998 3300006852 Bacteria 4710
228 Ga0075433_10077281 3300006852 Bacteria 2932
229 Ga0075433_10192500 3300006852 Bacteria 1814
230 Ga0075433_11181947 3300006852 Unclassified 664
231 Ga0075434_100147589 3300006871 Bacteria 2372
232 Ga0075434_100355737 3300006871 Bacteria 1485
233 Ga0075434_100687690 3300006871 Bacteria 1041
234 Ga0075429_100325179 3300006880 Bacteria 1346
235 Ga0075429_100401520 3300006880 Bacteria 1200
236 Ga0068865_100022084 3300006881 Bacteria 4145
237 Ga0075436_100026504 3300006914 Bacteria 3991
238 Ga0075436_100886325 3300006914 Unclassified 667
239 Ga0097620_100828612 3300006931 Bacteria 1012
240 Ga0097620_101814039 3300006931 Bacteria 674
241 Ga0075435_100000659 3300007076 Bacteria 21245
242 Ga0075435_100167499 3300007076 Bacteria 1853
243 Ga0075435_100310550 3300007076 Unclassified 1349
244 Ga0075435_100924095 3300007076 Bacteria 761
245 Ga0099794_10066480 3300007265 Bacteria 1759
246 Ga0105240_10002312 3300009093 Bacteria 30849
247 Ga0105240_10566791 3300009093 Bacteria 1254
248 Ga0105240_10610489 3300009093 Bacteria 1200
249 Ga0105240_10642868 3300009093 Bacteria 1164
250 Ga0105240_10721407 3300009093 Bacteria 1086
251 Ga0105240_10826112 3300009093 Bacteria 1002
252 Ga0111539_10011005 3300009094 Bacteria 11388
253 Ga0111539_10242122 3300009094 Bacteria 2100
254 Ga0105245_10001157 3300009098 Bacteria 23865
255 Ga0105245_10289809 3300009098 Bacteria 1603
256 Ga0105247_10188660 3300009101 Bacteria 1379
257 Ga0114129_10157134 3300009147 Bacteria 3108
258 Ga0114129_10229296 3300009147 Bacteria 2502
259 Ga0114129_10289312 3300009147 Bacteria 2187
260 Ga0114129_10569449 3300009147 Unclassified 1471
261 Ga0105243_10056044 3300009148 Bacteria 3133
262 Ga0105243_10737686 3300009148 Bacteria 964
263 Ga0105243_11202173 3300009148 Bacteria 771
264 Ga0105241_10011025 3300009174 Bacteria 6630
265 Ga0105241_10025731 3300009174 Bacteria 4374
266 Ga0105241_10034384 3300009174 Bacteria 3807
267 Ga0105241_10148840 3300009174 Bacteria 1913
268 Ga0105241_10257160 3300009174 Bacteria 1483
269 Ga0105241_10514122 3300009174 Bacteria 1070
270 Ga0105241_10697005 3300009174 Bacteria 927
271 Ga0105241_10912330 3300009174 Bacteria 816
272 Ga0105241_11648991 3300009174 Bacteria 622
273 Ga0105242_10005396 3300009176 Bacteria 9887
274 Ga0105242_10186212 3300009176 Bacteria 1835
275 Ga0105242_11421755 3300009176 Bacteria 722
276 Ga0105242_11956951 3300009176 Bacteria 628
277 Ga0105248_10017193 3300009177 Bacteria 7968
278 Ga0105248_10096511 3300009177 Bacteria 3330
279 Ga0105248_10139596 3300009177 Bacteria 2734
280 Ga0105248_11239672 3300009177 Bacteria 843
281 Ga0105248_12999890 3300009177 Bacteria 538
282 Ga0105237_10011271 3300009545 Bacteria 9459
283 Ga0105237_10045477 3300009545 Bacteria 4417
284 Ga0105237_10061425 3300009545 Bacteria 3757
285 Ga0105237_10342122 3300009545 Bacteria 1500
286 Ga0105237_10600057 3300009545 Bacteria 1108
287 Ga0105237_12245005 3300009545 Bacteria 555
288 Ga0105238_10002608 3300009551 Bacteria 17980
289 Ga0105238_10003648 3300009551 Bacteria 15344
290 Ga0105238_10017410 3300009551 Bacteria 7302
291 Ga0105238_10018628 3300009551 Bacteria 7069
292 Ga0105238_10128875 3300009551 Bacteria 2508
293 Ga0105238_10204230 3300009551 Bacteria 1952
294 Ga0105238_10482535 3300009551 Bacteria 1239
295 Ga0105238_10534921 3300009551 Bacteria 1175
296 Ga0105238_10685613 3300009551 Bacteria 1036
297 Ga0105249_10294295 3300009553 Bacteria 1626
298 Ga0105249_10346498 3300009553 Bacteria 1504
299 Ga0105249_10500026 3300009553 Bacteria 1261
300 Ga0105239_10026255 3300010375 Bacteria 6411
301 Ga0105239_10065438 3300010375 Bacteria 3992
302 Ga0105239_10157377 3300010375 Bacteria 2538
303 Ga0105239_10165237 3300010375 Bacteria 2475
304 Ga0105239_10614716 3300010375 Bacteria 1240
305 Ga0105239_11003929 3300010375 Bacteria 959
306 Ga0157373_10000547 3300013100 Bacteria 29443
307 Ga0157373_10070688 3300013100 Bacteria 2466
308 Ga0157373_10179768 3300013100 Bacteria 1489
309 Ga0157373_10215879 3300013100 Bacteria 1353
310 Ga0157370_10000787 3300013104 Bacteria 39845
311 Ga0157370_10119666 3300013104 Bacteria 2459
312 Ga0157370_10265032 3300013104 Bacteria 1587
313 Ga0157370_10467673 3300013104 Bacteria 1159
314 Ga0157370_10895155 3300013104 Bacteria 806
315 Ga0157369_10000025 3300013105 Bacteria 225515
316 Ga0157369_10006900 3300013105 Bacteria 13105
317 Ga0157369_10047909 3300013105 Bacteria 4639
318 Ga0157369_10050276 3300013105 Bacteria 4515
319 Ga0157369_10055174 3300013105 Bacteria 4289
320 Ga0157369_10096992 3300013105 Bacteria 3145
321 Ga0157369_10219939 3300013105 Bacteria 1988
322 Ga0157369_10302139 3300013105 Bacteria 1665
323 Ga0157369_10351006 3300013105 Bacteria 1532
324 Ga0157369_10942611 3300013105 Bacteria 885
325 Ga0157369_10989580 3300013105 Bacteria 861
326 Ga0157374_10025541 3300013296 Bacteria 5306
327 Ga0157374_10048847 3300013296 Bacteria 3927
328 Ga0157374_10176529 3300013296 Bacteria 2085
329 Ga0157374_10211566 3300013296 Bacteria 1901
330 Ga0157374_10253488 3300013296 Bacteria 1732
331 Ga0157374_10614065 3300013296 Unclassified 1098
332 Ga0157374_11024762 3300013296 Bacteria 845
333 Ga0157374_12052776 3300013296 Bacteria 598
334 Ga0157378_10001917 3300013297 Bacteria 18679
335 Ga0157378_10007980 3300013297 Bacteria 9242
336 Ga0157378_10031684 3300013297 Bacteria 4670
337 Ga0157378_10066892 3300013297 Bacteria 3219
338 Ga0157378_10478297 3300013297 Bacteria 1241
339 Ga0157378_10682080 3300013297 Bacteria 1045
340 Ga0157378_11305062 3300013297 Unclassified 767
341 Ga0163162_10001179 3300013306 Bacteria 24385
342 Ga0163162_10075968 3300013306 Bacteria 3421
343 Ga0163162_10321816 3300013306 Bacteria 1679
344 Ga0163162_11302400 3300013306 Bacteria 825
345 Ga0163162_11664533 3300013306 Bacteria 728
346 Ga0163162_12161545 3300013306 Bacteria 639
347 Ga0157372_10003791 3300013307 Bacteria 16237
348 Ga0157372_10004126 3300013307 Bacteria 15563
349 Ga0157372_10020463 3300013307 Bacteria 7140
350 Ga0157372_10048504 3300013307 Bacteria 4721
351 Ga0157372_10054223 3300013307 Bacteria 4471
352 Ga0157372_10122135 3300013307 Bacteria 2993
353 Ga0157372_10508025 3300013307 Bacteria 1405
354 Ga0157372_10621285 3300013307 Bacteria 1259
355 Ga0157372_10799174 3300013307 Bacteria 1096
356 Ga0157372_11084879 3300013307 Bacteria 926
357 Ga0157372_11320727 3300013307 Bacteria 832
358 Ga0157372_11444149 3300013307 Bacteria 793
359 Ga0157372_11450670 3300013307 Bacteria 791
360 Ga0157372_11968593 3300013307 Bacteria 672
361 Ga0157375_10000004 3300013308 Bacteria 474935
362 Ga0157375_10074900 3300013308 Bacteria 3408
363 Ga0157375_10265921 3300013308 Bacteria 1877
364 Ga0163163_10249858 3300014325 Bacteria 1824
365 Ga0157380_10197435 3300014326 Bacteria 1782
366 Ga0182008_10403856 3300014497 Bacteria 734
367 Ga0157377_10430302 3300014745 Bacteria 906
368 Ga0157379_10020788 3300014968 Bacteria 5809
369 Ga0157379_10069786 3300014968 Bacteria 3143
370 Ga0157376_10080449 3300014969 Bacteria 2795
371 Ga0157376_10089082 3300014969 Bacteria 2667
372 Ga0157376_10099552 3300014969 Bacteria 2537
373 Ga0157376_10415076 3300014969 Bacteria 1305
374 Ga0157376_11612029 3300014969 Bacteria 683
375 Ga0182007_10169583 3300015262 Bacteria 750
376 Ga0182005_1069332 3300015265 Bacteria 967
377 Ga0182005_1145912 3300015265 Unclassified 686
378 Ga0206352_10408732 3300020078 Bacteria 775
379 Ga0213872_10001567 3300021361 Bacteria 14600
380 Ga0213872_10015126 3300021361 Bacteria 3589
381 Ga0213876_10243324 3300021384 Bacteria 956
382 Ga0224572_1000754 3300024225 Bacteria 4221
383 Ga0224572_1037719 3300024225 Bacteria 914
384 Ga0228598_1000015 3300024227 Bacteria 23772
385 Ga0207656_10111733 3300025321 Bacteria 1263
386 Ga0207656_10359920 3300025321 Bacteria 727
387 Ga0207653_10333285 3300025885 Bacteria 591
388 Ga0207692_10003611 3300025898 Bacteria 6054
389 Ga0207710_10262294 3300025900 Bacteria 866
390 Ga0207685_10861176 3300025905 Unclassified 502
391 Ga0207699_10077512 3300025906 Bacteria 2051
392 Ga0207699_10182692 3300025906 Bacteria 1411
393 Ga0207699_10253614 3300025906 Bacteria 1213
394 Ga0207645_10321915 3300025907 Bacteria 1031
395 Ga0207705_10406042 3300025909 Bacteria 1054
396 Ga0207684_10042155 3300025910 Bacteria 3868
397 Ga0207684_10053444 3300025910 Bacteria 3428
398 Ga0207684_10134080 3300025910 Bacteria 2126
399 Ga0207684_10204289 3300025910 Bacteria 1704
400 Ga0207684_10664866 3300025910 Bacteria 887
401 Ga0207654_10099610 3300025911 Bacteria 1788
402 Ga0207654_10324520 3300025911 Bacteria 1053
403 Ga0207654_10388498 3300025911 Bacteria 968
404 Ga0207654_10390980 3300025911 Bacteria 965
405 Ga0207654_10426016 3300025911 Unclassified 927
406 Ga0207707_10087291 3300025912 Bacteria 2726
407 Ga0207707_10184238 3300025912 Bacteria 1822
408 Ga0207707_10189830 3300025912 Bacteria 1793
409 Ga0207695_10007872 3300025913 Bacteria 13454
410 Ga0207695_10015499 3300025913 Bacteria 8971
411 Ga0207695_10018824 3300025913 Bacteria 7968
412 Ga0207695_10083268 3300025913 Bacteria 3232
413 Ga0207695_10412767 3300025913 Bacteria 1234
414 Ga0207695_11386920 3300025913 Bacteria 583
415 Ga0207671_10008824 3300025914 Bacteria 8491
416 Ga0207671_10020853 3300025914 Bacteria 4983
417 Ga0207671_10123246 3300025914 Bacteria 1983
418 Ga0207671_10216245 3300025914 Bacteria 1500
419 Ga0207671_10618332 3300025914 Bacteria 863
420 Ga0207693_10007945 3300025915 Bacteria 8718
421 Ga0207693_10041254 3300025915 Bacteria 3633
422 Ga0207693_10123933 3300025915 Bacteria 2030
423 Ga0207693_10591563 3300025915 Bacteria 864
424 Ga0207663_10013247 3300025916 Bacteria 4479
425 Ga0207663_10065812 3300025916 Bacteria 2318
426 Ga0207663_10120856 3300025916 Bacteria 1794
427 Ga0207663_10231843 3300025916 Bacteria 1349
428 Ga0207663_10375590 3300025916 Bacteria 1082
429 Ga0207663_10543833 3300025916 Bacteria 907
430 Ga0207663_11114823 3300025916 Bacteria 634
431 Ga0207663_11125457 3300025916 Bacteria 631
432 Ga0207662_10046471 3300025918 Bacteria 2568
433 Ga0207662_10968729 3300025918 Bacteria 603
434 Ga0207649_10081088 3300025920 Bacteria 2100
435 Ga0207649_10245096 3300025920 Bacteria 1288
436 Ga0207652_10264928 3300025921 Bacteria 1550
437 Ga0207652_10467918 3300025921 Bacteria 1136
438 Ga0207646_10001174 3300025922 Bacteria 33188
439 Ga0207646_10002707 3300025922 Bacteria 20775
440 Ga0207646_10054505 3300025922 Bacteria 3576
441 Ga0207646_10139988 3300025922 Bacteria 2179
442 Ga0207681_11105309 3300025923 Bacteria 666
443 Ga0207694_10027214 3300025924 Bacteria 4353
444 Ga0207694_10028053 3300025924 Bacteria 4291
445 Ga0207694_10042822 3300025924 Bacteria 3493
446 Ga0207694_10105339 3300025924 Bacteria 2239
447 Ga0207694_10108672 3300025924 Bacteria 2204
448 Ga0207694_10210467 3300025924 Bacteria 1584
449 Ga0207694_10509966 3300025924 Bacteria 1007
450 Ga0207694_10806283 3300025924 Bacteria 793
451 Ga0207650_10019254 3300025925 Bacteria 4793
452 Ga0207650_10184635 3300025925 Bacteria 1664
453 Ga0207650_10366566 3300025925 Bacteria 1188
454 Ga0207687_10000625 3300025927 Bacteria 23866
455 Ga0207687_10082481 3300025927 Bacteria 2326
456 Ga0207700_10001317 3300025928 Bacteria 14099
457 Ga0207700_10031929 3300025928 Bacteria 3748
458 Ga0207700_10046438 3300025928 Bacteria 3212
459 Ga0207700_10128299 3300025928 Unclassified 2067
460 Ga0207700_10520581 3300025928 Bacteria 1054
461 Ga0207700_11051923 3300025928 Bacteria 728
462 Ga0207664_10086087 3300025929 Bacteria 2566
463 Ga0207664_10494324 3300025929 Bacteria 1095
464 Ga0207644_10489607 3300025931 Bacteria 1013
465 Ga0207644_10627322 3300025931 Bacteria 894
466 Ga0207690_10940904 3300025932 Bacteria 718
467 Ga0207690_11301150 3300025932 Bacteria 607
468 Ga0207706_11645846 3300025933 Unclassified 519
469 Ga0207686_10019632 3300025934 Bacteria 3847
470 Ga0207686_10172256 3300025934 Bacteria 1528
471 Ga0207686_10838236 3300025934 Unclassified 739
472 Ga0207686_11131099 3300025934 Bacteria 639
473 Ga0207709_10100067 3300025935 Bacteria 1914
474 Ga0207709_10256517 3300025935 Bacteria 1280
475 Ga0207709_10945098 3300025935 Bacteria 702
476 Ga0207670_10001988 3300025936 Bacteria 10720
477 Ga0207670_10072634 3300025936 Bacteria 2383
478 Ga0207669_10605806 3300025937 Bacteria 891
479 Ga0207704_10024004 3300025938 Bacteria 3297
480 Ga0207704_10106181 3300025938 Bacteria 1886
481 Ga0207704_10675354 3300025938 Bacteria 853
482 Ga0207665_10000317 3300025939 Bacteria 33348
483 Ga0207665_10085833 3300025939 Bacteria 2173
484 Ga0207665_10112386 3300025939 Bacteria 1915
485 Ga0207665_10134325 3300025939 Bacteria 1759
486 Ga0207665_10278527 3300025939 Bacteria 1244
487 Ga0207665_10357961 3300025939 Bacteria 1103
488 Ga0207665_10629510 3300025939 Bacteria 839
489 Ga0207665_11235831 3300025939 Unclassified 596
490 Ga0207711_10028686 3300025941 Bacteria 4687
491 Ga0207711_10134271 3300025941 Unclassified 2221
492 Ga0207711_10199175 3300025941 Bacteria 1827
493 Ga0207711_10359050 3300025941 Bacteria 1349
494 Ga0207711_11760096 3300025941 Bacteria 563
495 Ga0207689_10006498 3300025942 Bacteria 10326
496 Ga0207661_10309008 3300025944 Bacteria 1419
497 Ga0207661_10360822 3300025944 Bacteria 1312
498 Ga0207661_11168509 3300025944 Bacteria 708
499 Ga0207679_10223850 3300025945 Bacteria 1584
500 Ga0207679_10249481 3300025945 Bacteria 1508
501 Ga0207679_11363634 3300025945 Bacteria 651
502 Ga0207667_10004548 3300025949 Bacteria 16996
503 Ga0207667_10012497 3300025949 Bacteria 9775
504 Ga0207667_10043228 3300025949 Bacteria 4783
505 Ga0207667_10080180 3300025949 Bacteria 3382
506 Ga0207667_10109717 3300025949 Bacteria 2846
507 Ga0207667_11617550 3300025949 Bacteria 616
508 Ga0207651_10055773 3300025960 Bacteria 2716
509 Ga0207651_10135457 3300025960 Bacteria 1893
510 Ga0207651_10165316 3300025960 Bacteria 1739
511 Ga0207712_10062775 3300025961 Bacteria 2642
512 Ga0207712_11063824 3300025961 Bacteria 719
513 Ga0207640_10125023 3300025981 Bacteria 1850
514 Ga0207640_10197881 3300025981 Bacteria 1520
515 Ga0207640_10464737 3300025981 Bacteria 1046
516 Ga0207640_10865121 3300025981 Unclassified 787
517 Ga0207658_10777149 3300025986 Bacteria 868
518 Ga0207677_10151552 3300026023 Bacteria 1789
519 Ga0207677_10214585 3300026023 Bacteria 1539
520 Ga0207703_10000016 3300026035 Bacteria 285487
521 Ga0207703_10175762 3300026035 Bacteria 1886
522 Ga0207703_11535229 3300026035 Unclassified 641
523 Ga0207639_10049281 3300026041 Bacteria 3193
524 Ga0207639_10055041 3300026041 Bacteria 3043
525 Ga0207639_10201894 3300026041 Bacteria 1706
526 Ga0207678_10450132 3300026067 Unclassified 1119
527 Ga0207708_10151714 3300026075 Bacteria 1825
528 Ga0207708_10469332 3300026075 Unclassified 1051
529 Ga0207708_10556536 3300026075 Bacteria 968
530 Ga0207708_11911729 3300026075 Bacteria 520
531 Ga0207702_10008417 3300026078 Bacteria 8703
532 Ga0207702_10389013 3300026078 Bacteria 1342
533 Ga0207702_10401951 3300026078 Bacteria 1321
534 Ga0207702_10544953 3300026078 Bacteria 1134
535 Ga0207702_11057843 3300026078 Unclassified 805
536 Ga0207702_11482552 3300026078 Bacteria 672
537 Ga0207641_10013042 3300026088 Bacteria 6817
538 Ga0207641_10151541 3300026088 Bacteria 2100
539 Ga0207641_10327294 3300026088 Bacteria 1454
540 Ga0207648_10150354 3300026089 Bacteria 2054
541 Ga0207648_10477289 3300026089 Bacteria 1139
542 Ga0207648_10939041 3300026089 Bacteria 809
543 Ga0207648_11912551 3300026089 Bacteria 555
544 Ga0207674_10000004 3300026116 Bacteria 241430
545 Ga0207674_10000538 3300026116 Bacteria 49663
546 Ga0207674_10068364 3300026116 Bacteria 3575
547 Ga0207675_100082983 3300026118 Bacteria 3006
548 Ga0207675_100203728 3300026118 Bacteria 1901
549 Ga0207675_100368467 3300026118 Bacteria 1411
550 Ga0207683_10637478 3300026121 Bacteria 987
551 Ga0207698_10044113 3300026142 Bacteria 3347
552 Ga0207698_10233366 3300026142 Bacteria 1672
553 Ga0207698_10948562 3300026142 Bacteria 869
554 Ga0207698_11335913 3300026142 Bacteria 732
555 Ga0209967_1009693 3300027364 Bacteria 1336
556 Ga0209984_1006926 3300027424 Bacteria 1400
557 Ga0210000_1004085 3300027462 Bacteria 2108
558 Ga0209995_1009081 3300027471 Bacteria 1607
559 Ga0209968_1000365 3300027526 Bacteria 7479
560 Ga0209999_1007392 3300027543 Bacteria 1978
561 Ga0209970_1000402 3300027614 Bacteria 7334
562 Ga0210002_1001954 3300027617 Bacteria 2958
563 Ga0209983_1000217 3300027665 Bacteria 11496
564 Ga0209971_1000093 3300027682 Bacteria 27033
565 Ga0209966_1012168 3300027695 Bacteria 1577
566 Ga0209998_10030563 3300027717 Bacteria 1191
567 Ga0209998_10054927 3300027717 Bacteria 929
568 Ga0209974_10003052 3300027876 Bacteria 6058
569 Ga0207428_10211579 3300027907 Bacteria 1456
570 Ga0265354_1004184 3300028016 Bacteria 1535
571 Ga0268266_10036092 3300028379 Bacteria 4206
572 Ga0268266_10170641 3300028379 Bacteria 1974
573 Ga0268265_11672917 3300028380 Bacteria 642
574 Ga0268264_10001058 3300028381 Bacteria 27342
575 Ga0268264_10238233 3300028381 Bacteria 1684
576 Ga0268264_10610691 3300028381 Unclassified 1076
577 Ga0268264_11025416 3300028381 Bacteria 832
578 Ga0265338_10010392 3300028800 Bacteria 10920
579 Ga0265338_10222144 3300028800 Bacteria 1410
580 Ga0265338_10533440 3300028800 Bacteria 823
581 Ga0265766_1005588 3300030863 Unclassified 802
582 Ga0265765_1027452 3300030879 Bacteria 713
583 Ga0265760_10000487 3300031090 Bacteria 11121
584 Ga0265330_10102203 3300031235 Bacteria 1227
585 Ga0265328_10050014 3300031239 Bacteria 1535
586 Ga0265340_10062456 3300031247 Bacteria 1779
587 Ga0265340_10068281 3300031247 Bacteria 1688
588 Ga0265339_10014999 3300031249 Bacteria 4656
589 Ga0265331_10039899 3300031250 Bacteria 2287
590 Ga0265316_10006992 3300031344 Bacteria 10692
591 Ga0265316_10136738 3300031344 Bacteria 1843
592 Ga0265313_10267746 3300031595 Bacteria 693
593 Ga0307516_10029044 3300031730 Bacteria 5593
594 Ga0307516_10282175 3300031730 Bacteria 1342
595 Ga0307516_10621443 3300031730 Bacteria 735
596 Ga0307407_10339667 3300031903 Bacteria 1060
597 Ga0307416_100414991 3300032002 Bacteria 1388
598 Ga0307416_102273390 3300032002 Bacteria 643
599 Ga0307507_10069639 3300033179 Bacteria 3199
600 Ga0373926_0236828 3300035083 Bacteria 706
601 Ga0373928_0089091 3300035084 Bacteria 789
602 Ga0373944_0044955 3300035089 Bacteria 1377
603 Ga0373949_0100430 3300035090 Bacteria 792
604 Ga0373932_0192615 3300035112 Bacteria 721
605 Ga0373936_0123708 3300035113 Bacteria 1107
606 Ga0373936_0629581 3300035113 Bacteria 505
607 Ga0373941_0144456 3300035115 Bacteria 868
608 Ga0373941_0397337 3300035115 Bacteria 569
609 Ga0373960_0379090 3300035121 Bacteria 542
610 Ga0373943_0654105 3300035170 Bacteria 621
611 Ga0373942_0169086 3300035207 Bacteria 711
612 Ga0373961_0000533 3300035241 Bacteria 14489
613 Ga0373962_0076193 3300035242 Bacteria 1011
614 Ga0373931_0042823 3300035691 Unclassified 2382
615 Ga0373931_0048809 3300035691 Bacteria 2245
616 Ga0373935_0254422 3300035692 Bacteria 1230
617 Ga0373927_0125546 3300035695 Bacteria 1675
618 Ga0373933_0180045 3300035724 Bacteria 1348
619 Ga0373947_0348037 3300035725 Bacteria 994
620 Ga0373937_0311555 3300036401 Bacteria 1489
621 Ga0373937_1256587 3300036401 Bacteria 689
622 Ga0373937_1733651 3300036401 Bacteria 571
623 Ga0373925_0014221 3300037068 Bacteria 5758
624 Ga0373925_0024909 3300037068 Bacteria 4371
625 Ga0373925_0625114 3300037068 Bacteria 887
626 Ga0395898_1689576 3300037466 Bacteria 556
627 Ga0395901_0786133 3300038443 Bacteria 942
628 Ga0395901_0863257 3300038443 Bacteria 889
629 Ga0436365_0195783 3300039437 Bacteria 1066
630 Ga0436360_0083929 3300039438 Bacteria 2043
631 Ga0436361_0572145 3300039447 Bacteria 42313
632 Ga0436361_0588872 3300039447 Bacteria 2427
633 Ga0436363_1689408 3300039450 Bacteria 1869
634 Ga0451789_0210512 3300041443 Bacteria 646
635 Ga0451798_0627138 3300041458 Bacteria 889
636 Ga0451802_1443065 3300041460 Bacteria 757
637 Ga0451804_1018234 3300041463 Unclassified 614
638 Ga0451807_0341991 3300041486 Unclassified 794
639 Ga0451807_1396474 3300041486 Bacteria 730
640 Ga0451807_1503261 3300041486 Bacteria 1179
641 Ga0451837_0159427 3300041494 Bacteria 2170
642 Ga0451839_0828414 3300041496 Bacteria 578
643 Ga0451845_0231071 3300041501 Bacteria 526
644 Ga0451851_0191838 3300041507 Bacteria 743
645 Ga0450923_119175 3300042125 Archaea 621
646 Ga0453683_0525787 3300044673 Bacteria 769
647 Ga0453683_0603528 3300044673 Bacteria 716
648 Ga0453683_0735048 3300044673 Bacteria 648
649 Ga0453683_0994644 3300044673 Bacteria 557
650 Ga0466959_0021561 3300045049 Bacteria 4754
651 Ga0451576_1544281 3300045051 Bacteria 689
652 Ga0495590_0241944 3300046457 Bacteria 670
653 Ga0495629_0572689 3300046459 Bacteria 757
654 Ga0495580_0004978 3300046472 Bacteria 11096
655 Ga0495580_0054089 3300046472 Bacteria 2833
656 Ga0495580_0286949 3300046472 Bacteria 1122
657 Ga0495580_0319170 3300046472 Bacteria 1056
658 Ga0495580_0323091 3300046472 Bacteria 1049
659 Ga0495582_0362168 3300046473 Bacteria 835
660 Ga0495662_0202652 3300046476 Bacteria 978
661 Ga0495584_0471955 3300046491 Bacteria 639
662 Ga0495630_0430886 3300046517 Bacteria 1010
663 Ga0495622_0440002 3300046557 Unclassified 559
664 Ga0495625_0709813 3300046660 Bacteria 593
665 Ga0495588_0156992 3300046674 Bacteria 1203
666 Ga0495647_0367850 3300046681 Bacteria 657
667 Ga0495658_0366054 3300046683 Bacteria 917
668 Ga0495669_0050731 3300046684 Bacteria 1861
669 Ga0495674_0611985 3300047319 Bacteria 862
670 Ga0495679_007880 3300047446 Bacteria 4388
671 Ga0495684_0835885 3300047471 Bacteria 599
672 Ga0495602_0355761 3300048088 Bacteria 1056
673 Ga0496100_0400077 3300048903 Bacteria 1046
674 Ga0496101_0564309 3300048904 Bacteria 900
675 Ga0496102_0435243 3300048905 Bacteria 1231
676 Ga0496102_0482247 3300048905 Bacteria 1161
677 Ga0496102_1049568 3300048905 Bacteria 735
678 Ga0496102_1188426 3300048905 Bacteria 682
679 Ga0496104_0015667 3300048907 Bacteria 6876
680 Ga0496104_0048827 3300048907 Bacteria 3990
681 Ga0496104_0391259 3300048907 Bacteria 1302
682 Ga0496104_0602895 3300048907 Bacteria 1008
683 Ga0496105_0007070 3300048908 Bacteria 8651
684 Ga0496105_0385043 3300048908 Bacteria 1115
685 Ga0496105_0402482 3300048908 Bacteria 1086
686 Ga0496106_0071513 3300048909 Bacteria 2652
687 Ga0496112_0106760 3300048915 Bacteria 2770
688 Ga0496112_0506114 3300048915 Bacteria 1143
689 Ga0496112_0936063 3300048915 Bacteria 788
690 Ga0496112_1263248 3300048915 Bacteria 654
691 Ga0496112_1709681 3300048915 Bacteria 542
692 Ga0496113_0510562 3300048916 Unclassified 965
693 Ga0496114_0010012 3300048917 Bacteria 7537
694 Ga0496114_1195156 3300048917 Bacteria 646
695 Ga0496115_0253271 3300048918 Bacteria 1449
696 Ga0496115_0334732 3300048918 Bacteria 1236
697 Ga0496126_0004663 3300048929 Bacteria 16210
698 Ga0501031_0451086 3300049568 Bacteria 831
699 Ga0501032_0013843 3300049569 Bacteria 5723
700 Ga0501033_0001381 3300049570 Bacteria 21628
701 Ga0501034_0010860 3300049571 Bacteria 9458
702 Ga0501034_0063663 3300049571 Bacteria 3702
703 Ga0501036_0015321 3300049572 Bacteria 6402
704 Ga0501037_0001442 3300049573 Bacteria 17457
705 Ga0501037_0108402 3300049573 Bacteria 2001
706 Ga0501038_0000650 3300049574 Bacteria 30879
707 Ga0501038_0420616 3300049574 Bacteria 1031
708 Ga0501038_0613143 3300049574 Bacteria 822
709 Ga0501039_0034194 3300049575 Bacteria 3922
710 Ga0501039_0232351 3300049575 Bacteria 1450
711 Ga0501040_0300068 3300049576 Bacteria 1148
712 Ga0501040_1238176 3300049576 Unclassified 542
713 Ga0501041_0319603 3300049577 Bacteria 979
714 Ga0501041_0328686 3300049577 Bacteria 965
715 Ga0501042_0049884 3300049578 Bacteria 2987
716 Ga0501042_0239097 3300049578 Bacteria 1310
717 Ga0501043_0030948 3300049579 Bacteria 4208
718 Ga0501043_0166807 3300049579 Bacteria 1719
719 Ga0501043_0760390 3300049579 Bacteria 704
720 Ga0501046_0008656 3300049580 Bacteria 8848
721 Ga0501046_0070640 3300049580 Bacteria 2714
722 Ga0501046_0219959 3300049580 Bacteria 1406
723 Ga0501047_0090196 3300049581 Bacteria 2942
724 Ga0501047_0418510 3300049581 Bacteria 1171
725 Ga0501048_0059953 3300049582 Bacteria 2697
726 Ga0501048_0411752 3300049582 Bacteria 967
727 Ga0501068_0096308 3300049584 Bacteria 1830
728 Ga0501068_0188494 3300049584 Bacteria 1306
729 Ga0501069_1017229 3300049585 Bacteria 506
730 Ga0501070_0190773 3300049586 Bacteria 1684
731 Ga0501071_0155711 3300049587 Bacteria 1706
732 Ga0501071_0448657 3300049587 Bacteria 987
733 Ga0501072_0361704 3300049588 Bacteria 1152
734 Ga0501072_1326502 3300049588 Bacteria 557
735 Ga0501073_0000637 3300049589 Bacteria 24595
736 Ga0501073_0089078 3300049589 Bacteria 2145
737 Ga0501073_0148370 3300049589 Bacteria 1625
738 Ga0501073_1221011 3300049589 Bacteria 516
739 Ga0501074_0044381 3300049590 Bacteria 3218
740 Ga0501074_0076755 3300049590 Bacteria 2398
741 Ga0501074_0110242 3300049590 Bacteria 1969
742 Ga0501074_0179777 3300049590 Bacteria 1509
743 Ga0501074_0254397 3300049590 Bacteria 1249
744 Ga0501075_0029309 3300049591 Bacteria 4070
745 Ga0501075_0054932 3300049591 Bacteria 2997
746 Ga0501075_0277778 3300049591 Bacteria 1276
747 Ga0501075_0877184 3300049591 Bacteria 682
748 Ga0501076_0041284 3300049592 Bacteria 3629
749 Ga0501076_0056658 3300049592 Bacteria 3111
750 Ga0501076_0107874 3300049592 Bacteria 2249
751 Ga0501076_0127017 3300049592 Bacteria 2067
752 Ga0501076_0131135 3300049592 Bacteria 2033
753 Ga0501076_0314351 3300049592 Bacteria 1285
754 Ga0501077_0205579 3300049593 Bacteria 1251
755 Ga0501207_062283 3300049654 Bacteria 686
756 Ga0501251_114527 3300049681 Unclassified 505
757 Ga0501079_0093240 3300049741 Bacteria 2333
758 Ga0501079_0107580 3300049741 Bacteria 2165
759 Ga0501079_0135195 3300049741 Bacteria 1919
760 Ga0501080_0041536 3300049742 Bacteria 4284
761 Ga0501080_0154061 3300049742 Bacteria 2123
762 Ga0501080_0458400 3300049742 Bacteria 1142
763 Ga0501081_0024194 3300049743 Bacteria 4077
764 Ga0501081_0463185 3300049743 Bacteria 942
765 Ga0501083_0142637 3300049744 Bacteria 1568
766 Ga0501083_0215030 3300049744 Bacteria 1253
767 Ga0501035_0012190 3300049822 Bacteria 7948
768 Ga0501035_0246596 3300049822 Bacteria 1518
769 Ga0501035_0262065 3300049822 Bacteria 1465
770 Ga0501044_0115941 3300049823 Bacteria 2684
771 Ga0501044_0143576 3300049823 Bacteria 2374
772 Ga0501044_0253843 3300049823 Bacteria 1698
773 Ga0501045_0125815 3300049824 Bacteria 1904
774 Ga0501045_0786086 3300049824 Bacteria 701
775 nmdc:mga06z11_420541_c1 3300050494 Bacteria 805
776 nmdc:mga07m45_50761_c1 3300050496 Bacteria 2338
777 nmdc:mga05p37_211945_c2 3300050507 Unclassified 744
778 nmdc:mga05p37_315392_c1 3300050507 Bacteria 1852
779 nmdc:mga05p37_568154_c1 3300050507 Unclassified 1287
780 nmdc:mga05p37_572162_c1 3300050507 Bacteria 1281
781 nmdc:mga09592_417864_c1 3300050508 Bacteria 1159
782 nmdc:mga06r32_100238_c1 3300050510 Bacteria 2841
783 nmdc:mga06r32_115446_c1 3300050510 Bacteria 2644
784 nmdc:mga06r32_5033_c1 3300050510 Bacteria 11900
785 nmdc:mga08y16_11570_c1 3300050511 Bacteria 9274
786 nmdc:mga08y16_180517_c1 3300050511 Bacteria 2192
787 nmdc:mga0n895_145872_c1 3300050512 Bacteria 2396
788 nmdc:mga0n895_15956_c1 3300050512 Bacteria 6874
789 nmdc:mga0n895_336207_c1 3300050512 Bacteria 1530
790 nmdc:mga0n895_445691_c1 3300050512 Bacteria 1307
791 nmdc:mga0n895_69024_c1 3300050512 Bacteria 3501
792 nmdc:mga0rr50_119139_c1 3300050513 Bacteria 2098
793 nmdc:mga0rr50_1431382_c1 3300050513 Bacteria 585
794 nmdc:mga0rr50_283672_c1 3300050513 Bacteria 1382
795 nmdc:mga0rr50_375613_c1 3300050513 Bacteria 1198
796 nmdc:mga0rr50_680_c1 3300050513 Bacteria 18229
797 nmdc:mga0rr50_692352_c1 3300050513 Bacteria 870
798 nmdc:mga08x19_21707_c1 3300050514 Bacteria 3967
799 nmdc:mga08x19_2406_c1 3300050514 Bacteria 11353
800 nmdc:mga08x19_92134_c1 3300050514 Bacteria 2001
801 nmdc:mga0a205_246179_c1 3300050515 Bacteria 1668
802 nmdc:mga0a205_54542_c1 3300050515 Bacteria 3860
803 nmdc:mga0a205_62938_c1 3300050515 Bacteria 3584
804 Ga0495595_0085790 3300053084 Bacteria 1506
805 Ga0500572_000823 3300053111 Bacteria 9768
806 Ga0500595_024337 3300053119 Bacteria 2115
807 Ga0500568_0001378 3300053139 Bacteria 15779
808 Ga0500627_0208840 3300053158 Bacteria 874
809 Ga0501084_0114267 3300054114 Bacteria 2270
810 Ga0501084_0185734 3300054114 Bacteria 1754
811 Ga0501084_0900811 3300054114 Bacteria 744
812 Ga0501084_1869415 3300054114 Bacteria 501
813 Ga0501082_0000144 3300060353 Bacteria 59165
814 Ga0501082_0028341 3300060353 Bacteria 4825
815 Ga0501082_0197051 3300060353 Unclassified 1752
816 Ga0501082_0266029 3300060353 Bacteria 1492
817 Ga0530510_0195702 3300061734 Bacteria 1501
818 Ga0070717_10272665
819 rootH1_10018790
820 rootH2_10031538
821 JGI26141J51220_1004901
822 Ga0065712_10277471
823 Ga0065715_10102278
824 Ga0065715_10117509
825 Ga0065707_10130176
826 Ga0070658_10015984
827 Ga0070658_10209693
828 Ga0070658_10681303
829 Ga0070683_100038334
830 Ga0070683_100155325
831 Ga0070683_100647723
832 Ga0070670_100233041
833 Ga0070670_100249168
834 Ga0070670_100333234
835 Ga0068869_100110287
836 Ga0068869_101491563
837 Ga0070666_10042227
838 Ga0070666_10246923
839 Ga0070680_100193388
840 Ga0070682_100245733
841 Ga0070682_100415924
842 Ga0070682_100549859
843 Ga0068868_100956676
844 Ga0068868_101171718
845 Ga0070660_100889573
846 Ga0070689_100000480
847 Ga0070689_100101356
848 Ga0070689_100123827
849 Ga0070691_10008089
850 Ga0070691_10024905
851 Ga0070691_10669854
852 Ga0070661_100071859
853 Ga0070692_10314403
854 Ga0070692_10456590
855 Ga0070692_10494541
856 Ga0070668_101303062
857 Ga0070669_101463116
858 Ga0070671_100120594
859 Ga0070671_100178302
860 Ga0070671_101475007
861 Ga0070674_100153299
862 Ga0070673_100008341
863 Ga0070673_100081135
864 Ga0070673_100397708
865 Ga0070688_101643572
866 Ga0070659_100953161
867 Ga0070659_101576439
868 Ga0070703_10122993
869 Ga0070709_10039516
870 Ga0070709_10142154
871 Ga0070709_10558632
872 Ga0070714_100001369
873 Ga0070714_100300798
874 Ga0070714_100965041
875 Ga0070714_101085226
876 Ga0070714_101779622
877 Ga0070713_100045416
878 Ga0070713_100079911
879 Ga0070713_100471429
880 Ga0070713_100663584
881 Ga0070713_100702328
882 Ga0070713_101976886
883 Ga0070710_10051719
884 Ga0070710_10106701
885 Ga0070710_10644671
886 Ga0070701_10009097
887 Ga0070701_11079831
888 Ga0070711_100144755
889 Ga0070711_100301186
890 Ga0070711_100377213
891 Ga0070711_100463236
892 Ga0070711_100714502
893 Ga0070711_100771553
894 Ga0070711_101990762
895 Ga0070705_100000318
896 Ga0070705_100767469
897 Ga0070700_100454192
898 Ga0070700_100543650
899 Ga0070700_101858422
900 Ga0070694_100009496
901 Ga0070694_101260113
902 Ga0070708_100073918
903 Ga0070708_100924796
904 Ga0070708_101245173
905 Ga0070708_101720513
906 Ga0070708_101765480
907 Ga0070663_100184638
908 Ga0070663_101087722
909 Ga0070663_102161206
910 Ga0070678_100459278
911 Ga0070681_10031513
912 Ga0070681_10065939
913 Ga0070681_11821283
914 Ga0068867_100370149
915 Ga0068867_100435693
916 Ga0068867_100959455
917 Ga0068867_101766558
918 Ga0070685_10005965
919 Ga0070685_10378068
920 Ga0070706_100035133
921 Ga0070706_100131510
922 Ga0070706_100428575
923 Ga0070706_100543534
924 Ga0070706_100710742
925 Ga0070706_101674422
926 Ga0070707_100013869
927 Ga0070707_100030408
928 Ga0070707_100031435
929 Ga0070698_100000117
930 Ga0070698_100055527
931 Ga0070698_100106735
932 Ga0070698_100136780
933 Ga0070698_100269060
934 Ga0070698_100397703
935 Ga0070698_100996236
936 Ga0070699_100167296
937 Ga0070699_100263867
938 Ga0070699_100414016
939 Ga0070699_100992279
940 Ga0070684_100059640
941 Ga0070684_100066871
942 Ga0070684_100198194
943 Ga0070684_100603476
944 Ga0070697_100002643
945 Ga0070697_100103468
946 Ga0070697_100418303
947 Ga0070697_100946234
948 Ga0068853_100006054
949 Ga0068853_100019735
950 Ga0068853_100144625
951 Ga0070686_100386867
952 Ga0070695_100000749
953 Ga0070695_100023355
954 Ga0070695_100052003
955 Ga0070695_101078807
956 Ga0070695_101317319
957 Ga0070695_101533688
958 Ga0070696_100003548
959 Ga0070696_100278623
960 Ga0070696_101793316
961 Ga0070693_100013022
962 Ga0070665_100156282
963 Ga0070704_100123133
964 Ga0070704_100165882
965 Ga0070704_100369263
966 Ga0068855_100155080
967 Ga0068855_100187620
968 Ga0068855_100237382
969 Ga0068855_100237798
970 Ga0068855_100326552
971 Ga0070664_100148240
972 Ga0070664_100184067
973 Ga0070664_100392457
974 Ga0070664_100482514
975 Ga0068857_100003301
976 Ga0068857_100005814
977 Ga0068857_100164957
978 Ga0068857_101693921
979 Ga0068857_102361741
980 Ga0068854_100332717
981 Ga0068854_100400610
982 Ga0068854_101633853
983 Ga0068854_101859654
984 Ga0068856_100001825
985 Ga0068856_100006323
986 Ga0068856_100048310
987 Ga0068856_100119983
988 Ga0068856_100217333
989 Ga0068856_100432350
990 Ga0068856_101211655
991 Ga0068852_100003132
992 Ga0068852_101468201
993 Ga0068859_100828545
994 Ga0068859_101814004
995 Ga0068864_100169381
996 Ga0068864_101462819
997 Ga0068861_101410936
998 Ga0068861_102224289
999 Ga0068851_10071334
1000 Ga0068851_10944457
1001 Ga0068863_100018982
1002 Ga0068863_100158958
1003 Ga0068858_100000160
1004 Ga0068858_100128086
1005 Ga0068858_101663457
1006 Ga0068860_100003462
1007 Ga0068860_101562690
1008 Ga0068862_100642661
1009 Ga0081540_1039923
1010 Ga0070717_10000241
1011 Ga0070717_10002171
1012 Ga0070717_10036741
1013 Ga0070717_10054433
1014 Ga0070717_10103613
1015 Ga0070717_10432922
1016 Ga0070717_10494474
1017 Ga0075363_100548729
1018 Ga0070716_100000132
1019 Ga0070716_100136638
1020 Ga0070716_100177142
1021 Ga0070716_100483743
1022 Ga0070716_100636085
1023 Ga0070716_100872754
1024 Ga0070716_101084917
1025 Ga0070712_100032170
1026 Ga0070712_100092613
1027 Ga0070712_100446521
1028 Ga0070712_100631163
1029 Ga0097621_100047191
1030 Ga0097621_100098562
1031 Ga0097621_100114161
1032 Ga0097621_100165170
1033 Ga0075370_10021737
1034 Ga0068871_100638680
1035 Ga0068871_101215719
1036 Ga0068871_101492683
1037 Ga0068871_101612013
1038 Ga0068871_102007635
1039 Ga0075430_100659083
1040 Ga0075431_100000264
1041 Ga0075431_100057961
1042 Ga0075431_100103854
1043 Ga0075431_101973893
1044 Ga0075433_10028998
1045 Ga0075433_10077281
1046 Ga0075433_10192500
1047 Ga0075433_11181947
1048 Ga0075434_100147589
1049 Ga0075434_100355737
1050 Ga0075434_100687690
1051 Ga0075429_100325179
1052 Ga0075429_100401520
1053 Ga0068865_100022084
1054 Ga0075436_100026504
1055 Ga0075436_100886325
1056 Ga0097620_100828612
1057 Ga0097620_101814039
1058 Ga0075435_100000659
1059 Ga0075435_100167499
1060 Ga0075435_100310550
1061 Ga0075435_100924095
1062 Ga0099794_10066480
1063 Ga0105240_10002312
1064 Ga0105240_10566791
1065 Ga0105240_10610489
1066 Ga0105240_10642868
1067 Ga0105240_10721407
1068 Ga0105240_10826112
1069 Ga0111539_10011005
1070 Ga0111539_10242122
1071 Ga0105245_10001157
1072 Ga0105245_10289809
1073 Ga0105247_10188660
1074 Ga0114129_10157134
1075 Ga0114129_10229296
1076 Ga0114129_10289312
1077 Ga0114129_10569449
1078 Ga0105243_10056044
1079 Ga0105243_10737686
1080 Ga0105243_11202173
1081 Ga0105241_10011025
1082 Ga0105241_10025731
1083 Ga0105241_10034384
1084 Ga0105241_10148840
1085 Ga0105241_10257160
1086 Ga0105241_10514122
1087 Ga0105241_10697005
1088 Ga0105241_10912330
1089 Ga0105241_11648991
1090 Ga0105242_10005396
1091 Ga0105242_10186212
1092 Ga0105242_11421755
1093 Ga0105242_11956951
1094 Ga0105248_10017193
1095 Ga0105248_10096511
1096 Ga0105248_10139596
1097 Ga0105248_11239672
1098 Ga0105248_12999890
1099 Ga0105237_10011271
1100 Ga0105237_10045477
1101 Ga0105237_10061425
1102 Ga0105237_10342122
1103 Ga0105237_10600057
1104 Ga0105237_12245005
1105 Ga0105238_10002608
1106 Ga0105238_10003648
1107 Ga0105238_10017410
1108 Ga0105238_10018628
1109 Ga0105238_10128875
1110 Ga0105238_10204230
1111 Ga0105238_10482535
1112 Ga0105238_10534921
1113 Ga0105238_10685613
1114 Ga0105249_10294295
1115 Ga0105249_10346498
1116 Ga0105249_10500026
1117 Ga0105239_10026255
1118 Ga0105239_10065438
1119 Ga0105239_10157377
1120 Ga0105239_10165237
1121 Ga0105239_10614716
1122 Ga0105239_11003929
1123 Ga0157373_10000547
1124 Ga0157373_10070688
1125 Ga0157373_10179768
1126 Ga0157373_10215879
1127 Ga0157370_10000787
1128 Ga0157370_10119666
1129 Ga0157370_10265032
1130 Ga0157370_10467673
1131 Ga0157370_10895155
1132 Ga0157369_10000025
1133 Ga0157369_10006900
1134 Ga0157369_10047909
1135 Ga0157369_10050276
1136 Ga0157369_10055174
1137 Ga0157369_10096992
1138 Ga0157369_10219939
1139 Ga0157369_10302139
1140 Ga0157369_10351006
1141 Ga0157369_10942611
1142 Ga0157369_10989580
1143 Ga0157374_10025541
1144 Ga0157374_10048847
1145 Ga0157374_10176529
1146 Ga0157374_10211566
1147 Ga0157374_10253488
1148 Ga0157374_10614065
1149 Ga0157374_11024762
1150 Ga0157374_12052776
1151 Ga0157378_10001917
1152 Ga0157378_10007980
1153 Ga0157378_10031684
1154 Ga0157378_10066892
1155 Ga0157378_10478297
1156 Ga0157378_10682080
1157 Ga0157378_11305062
1158 Ga0163162_10001179
1159 Ga0163162_10075968
1160 Ga0163162_10321816
1161 Ga0163162_11302400
1162 Ga0163162_11664533
1163 Ga0163162_12161545
1164 Ga0157372_10003791
1165 Ga0157372_10004126
1166 Ga0157372_10020463
1167 Ga0157372_10048504
1168 Ga0157372_10054223
1169 Ga0157372_10122135
1170 Ga0157372_10508025
1171 Ga0157372_10621285
1172 Ga0157372_10799174
1173 Ga0157372_11084879
1174 Ga0157372_11320727
1175 Ga0157372_11444149
1176 Ga0157372_11450670
1177 Ga0157372_11968593
1178 Ga0157375_10000004
1179 Ga0157375_10074900
1180 Ga0157375_10265921
1181 Ga0163163_10249858
1182 Ga0157380_10197435
1183 Ga0182008_10403856
1184 Ga0157377_10430302
1185 Ga0157379_10020788
1186 Ga0157379_10069786
1187 Ga0157376_10080449
1188 Ga0157376_10089082
1189 Ga0157376_10099552
1190 Ga0157376_10415076
1191 Ga0157376_11612029
1192 Ga0182007_10169583
1193 Ga0182005_1069332
1194 Ga0182005_1145912
1195 Ga0206352_10408732
1196 Ga0213872_10001567
1197 Ga0213872_10015126
1198 Ga0213876_10243324
1199 Ga0224572_1000754
1200 Ga0224572_1037719
1201 Ga0228598_1000015
1202 Ga0207656_10111733
1203 Ga0207656_10359920
1204 Ga0207653_10333285
1205 Ga0207692_10003611
1206 Ga0207710_10262294
1207 Ga0207685_10861176
1208 Ga0207699_10077512
1209 Ga0207699_10182692
1210 Ga0207699_10253614
1211 Ga0207645_10321915
1212 Ga0207705_10406042
1213 Ga0207684_10042155
1214 Ga0207684_10053444
1215 Ga0207684_10134080
1216 Ga0207684_10204289
1217 Ga0207684_10664866
1218 Ga0207654_10099610
1219 Ga0207654_10324520
1220 Ga0207654_10388498
1221 Ga0207654_10390980
1222 Ga0207654_10426016
1223 Ga0207707_10087291
1224 Ga0207707_10184238
1225 Ga0207707_10189830
1226 Ga0207695_10007872
1227 Ga0207695_10015499
1228 Ga0207695_10018824
1229 Ga0207695_10083268
1230 Ga0207695_10412767
1231 Ga0207695_11386920
1232 Ga0207671_10008824
1233 Ga0207671_10020853
1234 Ga0207671_10123246
1235 Ga0207671_10216245
1236 Ga0207671_10618332
1237 Ga0207693_10007945
1238 Ga0207693_10041254
1239 Ga0207693_10123933
1240 Ga0207693_10591563
1241 Ga0207663_10013247
1242 Ga0207663_10065812
1243 Ga0207663_10120856
1244 Ga0207663_10231843
1245 Ga0207663_10375590
1246 Ga0207663_10543833
1247 Ga0207663_11114823
1248 Ga0207663_11125457
1249 Ga0207662_10046471
1250 Ga0207662_10968729
1251 Ga0207649_10081088
1252 Ga0207649_10245096
1253 Ga0207652_10264928
1254 Ga0207652_10467918
1255 Ga0207646_10001174
1256 Ga0207646_10002707
1257 Ga0207646_10054505
1258 Ga0207646_10139988
1259 Ga0207681_11105309
1260 Ga0207694_10027214
1261 Ga0207694_10028053
1262 Ga0207694_10042822
1263 Ga0207694_10105339
1264 Ga0207694_10108672
1265 Ga0207694_10210467
1266 Ga0207694_10509966
1267 Ga0207694_10806283
1268 Ga0207650_10019254
1269 Ga0207650_10184635
1270 Ga0207650_10366566
1271 Ga0207687_10000625
1272 Ga0207687_10082481
1273 Ga0207700_10001317
1274 Ga0207700_10031929
1275 Ga0207700_10046438
1276 Ga0207700_10128299
1277 Ga0207700_10520581
1278 Ga0207700_11051923
1279 Ga0207664_10086087
1280 Ga0207664_10494324
1281 Ga0207644_10489607
1282 Ga0207644_10627322
1283 Ga0207690_10940904
1284 Ga0207690_11301150
1285 Ga0207706_11645846
1286 Ga0207686_10019632
1287 Ga0207686_10172256
1288 Ga0207686_10838236
1289 Ga0207686_11131099
1290 Ga0207709_10100067
1291 Ga0207709_10256517
1292 Ga0207709_10945098
1293 Ga0207670_10001988
1294 Ga0207670_10072634
1295 Ga0207669_10605806
1296 Ga0207704_10024004
1297 Ga0207704_10106181
1298 Ga0207704_10675354
1299 Ga0207665_10000317
1300 Ga0207665_10085833
1301 Ga0207665_10112386
1302 Ga0207665_10134325
1303 Ga0207665_10278527
1304 Ga0207665_10357961
1305 Ga0207665_10629510
1306 Ga0207665_11235831
1307 Ga0207711_10028686
1308 Ga0207711_10134271
1309 Ga0207711_10199175
1310 Ga0207711_10359050
1311 Ga0207711_11760096
1312 Ga0207689_10006498
1313 Ga0207661_10309008
1314 Ga0207661_10360822
1315 Ga0207661_11168509
1316 Ga0207679_10223850
1317 Ga0207679_10249481
1318 Ga0207679_11363634
1319 Ga0207667_10004548
1320 Ga0207667_10012497
1321 Ga0207667_10043228
1322 Ga0207667_10080180
1323 Ga0207667_10109717
1324 Ga0207667_11617550
1325 Ga0207651_10055773
1326 Ga0207651_10135457
1327 Ga0207651_10165316
1328 Ga0207712_10062775
1329 Ga0207712_11063824
1330 Ga0207640_10125023
1331 Ga0207640_10197881
1332 Ga0207640_10464737
1333 Ga0207640_10865121
1334 Ga0207658_10777149
1335 Ga0207677_10151552
1336 Ga0207677_10214585
1337 Ga0207703_10000016
1338 Ga0207703_10175762
1339 Ga0207703_11535229
1340 Ga0207639_10049281
1341 Ga0207639_10055041
1342 Ga0207639_10201894
1343 Ga0207678_10450132
1344 Ga0207708_10151714
1345 Ga0207708_10469332
1346 Ga0207708_10556536
1347 Ga0207708_11911729
1348 Ga0207702_10008417
1349 Ga0207702_10389013
1350 Ga0207702_10401951
1351 Ga0207702_10544953
1352 Ga0207702_11057843
1353 Ga0207702_11482552
1354 Ga0207641_10013042
1355 Ga0207641_10151541
1356 Ga0207641_10327294
1357 Ga0207648_10150354
1358 Ga0207648_10477289
1359 Ga0207648_10939041
1360 Ga0207648_11912551
1361 Ga0207674_10000004
1362 Ga0207674_10000538
1363 Ga0207674_10068364
1364 Ga0207675_100082983
1365 Ga0207675_100203728
1366 Ga0207675_100368467
1367 Ga0207683_10637478
1368 Ga0207698_10044113
1369 Ga0207698_10233366
1370 Ga0207698_10948562
1371 Ga0207698_11335913
1372 Ga0209967_1009693
1373 Ga0209984_1006926
1374 Ga0210000_1004085
1375 Ga0209995_1009081
1376 Ga0209968_1000365
1377 Ga0209999_1007392
1378 Ga0209970_1000402
1379 Ga0210002_1001954
1380 Ga0209983_1000217
1381 Ga0209971_1000093
1382 Ga0209966_1012168
1383 Ga0209998_10030563
1384 Ga0209998_10054927
1385 Ga0209974_10003052
1386 Ga0207428_10211579
1387 Ga0265354_1004184
1388 Ga0268266_10036092
1389 Ga0268266_10170641
1390 Ga0268265_11672917
1391 Ga0268264_10001058
1392 Ga0268264_10238233
1393 Ga0268264_10610691
1394 Ga0268264_11025416
1395 Ga0265338_10010392
1396 Ga0265338_10222144
1397 Ga0265338_10533440
1398 Ga0265766_1005588
1399 Ga0265765_1027452
1400 Ga0265760_10000487
1401 Ga0265330_10102203
1402 Ga0265328_10050014
1403 Ga0265340_10062456
1404 Ga0265340_10068281
1405 Ga0265339_10014999
1406 Ga0265331_10039899
1407 Ga0265316_10006992
1408 Ga0265316_10136738
1409 Ga0265313_10267746
1410 Ga0307516_10029044
1411 Ga0307516_10282175
1412 Ga0307516_10621443
1413 Ga0307407_10339667
1414 Ga0307416_100414991
1415 Ga0307416_102273390
1416 Ga0307507_10069639
1417 Ga0373926_0236828
1418 Ga0373928_0089091
1419 Ga0373944_0044955
1420 Ga0373949_0100430
1421 Ga0373932_0192615
1422 Ga0373936_0123708
1423 Ga0373936_0629581
1424 Ga0373941_0144456
1425 Ga0373941_0397337
1426 Ga0373960_0379090
1427 Ga0373943_0654105
1428 Ga0373942_0169086
1429 Ga0373961_0000533
1430 Ga0373962_0076193
1431 Ga0373931_0042823
1432 Ga0373931_0048809
1433 Ga0373935_0254422
1434 Ga0373927_0125546
1435 Ga0373933_0180045
1436 Ga0373947_0348037
1437 Ga0373937_0311555
1438 Ga0373937_1256587
1439 Ga0373937_1733651
1440 Ga0373925_0014221
1441 Ga0373925_0024909
1442 Ga0373925_0625114
1443 Ga0395898_1689576
1444 Ga0395901_0786133
1445 Ga0395901_0863257
1446 Ga0436365_0195783
1447 Ga0436360_0083929
1448 Ga0436361_0572145
1449 Ga0436361_0588872
1450 Ga0436363_1689408
1451 Ga0451789_0210512
1452 Ga0451798_0627138
1453 Ga0451802_1443065
1454 Ga0451804_1018234
1455 Ga0451807_0341991
1456 Ga0451807_1396474
1457 Ga0451807_1503261
1458 Ga0451837_0159427
1459 Ga0451839_0828414
1460 Ga0451845_0231071
1461 Ga0451851_0191838
1462 Ga0450923_119175
1463 Ga0453683_0525787
1464 Ga0453683_0603528
1465 Ga0453683_0735048
1466 Ga0453683_0994644
1467 Ga0466959_0021561
1468 Ga0451576_1544281
1469 Ga0495590_0241944
1470 Ga0495629_0572689
1471 Ga0495580_0004978
1472 Ga0495580_0054089
1473 Ga0495580_0286949
1474 Ga0495580_0319170
1475 Ga0495580_0323091
1476 Ga0495582_0362168
1477 Ga0495662_0202652
1478 Ga0495584_0471955
1479 Ga0495630_0430886
1480 Ga0495622_0440002
1481 Ga0495625_0709813
1482 Ga0495588_0156992
1483 Ga0495647_0367850
1484 Ga0495658_0366054
1485 Ga0495669_0050731
1486 Ga0495674_0611985
1487 Ga0495679_007880
1488 Ga0495684_0835885
1489 Ga0495602_0355761
1490 Ga0496100_0400077
1491 Ga0496101_0564309
1492 Ga0496102_0435243
1493 Ga0496102_0482247
1494 Ga0496102_1049568
1495 Ga0496102_1188426
1496 Ga0496104_0015667
1497 Ga0496104_0048827
1498 Ga0496104_0391259
1499 Ga0496104_0602895
1500 Ga0496105_0007070
1501 Ga0496105_0385043
1502 Ga0496105_0402482
1503 Ga0496106_0071513
1504 Ga0496112_0106760
1505 Ga0496112_0506114
1506 Ga0496112_0936063
1507 Ga0496112_1263248
1508 Ga0496112_1709681
1509 Ga0496113_0510562
1510 Ga0496114_0010012
1511 Ga0496114_1195156
1512 Ga0496115_0253271
1513 Ga0496115_0334732
1514 Ga0496126_0004663
1515 Ga0501031_0451086
1516 Ga0501032_0013843
1517 Ga0501033_0001381
1518 Ga0501034_0010860
1519 Ga0501034_0063663
1520 Ga0501036_0015321
1521 Ga0501037_0001442
1522 Ga0501037_0108402
1523 Ga0501038_0000650
1524 Ga0501038_0420616
1525 Ga0501038_0613143
1526 Ga0501039_0034194
1527 Ga0501039_0232351
1528 Ga0501040_0300068
1529 Ga0501040_1238176
1530 Ga0501041_0319603
1531 Ga0501041_0328686
1532 Ga0501042_0049884
1533 Ga0501042_0239097
1534 Ga0501043_0030948
1535 Ga0501043_0166807
1536 Ga0501043_0760390
1537 Ga0501046_0008656
1538 Ga0501046_0070640
1539 Ga0501046_0219959
1540 Ga0501047_0090196
1541 Ga0501047_0418510
1542 Ga0501048_0059953
1543 Ga0501048_0411752
1544 Ga0501068_0096308
1545 Ga0501068_0188494
1546 Ga0501069_1017229
1547 Ga0501070_0190773
1548 Ga0501071_0155711
1549 Ga0501071_0448657
1550 Ga0501072_0361704
1551 Ga0501072_1326502
1552 Ga0501073_0000637
1553 Ga0501073_0089078
1554 Ga0501073_0148370
1555 Ga0501073_1221011
1556 Ga0501074_0044381
1557 Ga0501074_0076755
1558 Ga0501074_0110242
1559 Ga0501074_0179777
1560 Ga0501074_0254397
1561 Ga0501075_0029309
1562 Ga0501075_0054932
1563 Ga0501075_0277778
1564 Ga0501075_0877184
1565 Ga0501076_0041284
1566 Ga0501076_0056658
1567 Ga0501076_0107874
1568 Ga0501076_0127017
1569 Ga0501076_0131135
1570 Ga0501076_0314351
1571 Ga0501077_0205579
1572 Ga0501207_062283
1573 Ga0501251_114527
1574 Ga0501079_0093240
1575 Ga0501079_0107580
1576 Ga0501079_0135195
1577 Ga0501080_0041536
1578 Ga0501080_0154061
1579 Ga0501080_0458400
1580 Ga0501081_0024194
1581 Ga0501081_0463185
1582 Ga0501083_0142637
1583 Ga0501083_0215030
1584 Ga0501035_0012190
1585 Ga0501035_0246596
1586 Ga0501035_0262065
1587 Ga0501044_0115941
1588 Ga0501044_0143576
1589 Ga0501044_0253843
1590 Ga0501045_0125815
1591 Ga0501045_0786086
1592 nmdc:mga06z11_420541_c1
1593 nmdc:mga07m45_50761_c1
1594 nmdc:mga05p37_211945_c2
1595 nmdc:mga05p37_315392_c1
1596 nmdc:mga05p37_568154_c1
1597 nmdc:mga05p37_572162_c1
1598 nmdc:mga09592_417864_c1
1599 nmdc:mga06r32_100238_c1
1600 nmdc:mga06r32_115446_c1
1601 nmdc:mga06r32_5033_c1
1602 nmdc:mga08y16_11570_c1
1603 nmdc:mga08y16_180517_c1
1604 nmdc:mga0n895_145872_c1
1605 nmdc:mga0n895_15956_c1
1606 nmdc:mga0n895_336207_c1
1607 nmdc:mga0n895_445691_c1
1608 nmdc:mga0n895_69024_c1
1609 nmdc:mga0rr50_119139_c1
1610 nmdc:mga0rr50_1431382_c1
1611 nmdc:mga0rr50_283672_c1
1612 nmdc:mga0rr50_375613_c1
1613 nmdc:mga0rr50_680_c1
1614 nmdc:mga0rr50_692352_c1
1615 nmdc:mga08x19_21707_c1
1616 nmdc:mga08x19_2406_c1
1617 nmdc:mga08x19_92134_c1
1618 nmdc:mga0a205_246179_c1
1619 nmdc:mga0a205_54542_c1
1620 nmdc:mga0a205_62938_c1
1621 Ga0495595_0085790
1622 Ga0500572_000823
1623 Ga0500595_024337
1624 Ga0500568_0001378
1625 Ga0500627_0208840
1626 Ga0501084_0114267
1627 Ga0501084_0185734
1628 Ga0501084_0900811
1629 Ga0501084_1869415
1630 Ga0501082_0000144
1631 Ga0501082_0028341
1632 Ga0501082_0197051
1633 Ga0501082_0266029
1634 Ga0530510_0195702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

11

74

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wv0-assembly3.cif.gz_E crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9596 4 76
4egz-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orr3 0.9596 12 74
5d4s-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orx1 0.9592 9 74
3eet-assembly2.cif.gz_B-3 crystal structure of putative gntr-family transcriptional regulator 0.9566 12 76
3eet-assembly1.cif.gz_A-2 crystal structure of putative gntr-family transcriptional regulator 0.9519 8 76
ID Description Score Start End Superfamily
2wv0E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9836 9 76 1.10.10.10
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9825 9 76 1.10.10.10
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9802 9 76 1.10.10.10
af_P13669_2_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9785 9 75 1.10.10.10
af_P39389_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9767 12 76 1.10.10.10
ID Description Score Start End GO Terms
AF-W1VN38-F1-model_v4 Putative transcriptional regulator 0.9897 1 89 GO:0003677
GO:0003700
AF-A0A2V5ZN81-F1-model_v4 HTH gntR-type domain-containing protein 0.9877 1 86 GO:0003677
GO:0003700
AF-A0A538NRQ1-F1-model_v4 GntR family transcriptional regulator 0.9863 4 113 GO:0003677
GO:0003700
AF-A0A534FE81-F1-model_v4 GntR family transcriptional regulator 0.9839 1 88 GO:0003677
GO:0003700
AF-A0A0D1HZ74-F1-model_v4 deleted 0.9802 12 75

Map