F482095
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 817 | 338 | 801 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300025937|Ga0207669_10290769|Ga0207669_102907692 |
| Length | 180 |
| Sequence | MTEEQKIIDEEGHFHAEDEVVDLSDTIAEGWIALGIFWVLGLTVFYQFVTRYVLNDSAAWTEEVARYMLIGVVFVGAAIGVSKNLMIQVDFFYRFMPPWRAVDVLRIAFFAAAVVMTVQMMIKIGNQTRMTIVDAPMNIVYGLCLFGFAAMCFRSVQVARVHWRRGYSILERPESSLIDN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 3 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 4 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 5 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 6 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 7 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 8 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 9 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 10 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 11 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 12 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 13 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 14 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 15 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 16 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 17 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 18 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 19 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 20 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 21 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 104 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 118 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 119 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 120 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 217 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 218 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 244 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 245 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 253 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 254 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 258 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 259 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 260 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 263 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 264 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 265 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 266 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 267 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 268 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 269 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 270 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 271 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 272 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 315 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 327 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 329 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 330 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 333 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 334 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 337 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 338 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.04 |
| Metatranscriptomes | 0 |
| Isolates | 1.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.81 |
| Nodule | 0.73 |
| Rhizoplane | 4.04 |
| Rhizosphere | 76.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000013 | 3300002705 | Bacteria | 189553 |
| 2 | JGI25154J39366_1000032 | 3300002738 | Bacteria | 189265 |
| 3 | JGI25157J39369_1000017 | 3300002741 | Bacteria | 189553 |
| 4 | JGI25150J39212_1006693 | 3300002774 | Bacteria | 2360 |
| 5 | JGI25150J39212_1008334 | 3300002774 | Bacteria | 2032 |
| 6 | JGI25150J39212_1014251 | 3300002774 | Bacteria | 1355 |
| 7 | JGI25159J45721_1004214 | 3300002987 | Bacteria | 4848 |
| 8 | JGI25159J45721_1006741 | 3300002987 | Bacteria | 3385 |
| 9 | JGI25151J46595_10008595 | 3300003187 | Bacteria | 4895 |
| 10 | JGI25151J46595_10026532 | 3300003187 | Bacteria | 2336 |
| 11 | rootL2_10093584 | 3300003322 | Bacteria | 1137 |
| 12 | JGI25160J50197_1000106 | 3300003354 | Bacteria | 80449 |
| 13 | JGI25161J50226_1000041 | 3300003374 | Bacteria | 124485 |
| 14 | Ga0055526_1006939 | 3300003771 | Bacteria | 6021 |
| 15 | Ga0055526_1006976 | 3300003771 | Bacteria | 5993 |
| 16 | Ga0055537_1000029 | 3300003773 | Bacteria | 101797 |
| 17 | Ga0055537_1000229 | 3300003773 | Bacteria | 41052 |
| 18 | Ga0055537_1008434 | 3300003773 | Bacteria | 2379 |
| 19 | Ga0055524_1000040 | 3300003775 | Bacteria | 157409 |
| 20 | Ga0055536_1003958 | 3300003781 | Bacteria | 7764 |
| 21 | Ga0055536_1005991 | 3300003781 | Bacteria | 5784 |
| 22 | Ga0055536_1028010 | 3300003781 | Bacteria | 1544 |
| 23 | Ga0055536_1037502 | 3300003781 | Bacteria | 1185 |
| 24 | Ga0055534_1000081 | 3300003784 | Bacteria | 75591 |
| 25 | Ga0055534_1001320 | 3300003784 | Bacteria | 9970 |
| 26 | Ga0055534_1004555 | 3300003784 | Bacteria | 3972 |
| 27 | Ga0055528_1000107 | 3300003790 | Bacteria | 67056 |
| 28 | Ga0055528_1003803 | 3300003790 | Bacteria | 7436 |
| 29 | Ga0055530_10000493 | 3300003791 | Bacteria | 34162 |
| 30 | Ga0055530_10076700 | 3300003791 | Bacteria | 710 |
| 31 | Ga0055540_1000030 | 3300003792 | Bacteria | 177871 |
| 32 | Ga0055540_1001837 | 3300003792 | Bacteria | 11979 |
| 33 | Ga0055540_1002684 | 3300003792 | Bacteria | 9173 |
| 34 | Ga0055531_10009620 | 3300003794 | Bacteria | 4920 |
| 35 | Ga0055543_1001200 | 3300004625 | Bacteria | 10901 |
| 36 | Ga0065165_1017710 | 3300005262 | Bacteria | 2612 |
| 37 | Ga0065165_1023849 | 3300005262 | Bacteria | 2066 |
| 38 | Ga0065165_1024861 | 3300005262 | Bacteria | 2003 |
| 39 | Ga0065165_1032070 | 3300005262 | Bacteria | 1652 |
| 40 | Ga0065165_1073283 | 3300005262 | Bacteria | 905 |
| 41 | Ga0065704_10083585 | 3300005289 | Bacteria | 3445 |
| 42 | Ga0065715_10021301 | 3300005293 | Bacteria | 1978 |
| 43 | Ga0065715_10176942 | 3300005293 | Bacteria | 1504 |
| 44 | Ga0070676_10049045 | 3300005328 | Bacteria | 2470 |
| 45 | Ga0070676_10381142 | 3300005328 | Bacteria | 976 |
| 46 | Ga0070683_100538148 | 3300005329 | Bacteria | 1117 |
| 47 | Ga0070690_100069129 | 3300005330 | Bacteria | 2291 |
| 48 | Ga0070670_100049162 | 3300005331 | Bacteria | 3626 |
| 49 | Ga0070670_100155929 | 3300005331 | Bacteria | 1977 |
| 50 | Ga0070670_100186040 | 3300005331 | Bacteria | 1803 |
| 51 | Ga0070670_100246589 | 3300005331 | Bacteria | 1555 |
| 52 | Ga0070670_100276301 | 3300005331 | Bacteria | 1466 |
| 53 | Ga0070670_100340987 | 3300005331 | Bacteria | 1315 |
| 54 | Ga0070670_100389658 | 3300005331 | Bacteria | 1228 |
| 55 | Ga0070670_100614428 | 3300005331 | Bacteria | 973 |
| 56 | Ga0070677_10029393 | 3300005333 | Bacteria | 2083 |
| 57 | Ga0070677_10031593 | 3300005333 | Bacteria | 2025 |
| 58 | Ga0070677_10052088 | 3300005333 | Bacteria | 1659 |
| 59 | Ga0070677_10075091 | 3300005333 | Bacteria | 1432 |
| 60 | Ga0070677_10108316 | 3300005333 | Bacteria | 1236 |
| 61 | Ga0068869_100005126 | 3300005334 | Bacteria | 8215 |
| 62 | Ga0070666_10007413 | 3300005335 | Bacteria | 6762 |
| 63 | Ga0070666_10134319 | 3300005335 | Bacteria | 1720 |
| 64 | Ga0070666_10236303 | 3300005335 | Bacteria | 1291 |
| 65 | Ga0070666_10500287 | 3300005335 | Bacteria | 881 |
| 66 | Ga0070680_100112248 | 3300005336 | Bacteria | 2270 |
| 67 | Ga0068868_100001955 | 3300005338 | Bacteria | 14135 |
| 68 | Ga0068868_100282015 | 3300005338 | Bacteria | 1406 |
| 69 | Ga0068868_100419487 | 3300005338 | Bacteria | 1158 |
| 70 | Ga0068868_100449658 | 3300005338 | Bacteria | 1120 |
| 71 | Ga0068868_100460577 | 3300005338 | Bacteria | 1107 |
| 72 | Ga0070660_100104911 | 3300005339 | Bacteria | 2242 |
| 73 | Ga0070660_100222446 | 3300005339 | Bacteria | 1534 |
| 74 | Ga0070687_100020504 | 3300005343 | Bacteria | 3092 |
| 75 | Ga0070687_100165126 | 3300005343 | Bacteria | 1312 |
| 76 | Ga0070661_100236750 | 3300005344 | Bacteria | 1404 |
| 77 | Ga0070692_10443012 | 3300005345 | Bacteria | 830 |
| 78 | Ga0070668_100003555 | 3300005347 | Bacteria | 11496 |
| 79 | Ga0070668_100212306 | 3300005347 | Bacteria | 1593 |
| 80 | Ga0070668_100289407 | 3300005347 | Bacteria | 1371 |
| 81 | Ga0070668_100838589 | 3300005347 | Bacteria | 818 |
| 82 | Ga0070669_100017475 | 3300005353 | Bacteria | 5115 |
| 83 | Ga0070669_100031658 | 3300005353 | Bacteria | 3821 |
| 84 | Ga0070669_100060905 | 3300005353 | Bacteria | 2773 |
| 85 | Ga0070669_100789470 | 3300005353 | Bacteria | 806 |
| 86 | Ga0070669_100862666 | 3300005353 | Bacteria | 772 |
| 87 | Ga0070675_100005320 | 3300005354 | Bacteria | 9835 |
| 88 | Ga0070675_100061363 | 3300005354 | Bacteria | 3104 |
| 89 | Ga0070675_100159556 | 3300005354 | Bacteria | 1938 |
| 90 | Ga0070675_100161306 | 3300005354 | Bacteria | 1928 |
| 91 | Ga0070675_100203777 | 3300005354 | Bacteria | 1717 |
| 92 | Ga0070671_100006632 | 3300005355 | Bacteria | 9251 |
| 93 | Ga0070671_100043326 | 3300005355 | Bacteria | 3740 |
| 94 | Ga0070671_100069616 | 3300005355 | Bacteria | 2935 |
| 95 | Ga0070671_100281114 | 3300005355 | Bacteria | 1415 |
| 96 | Ga0070671_101193515 | 3300005355 | Bacteria | 670 |
| 97 | Ga0070674_100018239 | 3300005356 | Bacteria | 4433 |
| 98 | Ga0070674_100070201 | 3300005356 | Bacteria | 2474 |
| 99 | Ga0070674_100140602 | 3300005356 | Bacteria | 1811 |
| 100 | Ga0070674_100284602 | 3300005356 | Bacteria | 1312 |
| 101 | Ga0070673_100029782 | 3300005364 | Bacteria | 4075 |
| 102 | Ga0070673_100243919 | 3300005364 | Bacteria | 1563 |
| 103 | Ga0070673_100799803 | 3300005364 | Bacteria | 871 |
| 104 | Ga0070673_100967278 | 3300005364 | Bacteria | 791 |
| 105 | Ga0070688_100082736 | 3300005365 | Bacteria | 2081 |
| 106 | Ga0070659_100135367 | 3300005366 | Bacteria | 2003 |
| 107 | Ga0070659_100193210 | 3300005366 | Bacteria | 1673 |
| 108 | Ga0070659_100717292 | 3300005366 | Bacteria | 866 |
| 109 | Ga0070667_100018788 | 3300005367 | Bacteria | 5732 |
| 110 | Ga0070667_100036122 | 3300005367 | Bacteria | 4142 |
| 111 | Ga0070667_100038123 | 3300005367 | Bacteria | 4029 |
| 112 | Ga0070667_100478037 | 3300005367 | Bacteria | 1140 |
| 113 | Ga0070667_100557582 | 3300005367 | Bacteria | 1053 |
| 114 | Ga0070667_100606696 | 3300005367 | Bacteria | 1009 |
| 115 | Ga0070701_10167625 | 3300005438 | Bacteria | 1277 |
| 116 | Ga0070663_100169733 | 3300005455 | Bacteria | 1685 |
| 117 | Ga0070663_100497756 | 3300005455 | Bacteria | 1011 |
| 118 | Ga0070678_100048400 | 3300005456 | Bacteria | 3061 |
| 119 | Ga0070678_100053734 | 3300005456 | Bacteria | 2931 |
| 120 | Ga0070678_100075327 | 3300005456 | Bacteria | 2538 |
| 121 | Ga0070678_100169802 | 3300005456 | Bacteria | 1775 |
| 122 | Ga0070678_100229311 | 3300005456 | Bacteria | 1547 |
| 123 | Ga0070678_100441314 | 3300005456 | Bacteria | 1138 |
| 124 | Ga0070678_100806755 | 3300005456 | Bacteria | 852 |
| 125 | Ga0070662_100012157 | 3300005457 | Bacteria | 5700 |
| 126 | Ga0070662_100023662 | 3300005457 | Bacteria | 4222 |
| 127 | Ga0070662_100047737 | 3300005457 | Bacteria | 3081 |
| 128 | Ga0070662_100091956 | 3300005457 | Bacteria | 2279 |
| 129 | Ga0070662_100450243 | 3300005457 | Bacteria | 1068 |
| 130 | Ga0070681_10130574 | 3300005458 | Bacteria | 2444 |
| 131 | Ga0068867_100033665 | 3300005459 | Bacteria | 3712 |
| 132 | Ga0068867_100218580 | 3300005459 | Bacteria | 1534 |
| 133 | Ga0068867_100218856 | 3300005459 | Bacteria | 1533 |
| 134 | Ga0068867_100450506 | 3300005459 | Bacteria | 1096 |
| 135 | Ga0068867_100535071 | 3300005459 | Bacteria | 1012 |
| 136 | Ga0068867_101136767 | 3300005459 | Bacteria | 714 |
| 137 | Ga0070685_10092534 | 3300005466 | Bacteria | 1832 |
| 138 | Ga0070685_10480390 | 3300005466 | Bacteria | 876 |
| 139 | Ga0070679_100010948 | 3300005530 | Bacteria | 8620 |
| 140 | Ga0070679_100349390 | 3300005530 | Bacteria | 1427 |
| 141 | Ga0070684_100019585 | 3300005535 | Bacteria | 5600 |
| 142 | Ga0070684_100404076 | 3300005535 | Bacteria | 1259 |
| 143 | Ga0068853_100046393 | 3300005539 | Bacteria | 3725 |
| 144 | Ga0068853_100311331 | 3300005539 | Bacteria | 1458 |
| 145 | Ga0068853_100441130 | 3300005539 | Bacteria | 1223 |
| 146 | Ga0068853_100501800 | 3300005539 | Bacteria | 1145 |
| 147 | Ga0068853_100947748 | 3300005539 | Bacteria | 827 |
| 148 | Ga0070672_100020940 | 3300005543 | Bacteria | 4779 |
| 149 | Ga0070672_100060460 | 3300005543 | Bacteria | 2983 |
| 150 | Ga0070672_100086261 | 3300005543 | Bacteria | 2524 |
| 151 | Ga0070672_100153963 | 3300005543 | Bacteria | 1903 |
| 152 | Ga0070672_100217852 | 3300005543 | Bacteria | 1600 |
| 153 | Ga0070672_100254895 | 3300005543 | Bacteria | 1478 |
| 154 | Ga0070672_100294887 | 3300005543 | Bacteria | 1373 |
| 155 | Ga0070672_100356649 | 3300005543 | Bacteria | 1247 |
| 156 | Ga0070672_100540988 | 3300005543 | Bacteria | 1010 |
| 157 | Ga0070672_100694902 | 3300005543 | Bacteria | 890 |
| 158 | Ga0070686_100087148 | 3300005544 | Bacteria | 2081 |
| 159 | Ga0068855_100039058 | 3300005563 | Bacteria | 5636 |
| 160 | Ga0070664_100160693 | 3300005564 | Bacteria | 1987 |
| 161 | Ga0070664_100174782 | 3300005564 | Bacteria | 1906 |
| 162 | Ga0070664_100418007 | 3300005564 | Bacteria | 1228 |
| 163 | Ga0070664_100419519 | 3300005564 | Bacteria | 1225 |
| 164 | Ga0070664_100558804 | 3300005564 | Bacteria | 1059 |
| 165 | Ga0068857_100174217 | 3300005577 | Bacteria | 1956 |
| 166 | Ga0068854_100190261 | 3300005578 | Bacteria | 1608 |
| 167 | Ga0068854_100246187 | 3300005578 | Bacteria | 1425 |
| 168 | Ga0068856_100083350 | 3300005614 | Bacteria | 3174 |
| 169 | Ga0068856_100828582 | 3300005614 | Bacteria | 944 |
| 170 | Ga0070702_100553015 | 3300005615 | Bacteria | 855 |
| 171 | Ga0068852_100179606 | 3300005616 | Bacteria | 1989 |
| 172 | Ga0068852_100202806 | 3300005616 | Bacteria | 1877 |
| 173 | Ga0068852_100226474 | 3300005616 | Bacteria | 1780 |
| 174 | Ga0068852_100457566 | 3300005616 | Bacteria | 1264 |
| 175 | Ga0068852_100761867 | 3300005616 | Bacteria | 980 |
| 176 | Ga0068852_100807435 | 3300005616 | Bacteria | 952 |
| 177 | Ga0068852_100860374 | 3300005616 | Bacteria | 922 |
| 178 | Ga0068852_100925284 | 3300005616 | Bacteria | 889 |
| 179 | Ga0068852_101039117 | 3300005616 | Bacteria | 838 |
| 180 | Ga0068859_100004027 | 3300005617 | Bacteria | 14982 |
| 181 | Ga0068859_100068114 | 3300005617 | Bacteria | 3594 |
| 182 | Ga0068864_100009938 | 3300005618 | Bacteria | 7848 |
| 183 | Ga0068864_100083775 | 3300005618 | Bacteria | 2800 |
| 184 | Ga0068864_100126759 | 3300005618 | Bacteria | 2288 |
| 185 | Ga0068864_100161904 | 3300005618 | Bacteria | 2034 |
| 186 | Ga0068864_100299406 | 3300005618 | Bacteria | 1505 |
| 187 | Ga0068864_100843530 | 3300005618 | Bacteria | 902 |
| 188 | Ga0068866_10063423 | 3300005718 | Bacteria | 1926 |
| 189 | Ga0068866_10131381 | 3300005718 | Bacteria | 1425 |
| 190 | Ga0068861_100011946 | 3300005719 | Bacteria | 6048 |
| 191 | Ga0068861_100059976 | 3300005719 | Bacteria | 2914 |
| 192 | Ga0068861_100067050 | 3300005719 | Bacteria | 2768 |
| 193 | Ga0068861_100173149 | 3300005719 | Bacteria | 1790 |
| 194 | Ga0068861_100443501 | 3300005719 | Bacteria | 1161 |
| 195 | Ga0068851_10087079 | 3300005834 | Bacteria | 1640 |
| 196 | Ga0068851_10169368 | 3300005834 | Bacteria | 1204 |
| 197 | Ga0068851_10299336 | 3300005834 | Bacteria | 924 |
| 198 | Ga0068870_10252066 | 3300005840 | Bacteria | 1095 |
| 199 | Ga0068870_10349408 | 3300005840 | Bacteria | 948 |
| 200 | Ga0068863_100003466 | 3300005841 | Bacteria | 15562 |
| 201 | Ga0068863_100004155 | 3300005841 | Bacteria | 14296 |
| 202 | Ga0068863_100071438 | 3300005841 | Bacteria | 3283 |
| 203 | Ga0068863_100167627 | 3300005841 | Bacteria | 2106 |
| 204 | Ga0068863_100262952 | 3300005841 | Bacteria | 1668 |
| 205 | Ga0068863_100379684 | 3300005841 | Bacteria | 1380 |
| 206 | Ga0068863_100504607 | 3300005841 | Bacteria | 1191 |
| 207 | Ga0068863_100725874 | 3300005841 | Bacteria | 988 |
| 208 | Ga0068858_100002678 | 3300005842 | Bacteria | 17932 |
| 209 | Ga0068858_100004898 | 3300005842 | Bacteria | 13122 |
| 210 | Ga0068858_100127377 | 3300005842 | Bacteria | 2385 |
| 211 | Ga0068860_100005443 | 3300005843 | Bacteria | 12906 |
| 212 | Ga0068860_100033915 | 3300005843 | Bacteria | 4897 |
| 213 | Ga0068860_100221249 | 3300005843 | Bacteria | 1838 |
| 214 | Ga0068860_100760658 | 3300005843 | Bacteria | 981 |
| 215 | Ga0068862_100107966 | 3300005844 | Bacteria | 2440 |
| 216 | Ga0068862_100240628 | 3300005844 | Bacteria | 1645 |
| 217 | Ga0075363_100010846 | 3300006048 | Bacteria | 4346 |
| 218 | Ga0075363_100110179 | 3300006048 | Bacteria | 1530 |
| 219 | Ga0075364_10064338 | 3300006051 | Bacteria | 2407 |
| 220 | Ga0075364_10079127 | 3300006051 | Bacteria | 2172 |
| 221 | Ga0075432_10044377 | 3300006058 | Bacteria | 1559 |
| 222 | Ga0075362_10007059 | 3300006177 | Bacteria | 4224 |
| 223 | Ga0075362_10216834 | 3300006177 | Bacteria | 934 |
| 224 | Ga0075367_10092734 | 3300006178 | Bacteria | 1839 |
| 225 | Ga0075366_10001983 | 3300006195 | Bacteria | 10365 |
| 226 | Ga0075366_10512295 | 3300006195 | Bacteria | 742 |
| 227 | Ga0097621_100055088 | 3300006237 | Bacteria | 3246 |
| 228 | Ga0097621_100061406 | 3300006237 | Bacteria | 3082 |
| 229 | Ga0097621_100117798 | 3300006237 | Bacteria | 2251 |
| 230 | Ga0097621_100476730 | 3300006237 | Bacteria | 1127 |
| 231 | Ga0097621_100649944 | 3300006237 | Bacteria | 967 |
| 232 | Ga0097621_100891985 | 3300006237 | Bacteria | 828 |
| 233 | Ga0097621_101006728 | 3300006237 | Bacteria | 780 |
| 234 | Ga0097621_101049719 | 3300006237 | Bacteria | 764 |
| 235 | Ga0075370_10010702 | 3300006353 | Bacteria | 4808 |
| 236 | Ga0075370_10231396 | 3300006353 | Bacteria | 1094 |
| 237 | Ga0068871_100040497 | 3300006358 | Bacteria | 3732 |
| 238 | Ga0068871_100078417 | 3300006358 | Bacteria | 2731 |
| 239 | Ga0068871_100143643 | 3300006358 | Bacteria | 2031 |
| 240 | Ga0068871_100226512 | 3300006358 | Bacteria | 1621 |
| 241 | Ga0068871_100489330 | 3300006358 | Bacteria | 1107 |
| 242 | Ga0068871_100520155 | 3300006358 | Bacteria | 1074 |
| 243 | Ga0075430_100009841 | 3300006846 | Bacteria | 8087 |
| 244 | Ga0075429_100003178 | 3300006880 | Bacteria | 13964 |
| 245 | Ga0075429_101371786 | 3300006880 | Bacteria | 616 |
| 246 | Ga0068865_100017528 | 3300006881 | Bacteria | 4607 |
| 247 | Ga0068865_100520592 | 3300006881 | Bacteria | 994 |
| 248 | Ga0068865_100880386 | 3300006881 | Bacteria | 777 |
| 249 | Ga0097620_100004027 | 3300006931 | Bacteria | 14982 |
| 250 | Ga0097620_100068114 | 3300006931 | Bacteria | 3594 |
| 251 | Ga0079104_1011880 | 3300006946 | Bacteria | 2770 |
| 252 | Ga0099826_10000087 | 3300006948 | Bacteria | 46364 |
| 253 | Ga0099826_10073699 | 3300006948 | Bacteria | 2156 |
| 254 | Ga0099826_10106542 | 3300006948 | Bacteria | 1680 |
| 255 | Ga0105250_10099215 | 3300009092 | Bacteria | 1188 |
| 256 | Ga0105240_11660554 | 3300009093 | Bacteria | 668 |
| 257 | Ga0111539_11389437 | 3300009094 | Bacteria | 814 |
| 258 | Ga0105245_10380447 | 3300009098 | Bacteria | 1406 |
| 259 | Ga0105245_11357543 | 3300009098 | Bacteria | 760 |
| 260 | Ga0105243_10068322 | 3300009148 | Bacteria | 2864 |
| 261 | Ga0105242_10210395 | 3300009176 | Bacteria | 1733 |
| 262 | Ga0105242_10369020 | 3300009176 | Bacteria | 1331 |
| 263 | Ga0105242_10427266 | 3300009176 | Bacteria | 1243 |
| 264 | Ga0105242_10704672 | 3300009176 | Bacteria | 988 |
| 265 | Ga0105248_10051302 | 3300009177 | Bacteria | 4629 |
| 266 | Ga0105248_10128074 | 3300009177 | Bacteria | 2864 |
| 267 | Ga0105248_10234103 | 3300009177 | Bacteria | 2068 |
| 268 | Ga0105248_10239358 | 3300009177 | Bacteria | 2043 |
| 269 | Ga0105248_10274624 | 3300009177 | Bacteria | 1898 |
| 270 | Ga0105248_10895276 | 3300009177 | Bacteria | 1002 |
| 271 | Ga0105248_11022284 | 3300009177 | Bacteria | 934 |
| 272 | Ga0105248_11090375 | 3300009177 | Bacteria | 902 |
| 273 | Ga0105248_11137738 | 3300009177 | Bacteria | 882 |
| 274 | Ga0105237_10060033 | 3300009545 | Bacteria | 3804 |
| 275 | Ga0105238_10188351 | 3300009551 | Bacteria | 2040 |
| 276 | Ga0105238_10768242 | 3300009551 | Bacteria | 978 |
| 277 | Ga0105238_11194564 | 3300009551 | Bacteria | 785 |
| 278 | Ga0105249_10017865 | 3300009553 | Bacteria | 6302 |
| 279 | Ga0105249_10050443 | 3300009553 | Bacteria | 3794 |
| 280 | Ga0105249_10753312 | 3300009553 | Bacteria | 1036 |
| 281 | Ga0105239_10066299 | 3300010375 | Bacteria | 3966 |
| 282 | Ga0105246_10524362 | 3300011119 | Bacteria | 1010 |
| 283 | Ga0157323_1002135 | 3300012495 | Bacteria | 1071 |
| 284 | Ga0157347_1000221 | 3300012502 | Bacteria | 3270 |
| 285 | Ga0157327_1000947 | 3300012512 | Bacteria | 1713 |
| 286 | Ga0157326_1000451 | 3300012513 | Bacteria | 4870 |
| 287 | Ga0157373_10199882 | 3300013100 | Bacteria | 1409 |
| 288 | Ga0157371_10554873 | 3300013102 | Bacteria | 852 |
| 289 | Ga0157370_10003845 | 3300013104 | Bacteria | 17512 |
| 290 | Ga0157370_10188740 | 3300013104 | Bacteria | 1913 |
| 291 | Ga0157370_10912150 | 3300013104 | Bacteria | 797 |
| 292 | Ga0157370_10998864 | 3300013104 | Bacteria | 757 |
| 293 | Ga0157369_10166440 | 3300013105 | Bacteria | 2325 |
| 294 | Ga0157369_11133031 | 3300013105 | Bacteria | 799 |
| 295 | Ga0157374_10037741 | 3300013296 | Bacteria | 4437 |
| 296 | Ga0157374_10100494 | 3300013296 | Bacteria | 2773 |
| 297 | Ga0157374_10401056 | 3300013296 | Bacteria | 1368 |
| 298 | Ga0157374_10992622 | 3300013296 | Bacteria | 859 |
| 299 | Ga0157374_11422602 | 3300013296 | Bacteria | 716 |
| 300 | Ga0157378_10397636 | 3300013297 | Bacteria | 1357 |
| 301 | Ga0157378_10664449 | 3300013297 | Bacteria | 1059 |
| 302 | Ga0157378_10832512 | 3300013297 | Bacteria | 950 |
| 303 | Ga0163162_10038435 | 3300013306 | Bacteria | 4776 |
| 304 | Ga0163162_10106194 | 3300013306 | Bacteria | 2903 |
| 305 | Ga0163162_10222435 | 3300013306 | Bacteria | 2017 |
| 306 | Ga0163162_10254580 | 3300013306 | Bacteria | 1888 |
| 307 | Ga0163162_10339447 | 3300013306 | Bacteria | 1635 |
| 308 | Ga0163162_10568379 | 3300013306 | Bacteria | 1261 |
| 309 | Ga0163162_10688500 | 3300013306 | Bacteria | 1144 |
| 310 | Ga0163162_10758646 | 3300013306 | Bacteria | 1089 |
| 311 | Ga0157372_10355864 | 3300013307 | Bacteria | 1706 |
| 312 | Ga0157372_10995705 | 3300013307 | Bacteria | 971 |
| 313 | Ga0157375_10125411 | 3300013308 | Bacteria | 2682 |
| 314 | Ga0157375_10171764 | 3300013308 | Bacteria | 2316 |
| 315 | Ga0157375_10312197 | 3300013308 | Bacteria | 1737 |
| 316 | Ga0157375_10702613 | 3300013308 | Bacteria | 1165 |
| 317 | Ga0157375_10736169 | 3300013308 | Bacteria | 1138 |
| 318 | Ga0157375_10759448 | 3300013308 | Bacteria | 1120 |
| 319 | Ga0157375_10763925 | 3300013308 | Bacteria | 1117 |
| 320 | Ga0163163_10016809 | 3300014325 | Bacteria | 6810 |
| 321 | Ga0163163_10704698 | 3300014325 | Bacteria | 1073 |
| 322 | Ga0157380_10019496 | 3300014326 | Bacteria | 5055 |
| 323 | Ga0157380_10019525 | 3300014326 | Bacteria | 5051 |
| 324 | Ga0157380_10111348 | 3300014326 | Bacteria | 2301 |
| 325 | Ga0157380_10176244 | 3300014326 | Bacteria | 1874 |
| 326 | Ga0157380_10218221 | 3300014326 | Bacteria | 1705 |
| 327 | Ga0182008_10008214 | 3300014497 | Bacteria | 5711 |
| 328 | Ga0182008_10119643 | 3300014497 | Bacteria | 1309 |
| 329 | Ga0157377_10012265 | 3300014745 | Bacteria | 4304 |
| 330 | Ga0157377_10197256 | 3300014745 | Bacteria | 1276 |
| 331 | Ga0157379_10318866 | 3300014968 | Bacteria | 1419 |
| 332 | Ga0157379_10398164 | 3300014968 | Bacteria | 1265 |
| 333 | Ga0157376_10103751 | 3300014969 | Bacteria | 2490 |
| 334 | Ga0157376_10120479 | 3300014969 | Bacteria | 2324 |
| 335 | Ga0157376_10257822 | 3300014969 | Bacteria | 1632 |
| 336 | Ga0157376_10830816 | 3300014969 | Bacteria | 938 |
| 337 | Ga0182006_1017723 | 3300015261 | Bacteria | 3020 |
| 338 | Ga0182006_1079020 | 3300015261 | Bacteria | 1203 |
| 339 | Ga0182007_10021566 | 3300015262 | Bacteria | 2286 |
| 340 | Ga0163161_10000329 | 3300017792 | Bacteria | 40476 |
| 341 | Ga0163161_10013701 | 3300017792 | Bacteria | 5646 |
| 342 | Ga0163161_10053805 | 3300017792 | Bacteria | 2920 |
| 343 | Ga0163161_10321025 | 3300017792 | Bacteria | 1224 |
| 344 | Ga0163161_10362833 | 3300017792 | Bacteria | 1154 |
| 345 | Ga0163161_11166137 | 3300017792 | Bacteria | 665 |
| 346 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 347 | Ga0209436_105046 | 3300025208 | Bacteria | 3126 |
| 348 | Ga0207425_1001243 | 3300025245 | Bacteria | 11182 |
| 349 | Ga0207425_1007648 | 3300025245 | Bacteria | 2831 |
| 350 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 351 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 352 | Ga0209759_1000026 | 3300025256 | Bacteria | 311743 |
| 353 | Ga0209129_1007409 | 3300025258 | Bacteria | 3276 |
| 354 | Ga0209129_1032236 | 3300025258 | Bacteria | 867 |
| 355 | Ga0209565_1000026 | 3300025263 | Bacteria | 365910 |
| 356 | Ga0209565_1000150 | 3300025263 | Bacteria | 94073 |
| 357 | Ga0209565_1001312 | 3300025263 | Bacteria | 11421 |
| 358 | Ga0209565_1061899 | 3300025263 | Bacteria | 647 |
| 359 | Ga0207666_1001766 | 3300025271 | Bacteria | 2567 |
| 360 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 361 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 362 | Ga0209673_1000114 | 3300025273 | Bacteria | 178557 |
| 363 | Ga0209673_1008634 | 3300025273 | Bacteria | 4514 |
| 364 | Ga0209673_1066189 | 3300025273 | Bacteria | 879 |
| 365 | Ga0209130_1000099 | 3300025284 | Bacteria | 141717 |
| 366 | Ga0209130_1000123 | 3300025284 | Bacteria | 125840 |
| 367 | Ga0209130_1006153 | 3300025284 | Bacteria | 3960 |
| 368 | Ga0209675_1000062 | 3300025291 | Bacteria | 178557 |
| 369 | Ga0209675_1000155 | 3300025291 | Bacteria | 89020 |
| 370 | Ga0209675_1004791 | 3300025291 | Bacteria | 5878 |
| 371 | Ga0209675_1005864 | 3300025291 | Bacteria | 5045 |
| 372 | Ga0209676_1000051 | 3300025292 | Bacteria | 389016 |
| 373 | Ga0209676_1000325 | 3300025292 | Bacteria | 91840 |
| 374 | Ga0209676_1008862 | 3300025292 | Bacteria | 4423 |
| 375 | Ga0209025_1004061 | 3300025294 | Bacteria | 13090 |
| 376 | Ga0209025_1007738 | 3300025294 | Bacteria | 7920 |
| 377 | Ga0209025_1009286 | 3300025294 | Bacteria | 6885 |
| 378 | Ga0209025_1016364 | 3300025294 | Bacteria | 4384 |
| 379 | Ga0209564_1000211 | 3300025295 | Bacteria | 133277 |
| 380 | Ga0209564_1000228 | 3300025295 | Bacteria | 125206 |
| 381 | Ga0209564_1004815 | 3300025295 | Bacteria | 8037 |
| 382 | Ga0209758_1083564 | 3300025297 | Bacteria | 957 |
| 383 | Ga0209050_1000044 | 3300025298 | Bacteria | 391114 |
| 384 | Ga0209050_1003950 | 3300025298 | Bacteria | 10477 |
| 385 | Ga0209050_1010312 | 3300025298 | Bacteria | 4620 |
| 386 | Ga0209050_1038509 | 3300025298 | Bacteria | 1362 |
| 387 | Ga0209050_1057750 | 3300025298 | Bacteria | 936 |
| 388 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 389 | Ga0209256_1025111 | 3300025299 | Bacteria | 1742 |
| 390 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 391 | Ga0209051_1000031 | 3300025303 | Bacteria | 391114 |
| 392 | Ga0209051_1000208 | 3300025303 | Bacteria | 102967 |
| 393 | Ga0209051_1000760 | 3300025303 | Bacteria | 34370 |
| 394 | Ga0209051_1060818 | 3300025303 | Bacteria | 1190 |
| 395 | Ga0209257_1000058 | 3300025304 | Bacteria | 381686 |
| 396 | Ga0209257_1008393 | 3300025304 | Bacteria | 5887 |
| 397 | Ga0209257_1013462 | 3300025304 | Bacteria | 3633 |
| 398 | Ga0207697_10032926 | 3300025315 | Bacteria | 2122 |
| 399 | Ga0207697_10241147 | 3300025315 | Bacteria | 799 |
| 400 | Ga0207697_10255735 | 3300025315 | Bacteria | 775 |
| 401 | Ga0207656_10062842 | 3300025321 | Bacteria | 1633 |
| 402 | Ga0207656_10180936 | 3300025321 | Bacteria | 1012 |
| 403 | Ga0207682_10009146 | 3300025893 | Bacteria | 3914 |
| 404 | Ga0207682_10038424 | 3300025893 | Bacteria | 1942 |
| 405 | Ga0207682_10061961 | 3300025893 | Bacteria | 1567 |
| 406 | Ga0207682_10154994 | 3300025893 | Bacteria | 1035 |
| 407 | Ga0207682_10286553 | 3300025893 | Bacteria | 771 |
| 408 | Ga0207642_10015639 | 3300025899 | Bacteria | 2834 |
| 409 | Ga0207642_10067435 | 3300025899 | Bacteria | 1689 |
| 410 | Ga0207688_10033243 | 3300025901 | Bacteria | 2852 |
| 411 | Ga0207688_10148393 | 3300025901 | Bacteria | 1384 |
| 412 | Ga0207688_10234204 | 3300025901 | Bacteria | 1109 |
| 413 | Ga0207680_10023828 | 3300025903 | Bacteria | 3349 |
| 414 | Ga0207680_10363368 | 3300025903 | Bacteria | 1018 |
| 415 | Ga0207680_10719171 | 3300025903 | Bacteria | 716 |
| 416 | Ga0207645_10007091 | 3300025907 | Bacteria | 7965 |
| 417 | Ga0207645_10027206 | 3300025907 | Bacteria | 3694 |
| 418 | Ga0207645_10202394 | 3300025907 | Bacteria | 1306 |
| 419 | Ga0207645_10401707 | 3300025907 | Bacteria | 922 |
| 420 | Ga0207643_10445085 | 3300025908 | Bacteria | 824 |
| 421 | Ga0207707_10208990 | 3300025912 | Bacteria | 1701 |
| 422 | Ga0207671_10162669 | 3300025914 | Bacteria | 1729 |
| 423 | Ga0207660_10007738 | 3300025917 | Bacteria | 6956 |
| 424 | Ga0207662_10036429 | 3300025918 | Bacteria | 2875 |
| 425 | Ga0207662_10063557 | 3300025918 | Bacteria | 2220 |
| 426 | Ga0207662_10325602 | 3300025918 | Bacteria | 1027 |
| 427 | Ga0207649_10450638 | 3300025920 | Bacteria | 971 |
| 428 | Ga0207649_11110007 | 3300025920 | Bacteria | 624 |
| 429 | Ga0207652_10005260 | 3300025921 | Bacteria | 10509 |
| 430 | Ga0207681_10007401 | 3300025923 | Bacteria | 6721 |
| 431 | Ga0207681_10018416 | 3300025923 | Bacteria | 4400 |
| 432 | Ga0207681_10043750 | 3300025923 | Bacteria | 2998 |
| 433 | Ga0207681_10402397 | 3300025923 | Bacteria | 1106 |
| 434 | Ga0207681_10465468 | 3300025923 | Bacteria | 1030 |
| 435 | Ga0207694_10076303 | 3300025924 | Bacteria | 2625 |
| 436 | Ga0207650_10023527 | 3300025925 | Bacteria | 4369 |
| 437 | Ga0207650_10069686 | 3300025925 | Bacteria | 2642 |
| 438 | Ga0207650_10178246 | 3300025925 | Bacteria | 1692 |
| 439 | Ga0207650_10189625 | 3300025925 | Bacteria | 1642 |
| 440 | Ga0207650_10254052 | 3300025925 | Bacteria | 1424 |
| 441 | Ga0207650_10357721 | 3300025925 | Bacteria | 1202 |
| 442 | Ga0207650_10442076 | 3300025925 | Bacteria | 1081 |
| 443 | Ga0207650_10507514 | 3300025925 | Bacteria | 1008 |
| 444 | Ga0207650_10572600 | 3300025925 | Bacteria | 948 |
| 445 | Ga0207659_10007169 | 3300025926 | Bacteria | 6843 |
| 446 | Ga0207659_10020490 | 3300025926 | Bacteria | 4372 |
| 447 | Ga0207659_10138499 | 3300025926 | Bacteria | 1887 |
| 448 | Ga0207659_10260594 | 3300025926 | Bacteria | 1410 |
| 449 | Ga0207659_10504640 | 3300025926 | Bacteria | 1024 |
| 450 | Ga0207659_10693881 | 3300025926 | Bacteria | 871 |
| 451 | Ga0207687_10231983 | 3300025927 | Bacteria | 1458 |
| 452 | Ga0207687_10241112 | 3300025927 | Bacteria | 1433 |
| 453 | Ga0207644_10000068 | 3300025931 | Bacteria | 76090 |
| 454 | Ga0207644_10015661 | 3300025931 | Bacteria | 5094 |
| 455 | Ga0207690_10095883 | 3300025932 | Bacteria | 2108 |
| 456 | Ga0207690_10503538 | 3300025932 | Bacteria | 980 |
| 457 | Ga0207706_10045478 | 3300025933 | Bacteria | 3889 |
| 458 | Ga0207706_10152950 | 3300025933 | Bacteria | 2029 |
| 459 | Ga0207706_10206870 | 3300025933 | Bacteria | 1721 |
| 460 | Ga0207706_10259144 | 3300025933 | Bacteria | 1518 |
| 461 | Ga0207706_10661657 | 3300025933 | Bacteria | 894 |
| 462 | Ga0207686_10071853 | 3300025934 | Bacteria | 2228 |
| 463 | Ga0207686_10155738 | 3300025934 | Bacteria | 1596 |
| 464 | Ga0207686_10201916 | 3300025934 | Bacteria | 1424 |
| 465 | Ga0207709_10021397 | 3300025935 | Bacteria | 3661 |
| 466 | Ga0207709_10120378 | 3300025935 | Bacteria | 1771 |
| 467 | Ga0207670_11063869 | 3300025936 | Bacteria | 682 |
| 468 | Ga0207669_10026733 | 3300025937 | Bacteria | 3145 |
| 469 | Ga0207669_10186688 | 3300025937 | Bacteria | 1491 |
| 470 | Ga0207669_10290769 | 3300025937 | Bacteria | 1237 |
| 471 | Ga0207669_10515161 | 3300025937 | Bacteria | 959 |
| 472 | Ga0207704_10217717 | 3300025938 | Bacteria | 1410 |
| 473 | Ga0207704_10516559 | 3300025938 | Bacteria | 965 |
| 474 | Ga0207704_10973238 | 3300025938 | Bacteria | 717 |
| 475 | Ga0207665_10062982 | 3300025939 | Bacteria | 2518 |
| 476 | Ga0207691_10017865 | 3300025940 | Bacteria | 6721 |
| 477 | Ga0207691_10038713 | 3300025940 | Bacteria | 4412 |
| 478 | Ga0207691_10168616 | 3300025940 | Bacteria | 1918 |
| 479 | Ga0207691_10196626 | 3300025940 | Bacteria | 1756 |
| 480 | Ga0207691_10204227 | 3300025940 | Bacteria | 1719 |
| 481 | Ga0207691_10320459 | 3300025940 | Bacteria | 1329 |
| 482 | Ga0207691_10324822 | 3300025940 | Bacteria | 1319 |
| 483 | Ga0207691_10472773 | 3300025940 | Bacteria | 1066 |
| 484 | Ga0207691_10605827 | 3300025940 | Bacteria | 927 |
| 485 | Ga0207691_10633375 | 3300025940 | Bacteria | 904 |
| 486 | Ga0207711_10019765 | 3300025941 | Bacteria | 5612 |
| 487 | Ga0207711_10048659 | 3300025941 | Bacteria | 3627 |
| 488 | Ga0207711_10054755 | 3300025941 | Bacteria | 3424 |
| 489 | Ga0207711_10214937 | 3300025941 | Bacteria | 1757 |
| 490 | Ga0207711_10679055 | 3300025941 | Bacteria | 961 |
| 491 | Ga0207711_10680977 | 3300025941 | Bacteria | 959 |
| 492 | Ga0207689_10001957 | 3300025942 | Bacteria | 19463 |
| 493 | Ga0207689_10028597 | 3300025942 | Bacteria | 4661 |
| 494 | Ga0207689_10057292 | 3300025942 | Bacteria | 3206 |
| 495 | Ga0207689_10295671 | 3300025942 | Bacteria | 1342 |
| 496 | Ga0207661_10382422 | 3300025944 | Bacteria | 1274 |
| 497 | Ga0207679_10277308 | 3300025945 | Bacteria | 1436 |
| 498 | Ga0207679_10360161 | 3300025945 | Bacteria | 1270 |
| 499 | Ga0207679_10559851 | 3300025945 | Bacteria | 1027 |
| 500 | Ga0207679_10662694 | 3300025945 | Bacteria | 945 |
| 501 | Ga0207679_10693491 | 3300025945 | Bacteria | 924 |
| 502 | Ga0207651_10015897 | 3300025960 | Bacteria | 4389 |
| 503 | Ga0207651_10048641 | 3300025960 | Bacteria | 2868 |
| 504 | Ga0207651_10198016 | 3300025960 | Bacteria | 1607 |
| 505 | Ga0207651_10597533 | 3300025960 | Bacteria | 964 |
| 506 | Ga0207712_10085529 | 3300025961 | Bacteria | 2308 |
| 507 | Ga0207712_10131078 | 3300025961 | Bacteria | 1911 |
| 508 | Ga0207712_10312278 | 3300025961 | Bacteria | 1294 |
| 509 | Ga0207712_10665561 | 3300025961 | Bacteria | 906 |
| 510 | Ga0207668_10013103 | 3300025972 | Bacteria | 5096 |
| 511 | Ga0207668_10140566 | 3300025972 | Bacteria | 1856 |
| 512 | Ga0207668_10256489 | 3300025972 | Bacteria | 1423 |
| 513 | Ga0207658_10040984 | 3300025986 | Bacteria | 3350 |
| 514 | Ga0207658_10086776 | 3300025986 | Bacteria | 2414 |
| 515 | Ga0207658_10139362 | 3300025986 | Bacteria | 1960 |
| 516 | Ga0207658_10358044 | 3300025986 | Bacteria | 1272 |
| 517 | Ga0207677_10010533 | 3300026023 | Bacteria | 5237 |
| 518 | Ga0207677_10013473 | 3300026023 | Bacteria | 4740 |
| 519 | Ga0207703_10005888 | 3300026035 | Bacteria | 9825 |
| 520 | Ga0207703_10007902 | 3300026035 | Bacteria | 8412 |
| 521 | Ga0207703_10021291 | 3300026035 | Bacteria | 5076 |
| 522 | Ga0207703_10252155 | 3300026035 | Bacteria | 1591 |
| 523 | Ga0207639_10016030 | 3300026041 | Bacteria | 5293 |
| 524 | Ga0207639_11478983 | 3300026041 | Bacteria | 637 |
| 525 | Ga0207678_10360782 | 3300026067 | Bacteria | 1254 |
| 526 | Ga0207678_10677685 | 3300026067 | Bacteria | 907 |
| 527 | Ga0207708_10211045 | 3300026075 | Bacteria | 1552 |
| 528 | Ga0207708_10557909 | 3300026075 | Bacteria | 966 |
| 529 | Ga0207702_10121901 | 3300026078 | Bacteria | 2335 |
| 530 | Ga0207641_10005089 | 3300026088 | Bacteria | 11267 |
| 531 | Ga0207641_10012091 | 3300026088 | Bacteria | 7079 |
| 532 | Ga0207641_10021771 | 3300026088 | Bacteria | 5269 |
| 533 | Ga0207641_10236646 | 3300026088 | Bacteria | 1699 |
| 534 | Ga0207641_10677285 | 3300026088 | Bacteria | 1014 |
| 535 | Ga0207641_10860190 | 3300026088 | Bacteria | 899 |
| 536 | Ga0207648_10120272 | 3300026089 | Bacteria | 2309 |
| 537 | Ga0207648_10135611 | 3300026089 | Bacteria | 2168 |
| 538 | Ga0207648_10177046 | 3300026089 | Bacteria | 1887 |
| 539 | Ga0207648_10210706 | 3300026089 | Bacteria | 1725 |
| 540 | Ga0207648_10399361 | 3300026089 | Bacteria | 1245 |
| 541 | Ga0207648_10479927 | 3300026089 | Bacteria | 1135 |
| 542 | Ga0207648_10614029 | 3300026089 | Bacteria | 1003 |
| 543 | Ga0207676_10005849 | 3300026095 | Bacteria | 8690 |
| 544 | Ga0207676_10005921 | 3300026095 | Bacteria | 8637 |
| 545 | Ga0207676_10037212 | 3300026095 | Bacteria | 3707 |
| 546 | Ga0207676_10067533 | 3300026095 | Bacteria | 2856 |
| 547 | Ga0207676_10311473 | 3300026095 | Bacteria | 1441 |
| 548 | Ga0207676_10342735 | 3300026095 | Bacteria | 1379 |
| 549 | Ga0207676_10996626 | 3300026095 | Bacteria | 825 |
| 550 | Ga0207676_11214535 | 3300026095 | Bacteria | 747 |
| 551 | Ga0207674_10205009 | 3300026116 | Bacteria | 1921 |
| 552 | Ga0207674_11105118 | 3300026116 | Bacteria | 762 |
| 553 | Ga0207675_100004245 | 3300026118 | Bacteria | 13857 |
| 554 | Ga0207675_100004891 | 3300026118 | Bacteria | 12915 |
| 555 | Ga0207675_100196069 | 3300026118 | Bacteria | 1938 |
| 556 | Ga0207675_100457268 | 3300026118 | Bacteria | 1266 |
| 557 | Ga0207675_100563902 | 3300026118 | Bacteria | 1139 |
| 558 | Ga0207675_100782674 | 3300026118 | Bacteria | 966 |
| 559 | Ga0207675_100927088 | 3300026118 | Bacteria | 888 |
| 560 | Ga0207683_10009318 | 3300026121 | Bacteria | 8364 |
| 561 | Ga0207683_10037761 | 3300026121 | Bacteria | 4207 |
| 562 | Ga0207683_10051292 | 3300026121 | Bacteria | 3615 |
| 563 | Ga0207683_10066018 | 3300026121 | Bacteria | 3190 |
| 564 | Ga0207683_10082714 | 3300026121 | Bacteria | 2852 |
| 565 | Ga0207683_10269765 | 3300026121 | Bacteria | 1554 |
| 566 | Ga0207683_10458882 | 3300026121 | Bacteria | 1175 |
| 567 | Ga0207683_10553535 | 3300026121 | Bacteria | 1064 |
| 568 | Ga0207683_10606326 | 3300026121 | Bacteria | 1013 |
| 569 | Ga0207698_10183741 | 3300026142 | Bacteria | 1855 |
| 570 | Ga0207698_10669334 | 3300026142 | Bacteria | 1030 |
| 571 | Ga0207698_10804346 | 3300026142 | Bacteria | 942 |
| 572 | Ga0207698_10858230 | 3300026142 | Bacteria | 913 |
| 573 | Ga0207698_11257245 | 3300026142 | Bacteria | 755 |
| 574 | Ga0209281_1023406 | 3300027111 | Bacteria | 1171 |
| 575 | Ga0209282_1000307 | 3300027666 | Bacteria | 24300 |
| 576 | Ga0268266_10193231 | 3300028379 | Bacteria | 1859 |
| 577 | Ga0268266_11040786 | 3300028379 | Bacteria | 792 |
| 578 | Ga0268265_10118750 | 3300028380 | Bacteria | 2174 |
| 579 | Ga0268265_10979518 | 3300028380 | Bacteria | 834 |
| 580 | Ga0268264_10004057 | 3300028381 | Bacteria | 12533 |
| 581 | Ga0268264_10015030 | 3300028381 | Bacteria | 6351 |
| 582 | Ga0268264_10212368 | 3300028381 | Bacteria | 1777 |
| 583 | Ga0307515_10000064 | 3300028794 | Bacteria | 245452 |
| 584 | Ga0316178_1126380 | 3300030735 | Bacteria | 3798 |
| 585 | Ga0316183_1110495 | 3300030742 | Bacteria | 3751 |
| 586 | Ga0316182_1084678 | 3300030745 | Bacteria | 1898 |
| 587 | Ga0307513_10000090 | 3300031456 | Bacteria | 129750 |
| 588 | Ga0307513_10116438 | 3300031456 | Bacteria | 2652 |
| 589 | Ga0307513_10499229 | 3300031456 | Bacteria | 934 |
| 590 | Ga0307408_100005621 | 3300031548 | Bacteria | 8383 |
| 591 | Ga0307408_100039727 | 3300031548 | Bacteria | 3329 |
| 592 | Ga0307408_100086585 | 3300031548 | Bacteria | 2355 |
| 593 | Ga0307408_100096359 | 3300031548 | Bacteria | 2244 |
| 594 | Ga0307408_100132717 | 3300031548 | Bacteria | 1945 |
| 595 | Ga0307408_100304331 | 3300031548 | Bacteria | 1337 |
| 596 | Ga0307408_100422714 | 3300031548 | Bacteria | 1149 |
| 597 | Ga0307408_100438115 | 3300031548 | Bacteria | 1131 |
| 598 | Ga0307408_100530569 | 3300031548 | Bacteria | 1035 |
| 599 | Ga0307514_10011166 | 3300031649 | Bacteria | 7476 |
| 600 | Ga0307405_10005918 | 3300031731 | Bacteria | 5963 |
| 601 | Ga0307405_10037668 | 3300031731 | Bacteria | 2908 |
| 602 | Ga0307405_10073841 | 3300031731 | Bacteria | 2203 |
| 603 | Ga0307405_10086027 | 3300031731 | Bacteria | 2068 |
| 604 | Ga0307405_10098412 | 3300031731 | Bacteria | 1955 |
| 605 | Ga0307405_10176158 | 3300031731 | Bacteria | 1530 |
| 606 | Ga0307405_10202895 | 3300031731 | Bacteria | 1441 |
| 607 | Ga0307405_10421922 | 3300031731 | Bacteria | 1050 |
| 608 | Ga0307405_10491745 | 3300031731 | Bacteria | 981 |
| 609 | Ga0307413_10056403 | 3300031824 | Bacteria | 2396 |
| 610 | Ga0307413_10221699 | 3300031824 | Bacteria | 1382 |
| 611 | Ga0307413_10842566 | 3300031824 | Bacteria | 774 |
| 612 | Ga0307410_10042903 | 3300031852 | Bacteria | 2993 |
| 613 | Ga0307410_10052712 | 3300031852 | Bacteria | 2749 |
| 614 | Ga0307410_10413332 | 3300031852 | Bacteria | 1093 |
| 615 | Ga0307406_10006495 | 3300031901 | Bacteria | 6459 |
| 616 | Ga0307406_10018017 | 3300031901 | Bacteria | 4119 |
| 617 | Ga0307406_10056965 | 3300031901 | Bacteria | 2505 |
| 618 | Ga0307406_10252847 | 3300031901 | Bacteria | 1329 |
| 619 | Ga0307406_10376040 | 3300031901 | Bacteria | 1118 |
| 620 | Ga0307406_10431824 | 3300031901 | Bacteria | 1052 |
| 621 | Ga0307406_10491338 | 3300031901 | Bacteria | 993 |
| 622 | Ga0307406_10706521 | 3300031901 | Bacteria | 842 |
| 623 | Ga0307407_10039408 | 3300031903 | Bacteria | 2627 |
| 624 | Ga0307407_10259091 | 3300031903 | Bacteria | 1195 |
| 625 | Ga0307412_10002222 | 3300031911 | Bacteria | 10777 |
| 626 | Ga0307412_10029007 | 3300031911 | Bacteria | 3469 |
| 627 | Ga0307412_10046332 | 3300031911 | Bacteria | 2848 |
| 628 | Ga0307412_10071053 | 3300031911 | Bacteria | 2375 |
| 629 | Ga0307412_10163776 | 3300031911 | Bacteria | 1655 |
| 630 | Ga0307412_10249457 | 3300031911 | Bacteria | 1377 |
| 631 | Ga0307412_10475267 | 3300031911 | Bacteria | 1035 |
| 632 | Ga0307409_100000592 | 3300031995 | Bacteria | 15808 |
| 633 | Ga0307416_100006736 | 3300032002 | Bacteria | 7222 |
| 634 | Ga0307416_100030125 | 3300032002 | Bacteria | 4068 |
| 635 | Ga0307416_100078038 | 3300032002 | Bacteria | 2784 |
| 636 | Ga0307416_100093935 | 3300032002 | Bacteria | 2585 |
| 637 | Ga0307416_100176293 | 3300032002 | Bacteria | 1997 |
| 638 | Ga0307416_100214103 | 3300032002 | Bacteria | 1841 |
| 639 | Ga0307414_10011967 | 3300032004 | Bacteria | 5115 |
| 640 | Ga0307414_10223393 | 3300032004 | Bacteria | 1548 |
| 641 | Ga0307414_10385631 | 3300032004 | Bacteria | 1213 |
| 642 | Ga0307414_10418882 | 3300032004 | Bacteria | 1167 |
| 643 | Ga0307414_10888273 | 3300032004 | Bacteria | 816 |
| 644 | Ga0307411_10080376 | 3300032005 | Bacteria | 2241 |
| 645 | Ga0307415_100002275 | 3300032126 | Bacteria | 9522 |
| 646 | Ga0307415_100454217 | 3300032126 | Bacteria | 1108 |
| 647 | Ga0373944_0292425 | 3300035089 | Bacteria | 610 |
| 648 | Ga0373955_0116903 | 3300035172 | Bacteria | 1547 |
| 649 | Ga0373931_0045475 | 3300035691 | Bacteria | 2318 |
| 650 | Ga0373935_0338915 | 3300035692 | Bacteria | 1070 |
| 651 | Ga0373935_0509997 | 3300035692 | Bacteria | 874 |
| 652 | Ga0373927_0219919 | 3300035695 | Bacteria | 1248 |
| 653 | Ga0373937_0423920 | 3300036401 | Bacteria | 1263 |
| 654 | Ga0373937_0687698 | 3300036401 | Bacteria | 969 |
| 655 | Ga0395899_0003326 | 3300037312 | Bacteria | 12743 |
| 656 | Ga0395898_0007717 | 3300037466 | Bacteria | 11423 |
| 657 | Ga0395905_0000492 | 3300037471 | Bacteria | 54399 |
| 658 | Ga0395905_0005285 | 3300037471 | Bacteria | 13205 |
| 659 | Ga0395905_0024428 | 3300037471 | Bacteria | 5704 |
| 660 | Ga0395901_0345743 | 3300038443 | Bacteria | 1536 |
| 661 | Ga0439436_0044193 | 3300041404 | Bacteria | 1269 |
| 662 | Ga0439439_0017080 | 3300041406 | Bacteria | 1781 |
| 663 | Ga0439447_014294 | 3300041407 | Bacteria | 2231 |
| 664 | Ga0439447_035437 | 3300041407 | Bacteria | 1237 |
| 665 | Ga0439466_0008218 | 3300041411 | Bacteria | 3935 |
| 666 | Ga0439466_0012417 | 3300041411 | Bacteria | 3138 |
| 667 | Ga0439466_0128780 | 3300041411 | Bacteria | 779 |
| 668 | Ga0439465_0021445 | 3300041413 | Bacteria | 2025 |
| 669 | Ga0451789_0567393 | 3300041443 | Bacteria | 1248 |
| 670 | Ga0451791_1410299 | 3300041451 | Bacteria | 796 |
| 671 | Ga0451795_1340527 | 3300041456 | Bacteria | 708 |
| 672 | Ga0451804_0402448 | 3300041463 | Bacteria | 646 |
| 673 | Ga0451837_0128052 | 3300041494 | Bacteria | 1128 |
| 674 | Ga0451839_0069363 | 3300041496 | Bacteria | 618 |
| 675 | Ga0451843_0600576 | 3300041509 | Bacteria | 1233 |
| 676 | Ga0451853_2861878 | 3300041512 | Bacteria | 1975 |
| 677 | Ga0439431_0034770 | 3300041997 | Bacteria | 1264 |
| 678 | Ga0439431_0063027 | 3300041997 | Bacteria | 978 |
| 679 | Ga0439433_0008170 | 3300041999 | Bacteria | 2266 |
| 680 | Ga0439442_030730 | 3300042002 | Bacteria | 1121 |
| 681 | Ga0439445_0001503 | 3300042004 | Bacteria | 5070 |
| 682 | Ga0439445_0014743 | 3300042004 | Bacteria | 1907 |
| 683 | Ga0439432_000751 | 3300042006 | Bacteria | 12131 |
| 684 | Ga0439449_0002753 | 3300042007 | Bacteria | 6842 |
| 685 | Ga0439449_0042584 | 3300042007 | Bacteria | 1686 |
| 686 | Ga0439452_010200 | 3300042010 | Bacteria | 2742 |
| 687 | Ga0439452_020482 | 3300042010 | Bacteria | 1734 |
| 688 | Ga0439457_018482 | 3300042014 | Bacteria | 1549 |
| 689 | Ga0439462_0026957 | 3300042015 | Bacteria | 1515 |
| 690 | Ga0450911_000714 | 3300042115 | Bacteria | 9675 |
| 691 | Ga0450922_023042 | 3300042124 | Bacteria | 650 |
| 692 | Ga0450897_007865 | 3300042128 | Bacteria | 981 |
| 693 | Ga0450906_017658 | 3300042145 | Bacteria | 1285 |
| 694 | Ga0439434_0000521 | 3300042435 | Bacteria | 10979 |
| 695 | Ga0439464_0009427 | 3300042439 | Bacteria | 2570 |
| 696 | Ga0453683_0193090 | 3300044673 | Bacteria | 1292 |
| 697 | Ga0466960_0034266 | 3300044901 | Bacteria | 2365 |
| 698 | Ga0495603_0096110 | 3300046455 | Bacteria | 1731 |
| 699 | Ga0495603_0320633 | 3300046455 | Bacteria | 890 |
| 700 | Ga0495629_0181676 | 3300046459 | Bacteria | 1458 |
| 701 | Ga0495580_0030828 | 3300046472 | Bacteria | 3879 |
| 702 | Ga0495582_0277582 | 3300046473 | Bacteria | 962 |
| 703 | Ga0495639_0104206 | 3300046475 | Bacteria | 1341 |
| 704 | Ga0495639_0304126 | 3300046475 | Bacteria | 796 |
| 705 | Ga0495643_0127369 | 3300046522 | Bacteria | 1281 |
| 706 | Ga0495654_0003475 | 3300046530 | Bacteria | 9623 |
| 707 | Ga0495654_0074893 | 3300046530 | Bacteria | 1598 |
| 708 | Ga0495598_0017719 | 3300046537 | Bacteria | 1840 |
| 709 | Ga0495633_0178835 | 3300046558 | Bacteria | 977 |
| 710 | Ga0495656_0002368 | 3300046615 | Bacteria | 6248 |
| 711 | Ga0495656_0120241 | 3300046615 | Bacteria | 1239 |
| 712 | Ga0495656_0176722 | 3300046615 | Bacteria | 1047 |
| 713 | Ga0495635_0144507 | 3300046663 | Bacteria | 1620 |
| 714 | Ga0495588_0084062 | 3300046674 | Bacteria | 1663 |
| 715 | Ga0495647_0134503 | 3300046681 | Bacteria | 1050 |
| 716 | Ga0495670_0179989 | 3300046691 | Bacteria | 1116 |
| 717 | Ga0495600_0047474 | 3300046809 | Bacteria | 2801 |
| 718 | Ga0495600_0057169 | 3300046809 | Bacteria | 2549 |
| 719 | Ga0495581_0144641 | 3300047315 | Bacteria | 1388 |
| 720 | Ga0495684_0126127 | 3300047471 | Bacteria | 1926 |
| 721 | Ga0495593_0162601 | 3300047673 | Bacteria | 1127 |
| 722 | Ga0495602_0401047 | 3300048088 | Bacteria | 978 |
| 723 | Ga0496101_0004340 | 3300048904 | Bacteria | 8899 |
| 724 | Ga0496102_0043995 | 3300048905 | Bacteria | 4050 |
| 725 | Ga0496102_0170224 | 3300048905 | Bacteria | 2051 |
| 726 | Ga0496103_0042834 | 3300048906 | Bacteria | 2786 |
| 727 | Ga0496103_0065059 | 3300048906 | Bacteria | 2274 |
| 728 | Ga0496104_0075420 | 3300048907 | Bacteria | 3211 |
| 729 | Ga0496104_0135850 | 3300048907 | Bacteria | 2363 |
| 730 | Ga0496104_0472587 | 3300048907 | Bacteria | 1165 |
| 731 | Ga0496104_0907173 | 3300048907 | Bacteria | 786 |
| 732 | Ga0496105_0013954 | 3300048908 | Bacteria | 6387 |
| 733 | Ga0496105_0053857 | 3300048908 | Bacteria | 3323 |
| 734 | Ga0496105_0189715 | 3300048908 | Bacteria | 1681 |
| 735 | Ga0496105_0621609 | 3300048908 | Bacteria | 836 |
| 736 | Ga0496106_0113688 | 3300048909 | Bacteria | 2110 |
| 737 | Ga0496106_0404266 | 3300048909 | Bacteria | 1097 |
| 738 | Ga0496107_0037832 | 3300048910 | Bacteria | 3463 |
| 739 | Ga0496107_0326915 | 3300048910 | Bacteria | 1141 |
| 740 | Ga0496108_0245790 | 3300048911 | Bacteria | 1556 |
| 741 | Ga0496108_0348394 | 3300048911 | Bacteria | 1292 |
| 742 | Ga0496108_0372746 | 3300048911 | Bacteria | 1246 |
| 743 | Ga0496108_0490135 | 3300048911 | Bacteria | 1073 |
| 744 | Ga0496109_0316242 | 3300048912 | Bacteria | 1473 |
| 745 | Ga0496109_0370781 | 3300048912 | Bacteria | 1352 |
| 746 | Ga0496110_0650962 | 3300048913 | Bacteria | 953 |
| 747 | Ga0496113_0158042 | 3300048916 | Bacteria | 1791 |
| 748 | Ga0496113_0202107 | 3300048916 | Bacteria | 1579 |
| 749 | Ga0496114_0244812 | 3300048917 | Bacteria | 1577 |
| 750 | Ga0496114_0614018 | 3300048917 | Bacteria | 958 |
| 751 | Ga0496115_0420280 | 3300048918 | Bacteria | 1083 |
| 752 | Ga0496121_0004542 | 3300048924 | Bacteria | 18558 |
| 753 | Ga0496122_0000184 | 3300048925 | Bacteria | 144437 |
| 754 | Ga0496123_0000181 | 3300048926 | Bacteria | 127092 |
| 755 | Ga0496123_0177131 | 3300048926 | Bacteria | 1118 |
| 756 | Ga0496124_0033333 | 3300048927 | Bacteria | 4530 |
| 757 | Ga0496124_0082921 | 3300048927 | Bacteria | 2631 |
| 758 | Ga0496125_0007111 | 3300048928 | Bacteria | 11945 |
| 759 | Ga0496125_0007919 | 3300048928 | Bacteria | 11218 |
| 760 | Ga0496126_0140326 | 3300048929 | Bacteria | 2081 |
| 761 | Ga0496126_0319076 | 3300048929 | Bacteria | 1278 |
| 762 | Ga0501238_010778 | 3300049671 | Bacteria | 1223 |
| 763 | Ga0501225_0006440 | 3300049705 | Bacteria | 3427 |
| 764 | Ga0501241_027674 | 3300049758 | Bacteria | 1061 |
| 765 | Ga0501262_000209 | 3300049759 | Bacteria | 7284 |
| 766 | nmdc:mga03683_7048_c1 | 3300050489 | Bacteria | 3880 |
| 767 | nmdc:mga03n38_290553_c1 | 3300050490 | Bacteria | 875 |
| 768 | nmdc:mga03n38_74275_c1 | 3300050490 | Bacteria | 1581 |
| 769 | nmdc:mga03n38_88366_c1 | 3300050490 | Bacteria | 1470 |
| 770 | nmdc:mga00v17_58579_c1 | 3300050491 | Bacteria | 2360 |
| 771 | nmdc:mga00v17_85049_c1 | 3300050491 | Bacteria | 1980 |
| 772 | nmdc:mga0k408_131946_c1 | 3300050493 | Bacteria | 1483 |
| 773 | nmdc:mga0k408_234171_c1 | 3300050493 | Bacteria | 1096 |
| 774 | nmdc:mga0k408_29966_c1 | 3300050493 | Bacteria | 3101 |
| 775 | nmdc:mga0k408_552740_c1 | 3300050493 | Bacteria | 680 |
| 776 | nmdc:mga09592_745833_c1 | 3300050508 | Bacteria | 831 |
| 777 | nmdc:mga09592_7768_c1 | 3300050508 | Bacteria | 8715 |
| 778 | nmdc:mga0qj67_8225_c2 | 3300050509 | Bacteria | 6603 |
| 779 | nmdc:mga08y16_712602_c1 | 3300050511 | Bacteria | 1002 |
| 780 | nmdc:mga0n895_613493_c1 | 3300050512 | Bacteria | 1089 |
| 781 | Ga0495601_0461740 | 3300053077 | Bacteria | 821 |
| 782 | Ga0495601_0496587 | 3300053077 | Bacteria | 788 |
| 783 | Ga0495619_0200255 | 3300053085 | Bacteria | 1382 |
| 784 | Ga0495619_0275516 | 3300053085 | Bacteria | 1166 |
| 785 | Ga0500644_0001138 | 3300053088 | Bacteria | 7751 |
| 786 | Ga0500644_0003553 | 3300053088 | Bacteria | 3867 |
| 787 | Ga0500651_0005197 | 3300053093 | Bacteria | 7409 |
| 788 | Ga0500566_0230164 | 3300053094 | Bacteria | 915 |
| 789 | Ga0500650_0118545 | 3300053098 | Bacteria | 1234 |
| 790 | Ga0500562_008265 | 3300053108 | Bacteria | 2628 |
| 791 | Ga0500593_002149 | 3300053117 | Bacteria | 7169 |
| 792 | Ga0500594_0009084 | 3300053118 | Bacteria | 2281 |
| 793 | Ga0500628_007338 | 3300053129 | Bacteria | 1887 |
| 794 | Ga0500559_0040781 | 3300053136 | Bacteria | 2022 |
| 795 | Ga0500586_090956 | 3300053145 | Bacteria | 1071 |
| 796 | Ga0500616_0034346 | 3300053153 | Bacteria | 2762 |
| 797 | Ga0500622_0128002 | 3300053156 | Bacteria | 1224 |
| 798 | Ga0500645_000061 | 3300053730 | Bacteria | 85703 |
| 799 | Ga0500645_001674 | 3300053730 | Bacteria | 10874 |
| 800 | Ga0500645_021334 | 3300053730 | Bacteria | 2000 |
| 801 | Ga0500661_000809 | 3300055283 | Bacteria | 5830 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025936 | Ga0207670_11063869 | Ga0207670_110638691 | 166 |
| 2 | 3300025920 | Ga0207649_11110007 | Ga0207649_111100071 | 173 |
| 3 | 3300025937 | Ga0207669_10290769 | Ga0207669_102907692 | 178 |
| 4 | iso_pu_bacteria | 2511231002 | 2511243465 | 180 |
| 5 | iso_pu_bacteria | 2643221683 | 2644466122 | 181 |
| 6 | iso_pu_bacteria | 2842677519 | 2842681153 | 181 |
| 7 | iso_pu_bacteria | 2842733646 | 2842737419 | 181 |
| 8 | iso_pu_bacteria | 2842747753 | 2842749840 | 181 |
| 9 | iso_pu_bacteria | 2885192300 | 2885196589 | 181 |
| 10 | iso_pu_bacteria | 2904449895 | 2904454127 | 181 |
| 11 | iso_pu_bacteria | 2904456579 | 2904462016 | 181 |
| 12 | iso_pu_bacteria | 2919462493 | 2919465272 | 181 |
| 13 | iso_pu_bacteria | 2929520902 | 2929521858 | 181 |
| 14 | iso_pu_bacteria | 2945909444 | 2945914376 | 181 |
| 15 | iso_pu_bacteria | 2945945610 | 2945949907 | 181 |
| 16 | iso_pu_bacteria | 2945972063 | 2945973926 | 181 |
| 17 | iso_pu_bacteria | 2945984333 | 2945990229 | 181 |
| 18 | iso_pu_bacteria | 2954767861 | 2954770486 | 181 |
| 19 | iso_pu_bacteria | 2738543013 | 2739251826 | 182 |
| 20 | 3300005293 | Ga0065715_10176942 | Ga0065715_101769422 | 183 |
| 21 | 3300005330 | Ga0070690_100069129 | Ga0070690_1000691291 | 183 |
| 22 | 3300005331 | Ga0070670_100246589 | Ga0070670_1002465892 | 183 |
| 23 | 3300005333 | Ga0070677_10075091 | Ga0070677_100750912 | 183 |
| 24 | 3300005335 | Ga0070666_10007413 | Ga0070666_100074132 | 183 |
| 25 | 3300005338 | Ga0068868_100001955 | Ga0068868_10000195510 | 183 |
| 26 | 3300005354 | Ga0070675_100005320 | Ga0070675_1000053207 | 183 |
| 27 | 3300005355 | Ga0070671_100006632 | Ga0070671_1000066323 | 183 |
| 28 | 3300005364 | Ga0070673_100029782 | Ga0070673_1000297822 | 183 |
| 29 | 3300005365 | Ga0070688_100082736 | Ga0070688_1000827362 | 183 |
| 30 | 3300005367 | Ga0070667_100036122 | Ga0070667_1000361225 | 183 |
| 31 | 3300005456 | Ga0070678_100075327 | Ga0070678_1000753272 | 183 |
| 32 | 3300005457 | Ga0070662_100047737 | Ga0070662_1000477373 | 183 |
| 33 | 3300005459 | Ga0068867_100218856 | Ga0068867_1002188562 | 183 |
| 34 | 3300005466 | Ga0070685_10092534 | Ga0070685_100925342 | 183 |
| 35 | 3300005539 | Ga0068853_100947748 | Ga0068853_1009477481 | 183 |
| 36 | 3300005543 | Ga0070672_100060460 | Ga0070672_1000604604 | 183 |
| 37 | 3300005543 | Ga0070672_100294887 | Ga0070672_1002948872 | 183 |
| 38 | 3300005543 | Ga0070672_100356649 | Ga0070672_1003566492 | 183 |
| 39 | 3300005564 | Ga0070664_100418007 | Ga0070664_1004180072 | 183 |
| 40 | 3300005617 | Ga0068859_100004027 | Ga0068859_10000402712 | 183 |
| 41 | 3300005618 | Ga0068864_100009938 | Ga0068864_1000099386 | 183 |
| 42 | 3300005618 | Ga0068864_100299406 | Ga0068864_1002994062 | 183 |
| 43 | 3300005718 | Ga0068866_10063423 | Ga0068866_100634232 | 183 |
| 44 | 3300005719 | Ga0068861_100059976 | Ga0068861_1000599763 | 183 |
| 45 | 3300005719 | Ga0068861_100173149 | Ga0068861_1001731492 | 183 |
| 46 | 3300005834 | Ga0068851_10087079 | Ga0068851_100870792 | 183 |
| 47 | 3300005840 | Ga0068870_10252066 | Ga0068870_102520662 | 183 |
| 48 | 3300005841 | Ga0068863_100004155 | Ga0068863_1000041557 | 183 |
| 49 | 3300005841 | Ga0068863_100262952 | Ga0068863_1002629522 | 183 |
| 50 | 3300005841 | Ga0068863_100725874 | Ga0068863_1007258742 | 183 |
| 51 | 3300005842 | Ga0068858_100002678 | Ga0068858_1000026787 | 183 |
| 52 | 3300005843 | Ga0068860_100221249 | Ga0068860_1002212492 | 183 |
| 53 | 3300005844 | Ga0068862_100240628 | Ga0068862_1002406282 | 183 |
| 54 | 3300006237 | Ga0097621_100055088 | Ga0097621_1000550882 | 183 |
| 55 | 3300006237 | Ga0097621_100117798 | Ga0097621_1001177982 | 183 |
| 56 | 3300006237 | Ga0097621_100649944 | Ga0097621_1006499442 | 183 |
| 57 | 3300006358 | Ga0068871_100143643 | Ga0068871_1001436432 | 183 |
| 58 | 3300006358 | Ga0068871_100489330 | Ga0068871_1004893302 | 183 |
| 59 | 3300006846 | Ga0075430_100009841 | Ga0075430_1000098414 | 183 |
| 60 | 3300006880 | Ga0075429_100003178 | Ga0075429_1000031789 | 183 |
| 61 | 3300006881 | Ga0068865_100520592 | Ga0068865_1005205922 | 183 |
| 62 | 3300006931 | Ga0097620_100004027 | Ga0097620_10000402712 | 183 |
| 63 | 3300009176 | Ga0105242_10427266 | Ga0105242_104272662 | 183 |
| 64 | 3300009177 | Ga0105248_10128074 | Ga0105248_101280742 | 183 |
| 65 | 3300009177 | Ga0105248_10239358 | Ga0105248_102393582 | 183 |
| 66 | 3300009177 | Ga0105248_11022284 | Ga0105248_110222842 | 183 |
| 67 | 3300009553 | Ga0105249_10017865 | Ga0105249_100178652 | 183 |
| 68 | 3300013102 | Ga0157371_10554873 | Ga0157371_105548731 | 183 |
| 69 | 3300013296 | Ga0157374_10100494 | Ga0157374_101004942 | 183 |
| 70 | 3300013296 | Ga0157374_10401056 | Ga0157374_104010562 | 183 |
| 71 | 3300013296 | Ga0157374_11422602 | Ga0157374_114226022 | 183 |
| 72 | 3300013297 | Ga0157378_10397636 | Ga0157378_103976362 | 183 |
| 73 | 3300013306 | Ga0163162_10106194 | Ga0163162_101061942 | 183 |
| 74 | 3300013306 | Ga0163162_10254580 | Ga0163162_102545802 | 183 |
| 75 | 3300013306 | Ga0163162_10568379 | Ga0163162_105683792 | 183 |
| 76 | 3300013307 | Ga0157372_10995705 | Ga0157372_109957051 | 183 |
| 77 | 3300013308 | Ga0157375_10171764 | Ga0157375_101717642 | 183 |
| 78 | 3300013308 | Ga0157375_10312197 | Ga0157375_103121972 | 183 |
| 79 | 3300014325 | Ga0163163_10016809 | Ga0163163_100168094 | 183 |
| 80 | 3300014326 | Ga0157380_10111348 | Ga0157380_101113482 | 183 |
| 81 | 3300014969 | Ga0157376_10120479 | Ga0157376_101204792 | 183 |
| 82 | 3300025271 | Ga0207666_1001766 | Ga0207666_10017663 | 183 |
| 83 | 3300025321 | Ga0207656_10180936 | Ga0207656_101809362 | 183 |
| 84 | 3300025893 | Ga0207682_10286553 | Ga0207682_102865532 | 183 |
| 85 | 3300025899 | Ga0207642_10067435 | Ga0207642_100674352 | 183 |
| 86 | 3300025903 | Ga0207680_10023828 | Ga0207680_100238282 | 183 |
| 87 | 3300025908 | Ga0207643_10445085 | Ga0207643_104450852 | 183 |
| 88 | 3300025923 | Ga0207681_10007401 | Ga0207681_100074014 | 183 |
| 89 | 3300025926 | Ga0207659_10007169 | Ga0207659_100071694 | 183 |
| 90 | 3300025931 | Ga0207644_10000068 | Ga0207644_1000006816 | 183 |
| 91 | 3300025931 | Ga0207644_10015661 | Ga0207644_100156615 | 183 |
| 92 | 3300025933 | Ga0207706_10259144 | Ga0207706_102591442 | 183 |
| 93 | 3300025934 | Ga0207686_10155738 | Ga0207686_101557382 | 183 |
| 94 | 3300025938 | Ga0207704_10516559 | Ga0207704_105165592 | 183 |
| 95 | 3300025938 | Ga0207704_10973238 | Ga0207704_109732382 | 183 |
| 96 | 3300025940 | Ga0207691_10324822 | Ga0207691_103248222 | 183 |
| 97 | 3300025940 | Ga0207691_10605827 | Ga0207691_106058272 | 183 |
| 98 | 3300025941 | Ga0207711_10048659 | Ga0207711_100486592 | 183 |
| 99 | 3300025941 | Ga0207711_10214937 | Ga0207711_102149372 | 183 |
| 100 | 3300025942 | Ga0207689_10028597 | Ga0207689_100285974 | 183 |
| 101 | 3300025945 | Ga0207679_10662694 | Ga0207679_106626942 | 183 |
| 102 | 3300025960 | Ga0207651_10015897 | Ga0207651_100158972 | 183 |
| 103 | 3300025961 | Ga0207712_10131078 | Ga0207712_101310782 | 183 |
| 104 | 3300025986 | Ga0207658_10139362 | Ga0207658_101393622 | 183 |
| 105 | 3300026023 | Ga0207677_10010533 | Ga0207677_100105333 | 183 |
| 106 | 3300026035 | Ga0207703_10005888 | Ga0207703_100058887 | 183 |
| 107 | 3300026088 | Ga0207641_10005089 | Ga0207641_100050898 | 183 |
| 108 | 3300026088 | Ga0207641_10236646 | Ga0207641_102366462 | 183 |
| 109 | 3300026089 | Ga0207648_10135611 | Ga0207648_101356112 | 183 |
| 110 | 3300026095 | Ga0207676_10005849 | Ga0207676_100058496 | 183 |
| 111 | 3300026095 | Ga0207676_10311473 | Ga0207676_103114732 | 183 |
| 112 | 3300026118 | Ga0207675_100196069 | Ga0207675_1001960692 | 183 |
| 113 | 3300026118 | Ga0207675_100457268 | Ga0207675_1004572682 | 183 |
| 114 | 3300026121 | Ga0207683_10082714 | Ga0207683_100827142 | 183 |
| 115 | 3300028379 | Ga0268266_10193231 | Ga0268266_101932312 | 183 |
| 116 | 3300028381 | Ga0268264_10212368 | Ga0268264_102123682 | 183 |
| 117 | 3300036401 | Ga0373937_0687698 | Ga0373937_0687698_347_904 | 183 |
| 118 | 3300037471 | Ga0395905_0024428 | Ga0395905_0024428_1771_2358 | 183 |
| 119 | 3300041463 | Ga0451804_0402448 | Ga0451804_0402448_54_611 | 183 |
| 120 | 3300042439 | Ga0439464_0009427 | Ga0439464_0009427_1568_2134 | 183 |
| 121 | 3300044673 | Ga0453683_0193090 | Ga0453683_0193090_368_937 | 183 |
| 122 | 3300044901 | Ga0466960_0034266 | Ga0466960_0034266_1576_2130 | 183 |
| 123 | 3300046455 | Ga0495603_0320633 | Ga0495603_0320633_274_831 | 183 |
| 124 | 3300046537 | Ga0495598_0017719 | Ga0495598_0017719_928_1485 | 183 |
| 125 | 3300048907 | Ga0496104_0135850 | Ga0496104_0135850_270_827 | 183 |
| 126 | 3300048908 | Ga0496105_0053857 | Ga0496105_0053857_860_1417 | 183 |
| 127 | 3300048911 | Ga0496108_0372746 | Ga0496108_0372746_582_1139 | 183 |
| 128 | 3300050508 | nmdc:mga09592_7768_c1 | nmdc:mga09592_7768_c1_6812_7372 | 183 |
| 129 | 3300050509 | nmdc:mga0qj67_8225_c2 | nmdc:mga0qj67_8225_c2_4476_5036 | 183 |
| 130 | 3300002705 | JGI25156J39149_1000013 | JGI25156J39149_100001333 | 184 |
| 131 | 3300002738 | JGI25154J39366_1000032 | JGI25154J39366_100003233 | 184 |
| 132 | 3300002741 | JGI25157J39369_1000017 | JGI25157J39369_100001733 | 184 |
| 133 | 3300002774 | JGI25150J39212_1006693 | JGI25150J39212_10066931 | 184 |
| 134 | 3300002774 | JGI25150J39212_1008334 | JGI25150J39212_10083342 | 184 |
| 135 | 3300002774 | JGI25150J39212_1014251 | JGI25150J39212_10142512 | 184 |
| 136 | 3300002987 | JGI25159J45721_1004214 | JGI25159J45721_10042142 | 184 |
| 137 | 3300002987 | JGI25159J45721_1006741 | JGI25159J45721_10067413 | 184 |
| 138 | 3300003187 | JGI25151J46595_10008595 | JGI25151J46595_100085954 | 184 |
| 139 | 3300003187 | JGI25151J46595_10026532 | JGI25151J46595_100265323 | 184 |
| 140 | 3300003322 | rootL2_10093584 | rootL2_100935841 | 184 |
| 141 | 3300003354 | JGI25160J50197_1000106 | JGI25160J50197_10001064 | 184 |
| 142 | 3300003374 | JGI25161J50226_1000041 | JGI25161J50226_100004144 | 184 |
| 143 | 3300003771 | Ga0055526_1006939 | Ga0055526_10069392 | 184 |
| 144 | 3300003771 | Ga0055526_1006976 | Ga0055526_10069762 | 184 |
| 145 | 3300003773 | Ga0055537_1000029 | Ga0055537_100002992 | 184 |
| 146 | 3300003773 | Ga0055537_1000229 | Ga0055537_100022920 | 184 |
| 147 | 3300003773 | Ga0055537_1008434 | Ga0055537_10084342 | 184 |
| 148 | 3300003775 | Ga0055524_1000040 | Ga0055524_100004040 | 184 |
| 149 | 3300003781 | Ga0055536_1003958 | Ga0055536_10039586 | 184 |
| 150 | 3300003781 | Ga0055536_1005991 | Ga0055536_10059913 | 184 |
| 151 | 3300003781 | Ga0055536_1028010 | Ga0055536_10280102 | 184 |
| 152 | 3300003781 | Ga0055536_1037502 | Ga0055536_10375021 | 184 |
| 153 | 3300003784 | Ga0055534_1000081 | Ga0055534_100008153 | 184 |
| 154 | 3300003784 | Ga0055534_1001320 | Ga0055534_10013209 | 184 |
| 155 | 3300003784 | Ga0055534_1004555 | Ga0055534_10045552 | 184 |
| 156 | 3300003790 | Ga0055528_1000107 | Ga0055528_100010753 | 184 |
| 157 | 3300003790 | Ga0055528_1003803 | Ga0055528_10038034 | 184 |
| 158 | 3300003791 | Ga0055530_10000493 | Ga0055530_1000049324 | 184 |
| 159 | 3300003791 | Ga0055530_10076700 | Ga0055530_100767001 | 184 |
| 160 | 3300003792 | Ga0055540_1000030 | Ga0055540_1000030118 | 184 |
| 161 | 3300003792 | Ga0055540_1001837 | Ga0055540_10018373 | 184 |
| 162 | 3300003792 | Ga0055540_1002684 | Ga0055540_10026849 | 184 |
| 163 | 3300003794 | Ga0055531_10009620 | Ga0055531_100096204 | 184 |
| 164 | 3300004625 | Ga0055543_1001200 | Ga0055543_10012004 | 184 |
| 165 | 3300005262 | Ga0065165_1017710 | Ga0065165_10177103 | 184 |
| 166 | 3300005262 | Ga0065165_1023849 | Ga0065165_10238492 | 184 |
| 167 | 3300005262 | Ga0065165_1024861 | Ga0065165_10248612 | 184 |
| 168 | 3300005262 | Ga0065165_1032070 | Ga0065165_10320702 | 184 |
| 169 | 3300005262 | Ga0065165_1073283 | Ga0065165_10732832 | 184 |
| 170 | 3300005289 | Ga0065704_10083585 | Ga0065704_100835853 | 184 |
| 171 | 3300005293 | Ga0065715_10021301 | Ga0065715_100213012 | 184 |
| 172 | 3300005328 | Ga0070676_10049045 | Ga0070676_100490453 | 184 |
| 173 | 3300005328 | Ga0070676_10381142 | Ga0070676_103811422 | 184 |
| 174 | 3300005329 | Ga0070683_100538148 | Ga0070683_1005381482 | 184 |
| 175 | 3300005331 | Ga0070670_100049162 | Ga0070670_1000491622 | 184 |
| 176 | 3300005331 | Ga0070670_100155929 | Ga0070670_1001559292 | 184 |
| 177 | 3300005331 | Ga0070670_100186040 | Ga0070670_1001860402 | 184 |
| 178 | 3300005331 | Ga0070670_100276301 | Ga0070670_1002763012 | 184 |
| 179 | 3300005331 | Ga0070670_100340987 | Ga0070670_1003409872 | 184 |
| 180 | 3300005331 | Ga0070670_100389658 | Ga0070670_1003896582 | 184 |
| 181 | 3300005331 | Ga0070670_100614428 | Ga0070670_1006144282 | 184 |
| 182 | 3300005333 | Ga0070677_10029393 | Ga0070677_100293932 | 184 |
| 183 | 3300005333 | Ga0070677_10031593 | Ga0070677_100315931 | 184 |
| 184 | 3300005333 | Ga0070677_10052088 | Ga0070677_100520882 | 184 |
| 185 | 3300005333 | Ga0070677_10108316 | Ga0070677_101083162 | 184 |
| 186 | 3300005334 | Ga0068869_100005126 | Ga0068869_1000051268 | 184 |
| 187 | 3300005335 | Ga0070666_10134319 | Ga0070666_101343192 | 184 |
| 188 | 3300005335 | Ga0070666_10236303 | Ga0070666_102363031 | 184 |
| 189 | 3300005335 | Ga0070666_10500287 | Ga0070666_105002872 | 184 |
| 190 | 3300005336 | Ga0070680_100112248 | Ga0070680_1001122482 | 184 |
| 191 | 3300005338 | Ga0068868_100282015 | Ga0068868_1002820152 | 184 |
| 192 | 3300005338 | Ga0068868_100419487 | Ga0068868_1004194872 | 184 |
| 193 | 3300005338 | Ga0068868_100449658 | Ga0068868_1004496582 | 184 |
| 194 | 3300005338 | Ga0068868_100460577 | Ga0068868_1004605772 | 184 |
| 195 | 3300005339 | Ga0070660_100104911 | Ga0070660_1001049113 | 184 |
| 196 | 3300005339 | Ga0070660_100222446 | Ga0070660_1002224462 | 184 |
| 197 | 3300005343 | Ga0070687_100020504 | Ga0070687_1000205042 | 184 |
| 198 | 3300005343 | Ga0070687_100165126 | Ga0070687_1001651262 | 184 |
| 199 | 3300005344 | Ga0070661_100236750 | Ga0070661_1002367502 | 184 |
| 200 | 3300005345 | Ga0070692_10443012 | Ga0070692_104430121 | 184 |
| 201 | 3300005347 | Ga0070668_100003555 | Ga0070668_1000035552 | 184 |
| 202 | 3300005347 | Ga0070668_100212306 | Ga0070668_1002123062 | 184 |
| 203 | 3300005347 | Ga0070668_100289407 | Ga0070668_1002894072 | 184 |
| 204 | 3300005347 | Ga0070668_100838589 | Ga0070668_1008385891 | 184 |
| 205 | 3300005353 | Ga0070669_100017475 | Ga0070669_1000174755 | 184 |
| 206 | 3300005353 | Ga0070669_100031658 | Ga0070669_1000316582 | 184 |
| 207 | 3300005353 | Ga0070669_100060905 | Ga0070669_1000609052 | 184 |
| 208 | 3300005353 | Ga0070669_100789470 | Ga0070669_1007894702 | 184 |
| 209 | 3300005353 | Ga0070669_100862666 | Ga0070669_1008626662 | 184 |
| 210 | 3300005354 | Ga0070675_100061363 | Ga0070675_1000613632 | 184 |
| 211 | 3300005354 | Ga0070675_100159556 | Ga0070675_1001595562 | 184 |
| 212 | 3300005354 | Ga0070675_100161306 | Ga0070675_1001613062 | 184 |
| 213 | 3300005354 | Ga0070675_100203777 | Ga0070675_1002037772 | 184 |
| 214 | 3300005355 | Ga0070671_100043326 | Ga0070671_1000433262 | 184 |
| 215 | 3300005355 | Ga0070671_100069616 | Ga0070671_1000696161 | 184 |
| 216 | 3300005355 | Ga0070671_100281114 | Ga0070671_1002811142 | 184 |
| 217 | 3300005355 | Ga0070671_101193515 | Ga0070671_1011935151 | 184 |
| 218 | 3300005356 | Ga0070674_100018239 | Ga0070674_1000182393 | 184 |
| 219 | 3300005356 | Ga0070674_100070201 | Ga0070674_1000702012 | 184 |
| 220 | 3300005356 | Ga0070674_100140602 | Ga0070674_1001406021 | 184 |
| 221 | 3300005356 | Ga0070674_100284602 | Ga0070674_1002846022 | 184 |
| 222 | 3300005364 | Ga0070673_100243919 | Ga0070673_1002439192 | 184 |
| 223 | 3300005364 | Ga0070673_100799803 | Ga0070673_1007998032 | 184 |
| 224 | 3300005364 | Ga0070673_100967278 | Ga0070673_1009672781 | 184 |
| 225 | 3300005366 | Ga0070659_100135367 | Ga0070659_1001353672 | 184 |
| 226 | 3300005366 | Ga0070659_100193210 | Ga0070659_1001932102 | 184 |
| 227 | 3300005366 | Ga0070659_100717292 | Ga0070659_1007172921 | 184 |
| 228 | 3300005367 | Ga0070667_100018788 | Ga0070667_1000187883 | 184 |
| 229 | 3300005367 | Ga0070667_100038123 | Ga0070667_1000381234 | 184 |
| 230 | 3300005367 | Ga0070667_100478037 | Ga0070667_1004780372 | 184 |
| 231 | 3300005367 | Ga0070667_100557582 | Ga0070667_1005575822 | 184 |
| 232 | 3300005367 | Ga0070667_100606696 | Ga0070667_1006066961 | 184 |
| 233 | 3300005438 | Ga0070701_10167625 | Ga0070701_101676251 | 184 |
| 234 | 3300005455 | Ga0070663_100169733 | Ga0070663_1001697332 | 184 |
| 235 | 3300005455 | Ga0070663_100497756 | Ga0070663_1004977562 | 184 |
| 236 | 3300005456 | Ga0070678_100048400 | Ga0070678_1000484003 | 184 |
| 237 | 3300005456 | Ga0070678_100053734 | Ga0070678_1000537343 | 184 |
| 238 | 3300005456 | Ga0070678_100169802 | Ga0070678_1001698022 | 184 |
| 239 | 3300005456 | Ga0070678_100229311 | Ga0070678_1002293112 | 184 |
| 240 | 3300005456 | Ga0070678_100441314 | Ga0070678_1004413142 | 184 |
| 241 | 3300005456 | Ga0070678_100806755 | Ga0070678_1008067552 | 184 |
| 242 | 3300005457 | Ga0070662_100012157 | Ga0070662_1000121573 | 184 |
| 243 | 3300005457 | Ga0070662_100023662 | Ga0070662_1000236622 | 184 |
| 244 | 3300005457 | Ga0070662_100091956 | Ga0070662_1000919562 | 184 |
| 245 | 3300005457 | Ga0070662_100450243 | Ga0070662_1004502431 | 184 |
| 246 | 3300005458 | Ga0070681_10130574 | Ga0070681_101305742 | 184 |
| 247 | 3300005459 | Ga0068867_100033665 | Ga0068867_1000336654 | 184 |
| 248 | 3300005459 | Ga0068867_100218580 | Ga0068867_1002185802 | 184 |
| 249 | 3300005459 | Ga0068867_100450506 | Ga0068867_1004505062 | 184 |
| 250 | 3300005459 | Ga0068867_100535071 | Ga0068867_1005350712 | 184 |
| 251 | 3300005459 | Ga0068867_101136767 | Ga0068867_1011367671 | 184 |
| 252 | 3300005466 | Ga0070685_10480390 | Ga0070685_104803902 | 184 |
| 253 | 3300005530 | Ga0070679_100010948 | Ga0070679_1000109489 | 184 |
| 254 | 3300005530 | Ga0070679_100349390 | Ga0070679_1003493902 | 184 |
| 255 | 3300005535 | Ga0070684_100019585 | Ga0070684_1000195854 | 184 |
| 256 | 3300005535 | Ga0070684_100404076 | Ga0070684_1004040762 | 184 |
| 257 | 3300005539 | Ga0068853_100046393 | Ga0068853_1000463933 | 184 |
| 258 | 3300005539 | Ga0068853_100311331 | Ga0068853_1003113312 | 184 |
| 259 | 3300005539 | Ga0068853_100441130 | Ga0068853_1004411302 | 184 |
| 260 | 3300005539 | Ga0068853_100501800 | Ga0068853_1005018002 | 184 |
| 261 | 3300005543 | Ga0070672_100020940 | Ga0070672_1000209402 | 184 |
| 262 | 3300005543 | Ga0070672_100086261 | Ga0070672_1000862612 | 184 |
| 263 | 3300005543 | Ga0070672_100153963 | Ga0070672_1001539632 | 184 |
| 264 | 3300005543 | Ga0070672_100217852 | Ga0070672_1002178522 | 184 |
| 265 | 3300005543 | Ga0070672_100254895 | Ga0070672_1002548952 | 184 |
| 266 | 3300005543 | Ga0070672_100540988 | Ga0070672_1005409882 | 184 |
| 267 | 3300005543 | Ga0070672_100694902 | Ga0070672_1006949022 | 184 |
| 268 | 3300005544 | Ga0070686_100087148 | Ga0070686_1000871482 | 184 |
| 269 | 3300005563 | Ga0068855_100039058 | Ga0068855_1000390583 | 184 |
| 270 | 3300005564 | Ga0070664_100160693 | Ga0070664_1001606932 | 184 |
| 271 | 3300005564 | Ga0070664_100174782 | Ga0070664_1001747822 | 184 |
| 272 | 3300005564 | Ga0070664_100419519 | Ga0070664_1004195192 | 184 |
| 273 | 3300005564 | Ga0070664_100558804 | Ga0070664_1005588042 | 184 |
| 274 | 3300005577 | Ga0068857_100174217 | Ga0068857_1001742172 | 184 |
| 275 | 3300005578 | Ga0068854_100190261 | Ga0068854_1001902612 | 184 |
| 276 | 3300005578 | Ga0068854_100246187 | Ga0068854_1002461872 | 184 |
| 277 | 3300005614 | Ga0068856_100083350 | Ga0068856_1000833502 | 184 |
| 278 | 3300005614 | Ga0068856_100828582 | Ga0068856_1008285821 | 184 |
| 279 | 3300005615 | Ga0070702_100553015 | Ga0070702_1005530152 | 184 |
| 280 | 3300005616 | Ga0068852_100179606 | Ga0068852_1001796062 | 184 |
| 281 | 3300005616 | Ga0068852_100202806 | Ga0068852_1002028062 | 184 |
| 282 | 3300005616 | Ga0068852_100226474 | Ga0068852_1002264742 | 184 |
| 283 | 3300005616 | Ga0068852_100457566 | Ga0068852_1004575662 | 184 |
| 284 | 3300005616 | Ga0068852_100761867 | Ga0068852_1007618672 | 184 |
| 285 | 3300005616 | Ga0068852_100807435 | Ga0068852_1008074352 | 184 |
| 286 | 3300005616 | Ga0068852_100860374 | Ga0068852_1008603742 | 184 |
| 287 | 3300005616 | Ga0068852_100925284 | Ga0068852_1009252841 | 184 |
| 288 | 3300005616 | Ga0068852_101039117 | Ga0068852_1010391172 | 184 |
| 289 | 3300005617 | Ga0068859_100068114 | Ga0068859_1000681143 | 184 |
| 290 | 3300005618 | Ga0068864_100083775 | Ga0068864_1000837753 | 184 |
| 291 | 3300005618 | Ga0068864_100126759 | Ga0068864_1001267593 | 184 |
| 292 | 3300005618 | Ga0068864_100161904 | Ga0068864_1001619042 | 184 |
| 293 | 3300005618 | Ga0068864_100843530 | Ga0068864_1008435302 | 184 |
| 294 | 3300005718 | Ga0068866_10131381 | Ga0068866_101313811 | 184 |
| 295 | 3300005719 | Ga0068861_100011946 | Ga0068861_1000119465 | 184 |
| 296 | 3300005719 | Ga0068861_100067050 | Ga0068861_1000670502 | 184 |
| 297 | 3300005719 | Ga0068861_100443501 | Ga0068861_1004435012 | 184 |
| 298 | 3300005834 | Ga0068851_10169368 | Ga0068851_101693682 | 184 |
| 299 | 3300005834 | Ga0068851_10299336 | Ga0068851_102993362 | 184 |
| 300 | 3300005840 | Ga0068870_10349408 | Ga0068870_103494082 | 184 |
| 301 | 3300005841 | Ga0068863_100003466 | Ga0068863_1000034662 | 184 |
| 302 | 3300005841 | Ga0068863_100071438 | Ga0068863_1000714384 | 184 |
| 303 | 3300005841 | Ga0068863_100167627 | Ga0068863_1001676272 | 184 |
| 304 | 3300005841 | Ga0068863_100379684 | Ga0068863_1003796842 | 184 |
| 305 | 3300005841 | Ga0068863_100504607 | Ga0068863_1005046072 | 184 |
| 306 | 3300005842 | Ga0068858_100004898 | Ga0068858_10000489814 | 184 |
| 307 | 3300005842 | Ga0068858_100127377 | Ga0068858_1001273772 | 184 |
| 308 | 3300005843 | Ga0068860_100005443 | Ga0068860_1000054434 | 184 |
| 309 | 3300005843 | Ga0068860_100033915 | Ga0068860_1000339152 | 184 |
| 310 | 3300005843 | Ga0068860_100760658 | Ga0068860_1007606582 | 184 |
| 311 | 3300005844 | Ga0068862_100107966 | Ga0068862_1001079662 | 184 |
| 312 | 3300006048 | Ga0075363_100010846 | Ga0075363_1000108463 | 184 |
| 313 | 3300006048 | Ga0075363_100110179 | Ga0075363_1001101792 | 184 |
| 314 | 3300006051 | Ga0075364_10064338 | Ga0075364_100643382 | 184 |
| 315 | 3300006051 | Ga0075364_10079127 | Ga0075364_100791273 | 184 |
| 316 | 3300006058 | Ga0075432_10044377 | Ga0075432_100443772 | 184 |
| 317 | 3300006177 | Ga0075362_10007059 | Ga0075362_100070592 | 184 |
| 318 | 3300006177 | Ga0075362_10216834 | Ga0075362_102168342 | 184 |
| 319 | 3300006178 | Ga0075367_10092734 | Ga0075367_100927342 | 184 |
| 320 | 3300006195 | Ga0075366_10001983 | Ga0075366_100019834 | 184 |
| 321 | 3300006195 | Ga0075366_10512295 | Ga0075366_105122952 | 184 |
| 322 | 3300006237 | Ga0097621_100061406 | Ga0097621_1000614063 | 184 |
| 323 | 3300006237 | Ga0097621_100476730 | Ga0097621_1004767302 | 184 |
| 324 | 3300006237 | Ga0097621_100891985 | Ga0097621_1008919852 | 184 |
| 325 | 3300006237 | Ga0097621_101006728 | Ga0097621_1010067282 | 184 |
| 326 | 3300006237 | Ga0097621_101049719 | Ga0097621_1010497192 | 184 |
| 327 | 3300006353 | Ga0075370_10010702 | Ga0075370_100107022 | 184 |
| 328 | 3300006353 | Ga0075370_10231396 | Ga0075370_102313962 | 184 |
| 329 | 3300006358 | Ga0068871_100040497 | Ga0068871_1000404973 | 184 |
| 330 | 3300006358 | Ga0068871_100078417 | Ga0068871_1000784173 | 184 |
| 331 | 3300006358 | Ga0068871_100226512 | Ga0068871_1002265122 | 184 |
| 332 | 3300006358 | Ga0068871_100520155 | Ga0068871_1005201552 | 184 |
| 333 | 3300006880 | Ga0075429_101371786 | Ga0075429_1013717861 | 184 |
| 334 | 3300006881 | Ga0068865_100017528 | Ga0068865_1000175282 | 184 |
| 335 | 3300006881 | Ga0068865_100880386 | Ga0068865_1008803861 | 184 |
| 336 | 3300006931 | Ga0097620_100068114 | Ga0097620_1000681143 | 184 |
| 337 | 3300006946 | Ga0079104_1011880 | Ga0079104_10118802 | 184 |
| 338 | 3300006948 | Ga0099826_10000087 | Ga0099826_100000878 | 184 |
| 339 | 3300006948 | Ga0099826_10073699 | Ga0099826_100736992 | 184 |
| 340 | 3300006948 | Ga0099826_10106542 | Ga0099826_101065422 | 184 |
| 341 | 3300009092 | Ga0105250_10099215 | Ga0105250_100992152 | 184 |
| 342 | 3300009093 | Ga0105240_11660554 | Ga0105240_116605541 | 184 |
| 343 | 3300009094 | Ga0111539_11389437 | Ga0111539_113894371 | 184 |
| 344 | 3300009098 | Ga0105245_10380447 | Ga0105245_103804472 | 184 |
| 345 | 3300009098 | Ga0105245_11357543 | Ga0105245_113575432 | 184 |
| 346 | 3300009148 | Ga0105243_10068322 | Ga0105243_100683222 | 184 |
| 347 | 3300009176 | Ga0105242_10210395 | Ga0105242_102103952 | 184 |
| 348 | 3300009176 | Ga0105242_10369020 | Ga0105242_103690202 | 184 |
| 349 | 3300009176 | Ga0105242_10704672 | Ga0105242_107046722 | 184 |
| 350 | 3300009177 | Ga0105248_10051302 | Ga0105248_100513025 | 184 |
| 351 | 3300009177 | Ga0105248_10234103 | Ga0105248_102341032 | 184 |
| 352 | 3300009177 | Ga0105248_10274624 | Ga0105248_102746242 | 184 |
| 353 | 3300009177 | Ga0105248_10895276 | Ga0105248_108952762 | 184 |
| 354 | 3300009177 | Ga0105248_11090375 | Ga0105248_110903751 | 184 |
| 355 | 3300009177 | Ga0105248_11137738 | Ga0105248_111377382 | 184 |
| 356 | 3300009545 | Ga0105237_10060033 | Ga0105237_100600333 | 184 |
| 357 | 3300009551 | Ga0105238_10188351 | Ga0105238_101883512 | 184 |
| 358 | 3300009551 | Ga0105238_10768242 | Ga0105238_107682422 | 184 |
| 359 | 3300009551 | Ga0105238_11194564 | Ga0105238_111945642 | 184 |
| 360 | 3300009553 | Ga0105249_10050443 | Ga0105249_100504432 | 184 |
| 361 | 3300009553 | Ga0105249_10753312 | Ga0105249_107533121 | 184 |
| 362 | 3300010375 | Ga0105239_10066299 | Ga0105239_100662993 | 184 |
| 363 | 3300011119 | Ga0105246_10524362 | Ga0105246_105243622 | 184 |
| 364 | 3300012495 | Ga0157323_1002135 | Ga0157323_10021352 | 184 |
| 365 | 3300012502 | Ga0157347_1000221 | Ga0157347_10002212 | 184 |
| 366 | 3300012512 | Ga0157327_1000947 | Ga0157327_10009471 | 184 |
| 367 | 3300012513 | Ga0157326_1000451 | Ga0157326_10004512 | 184 |
| 368 | 3300013100 | Ga0157373_10199882 | Ga0157373_101998822 | 184 |
| 369 | 3300013104 | Ga0157370_10003845 | Ga0157370_1000384517 | 184 |
| 370 | 3300013104 | Ga0157370_10188740 | Ga0157370_101887402 | 184 |
| 371 | 3300013104 | Ga0157370_10912150 | Ga0157370_109121501 | 184 |
| 372 | 3300013104 | Ga0157370_10998864 | Ga0157370_109988641 | 184 |
| 373 | 3300013105 | Ga0157369_10166440 | Ga0157369_101664402 | 184 |
| 374 | 3300013105 | Ga0157369_11133031 | Ga0157369_111330312 | 184 |
| 375 | 3300013296 | Ga0157374_10037741 | Ga0157374_100377413 | 184 |
| 376 | 3300013296 | Ga0157374_10992622 | Ga0157374_109926222 | 184 |
| 377 | 3300013297 | Ga0157378_10664449 | Ga0157378_106644491 | 184 |
| 378 | 3300013297 | Ga0157378_10832512 | Ga0157378_108325122 | 184 |
| 379 | 3300013306 | Ga0163162_10038435 | Ga0163162_100384355 | 184 |
| 380 | 3300013306 | Ga0163162_10222435 | Ga0163162_102224352 | 184 |
| 381 | 3300013306 | Ga0163162_10339447 | Ga0163162_103394472 | 184 |
| 382 | 3300013306 | Ga0163162_10688500 | Ga0163162_106885002 | 184 |
| 383 | 3300013306 | Ga0163162_10758646 | Ga0163162_107586462 | 184 |
| 384 | 3300013307 | Ga0157372_10355864 | Ga0157372_103558642 | 184 |
| 385 | 3300013308 | Ga0157375_10125411 | Ga0157375_101254112 | 184 |
| 386 | 3300013308 | Ga0157375_10702613 | Ga0157375_107026132 | 184 |
| 387 | 3300013308 | Ga0157375_10736169 | Ga0157375_107361692 | 184 |
| 388 | 3300013308 | Ga0157375_10759448 | Ga0157375_107594482 | 184 |
| 389 | 3300013308 | Ga0157375_10763925 | Ga0157375_107639252 | 184 |
| 390 | 3300014325 | Ga0163163_10704698 | Ga0163163_107046982 | 184 |
| 391 | 3300014326 | Ga0157380_10019496 | Ga0157380_100194964 | 184 |
| 392 | 3300014326 | Ga0157380_10019525 | Ga0157380_100195256 | 184 |
| 393 | 3300014326 | Ga0157380_10176244 | Ga0157380_101762442 | 184 |
| 394 | 3300014326 | Ga0157380_10218221 | Ga0157380_102182212 | 184 |
| 395 | 3300014497 | Ga0182008_10008214 | Ga0182008_100082142 | 184 |
| 396 | 3300014497 | Ga0182008_10119643 | Ga0182008_101196432 | 184 |
| 397 | 3300014745 | Ga0157377_10012265 | Ga0157377_100122655 | 184 |
| 398 | 3300014745 | Ga0157377_10197256 | Ga0157377_101972561 | 184 |
| 399 | 3300014968 | Ga0157379_10318866 | Ga0157379_103188662 | 184 |
| 400 | 3300014968 | Ga0157379_10398164 | Ga0157379_103981642 | 184 |
| 401 | 3300014969 | Ga0157376_10103751 | Ga0157376_101037513 | 184 |
| 402 | 3300014969 | Ga0157376_10257822 | Ga0157376_102578222 | 184 |
| 403 | 3300014969 | Ga0157376_10830816 | Ga0157376_108308162 | 184 |
| 404 | 3300015261 | Ga0182006_1017723 | Ga0182006_10177233 | 184 |
| 405 | 3300015261 | Ga0182006_1079020 | Ga0182006_10790202 | 184 |
| 406 | 3300015262 | Ga0182007_10021566 | Ga0182007_100215662 | 184 |
| 407 | 3300017792 | Ga0163161_10000329 | Ga0163161_1000032911 | 184 |
| 408 | 3300017792 | Ga0163161_10013701 | Ga0163161_100137015 | 184 |
| 409 | 3300017792 | Ga0163161_10053805 | Ga0163161_100538052 | 184 |
| 410 | 3300017792 | Ga0163161_10321025 | Ga0163161_103210252 | 184 |
| 411 | 3300017792 | Ga0163161_10362833 | Ga0163161_103628332 | 184 |
| 412 | 3300017792 | Ga0163161_11166137 | Ga0163161_111661371 | 184 |
| 413 | 3300025206 | Ga0209435_100003 | Ga0209435_100003139 | 184 |
| 414 | 3300025208 | Ga0209436_105046 | Ga0209436_1050464 | 184 |
| 415 | 3300025245 | Ga0207425_1001243 | Ga0207425_10012439 | 184 |
| 416 | 3300025245 | Ga0207425_1007648 | Ga0207425_10076482 | 184 |
| 417 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008139 | 184 |
| 418 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007139 | 184 |
| 419 | 3300025256 | Ga0209759_1000026 | Ga0209759_1000026141 | 184 |
| 420 | 3300025258 | Ga0209129_1007409 | Ga0209129_10074092 | 184 |
| 421 | 3300025258 | Ga0209129_1032236 | Ga0209129_10322361 | 184 |
| 422 | 3300025263 | Ga0209565_1000026 | Ga0209565_1000026342 | 184 |
| 423 | 3300025263 | Ga0209565_1000150 | Ga0209565_100015037 | 184 |
| 424 | 3300025263 | Ga0209565_1001312 | Ga0209565_10013128 | 184 |
| 425 | 3300025263 | Ga0209565_1061899 | Ga0209565_10618991 | 184 |
| 426 | 3300025273 | Ga0209673_1000009 | Ga0209673_1000009349 | 184 |
| 427 | 3300025273 | Ga0209673_1000012 | Ga0209673_1000012250 | 184 |
| 428 | 3300025273 | Ga0209673_1000114 | Ga0209673_1000114119 | 184 |
| 429 | 3300025273 | Ga0209673_1008634 | Ga0209673_10086343 | 184 |
| 430 | 3300025273 | Ga0209673_1066189 | Ga0209673_10661892 | 184 |
| 431 | 3300025284 | Ga0209130_1000099 | Ga0209130_100009992 | 184 |
| 432 | 3300025284 | Ga0209130_1000123 | Ga0209130_10001234 | 184 |
| 433 | 3300025284 | Ga0209130_1006153 | Ga0209130_10061533 | 184 |
| 434 | 3300025291 | Ga0209675_1000062 | Ga0209675_1000062119 | 184 |
| 435 | 3300025291 | Ga0209675_1000155 | Ga0209675_100015513 | 184 |
| 436 | 3300025291 | Ga0209675_1004791 | Ga0209675_10047912 | 184 |
| 437 | 3300025291 | Ga0209675_1005864 | Ga0209675_10058642 | 184 |
| 438 | 3300025292 | Ga0209676_1000051 | Ga0209676_1000051118 | 184 |
| 439 | 3300025292 | Ga0209676_1000325 | Ga0209676_100032557 | 184 |
| 440 | 3300025292 | Ga0209676_1008862 | Ga0209676_10088623 | 184 |
| 441 | 3300025294 | Ga0209025_1004061 | Ga0209025_10040619 | 184 |
| 442 | 3300025294 | Ga0209025_1007738 | Ga0209025_10077389 | 184 |
| 443 | 3300025294 | Ga0209025_1009286 | Ga0209025_10092868 | 184 |
| 444 | 3300025294 | Ga0209025_1016364 | Ga0209025_10163644 | 184 |
| 445 | 3300025295 | Ga0209564_1000211 | Ga0209564_100021124 | 184 |
| 446 | 3300025295 | Ga0209564_1000228 | Ga0209564_100022824 | 184 |
| 447 | 3300025295 | Ga0209564_1004815 | Ga0209564_10048155 | 184 |
| 448 | 3300025297 | Ga0209758_1083564 | Ga0209758_10835642 | 184 |
| 449 | 3300025298 | Ga0209050_1000044 | Ga0209050_1000044228 | 184 |
| 450 | 3300025298 | Ga0209050_1003950 | Ga0209050_10039504 | 184 |
| 451 | 3300025298 | Ga0209050_1010312 | Ga0209050_10103122 | 184 |
| 452 | 3300025298 | Ga0209050_1038509 | Ga0209050_10385092 | 184 |
| 453 | 3300025298 | Ga0209050_1057750 | Ga0209050_10577502 | 184 |
| 454 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003504 | 184 |
| 455 | 3300025299 | Ga0209256_1025111 | Ga0209256_10251112 | 184 |
| 456 | 3300025302 | Ga0207426_1000062 | Ga0207426_1000062257 | 184 |
| 457 | 3300025303 | Ga0209051_1000031 | Ga0209051_1000031228 | 184 |
| 458 | 3300025303 | Ga0209051_1000208 | Ga0209051_100020826 | 184 |
| 459 | 3300025303 | Ga0209051_1000760 | Ga0209051_100076028 | 184 |
| 460 | 3300025303 | Ga0209051_1060818 | Ga0209051_10608182 | 184 |
| 461 | 3300025304 | Ga0209257_1000058 | Ga0209257_1000058222 | 184 |
| 462 | 3300025304 | Ga0209257_1008393 | Ga0209257_10083934 | 184 |
| 463 | 3300025304 | Ga0209257_1013462 | Ga0209257_10134623 | 184 |
| 464 | 3300025315 | Ga0207697_10032926 | Ga0207697_100329263 | 184 |
| 465 | 3300025315 | Ga0207697_10241147 | Ga0207697_102411472 | 184 |
| 466 | 3300025315 | Ga0207697_10255735 | Ga0207697_102557352 | 184 |
| 467 | 3300025321 | Ga0207656_10062842 | Ga0207656_100628422 | 184 |
| 468 | 3300025893 | Ga0207682_10009146 | Ga0207682_100091462 | 184 |
| 469 | 3300025893 | Ga0207682_10038424 | Ga0207682_100384242 | 184 |
| 470 | 3300025893 | Ga0207682_10061961 | Ga0207682_100619612 | 184 |
| 471 | 3300025893 | Ga0207682_10154994 | Ga0207682_101549942 | 184 |
| 472 | 3300025899 | Ga0207642_10015639 | Ga0207642_100156393 | 184 |
| 473 | 3300025901 | Ga0207688_10033243 | Ga0207688_100332432 | 184 |
| 474 | 3300025901 | Ga0207688_10148393 | Ga0207688_101483932 | 184 |
| 475 | 3300025901 | Ga0207688_10234204 | Ga0207688_102342042 | 184 |
| 476 | 3300025903 | Ga0207680_10363368 | Ga0207680_103633682 | 184 |
| 477 | 3300025903 | Ga0207680_10719171 | Ga0207680_107191712 | 184 |
| 478 | 3300025907 | Ga0207645_10007091 | Ga0207645_100070915 | 184 |
| 479 | 3300025907 | Ga0207645_10027206 | Ga0207645_100272063 | 184 |
| 480 | 3300025907 | Ga0207645_10202394 | Ga0207645_102023942 | 184 |
| 481 | 3300025907 | Ga0207645_10401707 | Ga0207645_104017072 | 184 |
| 482 | 3300025912 | Ga0207707_10208990 | Ga0207707_102089902 | 184 |
| 483 | 3300025914 | Ga0207671_10162669 | Ga0207671_101626691 | 184 |
| 484 | 3300025917 | Ga0207660_10007738 | Ga0207660_100077382 | 184 |
| 485 | 3300025918 | Ga0207662_10036429 | Ga0207662_100364292 | 184 |
| 486 | 3300025918 | Ga0207662_10063557 | Ga0207662_100635572 | 184 |
| 487 | 3300025918 | Ga0207662_10325602 | Ga0207662_103256021 | 184 |
| 488 | 3300025920 | Ga0207649_10450638 | Ga0207649_104506382 | 184 |
| 489 | 3300025921 | Ga0207652_10005260 | Ga0207652_100052602 | 184 |
| 490 | 3300025923 | Ga0207681_10018416 | Ga0207681_100184164 | 184 |
| 491 | 3300025923 | Ga0207681_10043750 | Ga0207681_100437504 | 184 |
| 492 | 3300025923 | Ga0207681_10402397 | Ga0207681_104023972 | 184 |
| 493 | 3300025923 | Ga0207681_10465468 | Ga0207681_104654682 | 184 |
| 494 | 3300025924 | Ga0207694_10076303 | Ga0207694_100763033 | 184 |
| 495 | 3300025925 | Ga0207650_10023527 | Ga0207650_100235272 | 184 |
| 496 | 3300025925 | Ga0207650_10069686 | Ga0207650_100696862 | 184 |
| 497 | 3300025925 | Ga0207650_10178246 | Ga0207650_101782462 | 184 |
| 498 | 3300025925 | Ga0207650_10189625 | Ga0207650_101896252 | 184 |
| 499 | 3300025925 | Ga0207650_10254052 | Ga0207650_102540522 | 184 |
| 500 | 3300025925 | Ga0207650_10357721 | Ga0207650_103577212 | 184 |
| 501 | 3300025925 | Ga0207650_10442076 | Ga0207650_104420762 | 184 |
| 502 | 3300025925 | Ga0207650_10507514 | Ga0207650_105075142 | 184 |
| 503 | 3300025925 | Ga0207650_10572600 | Ga0207650_105726002 | 184 |
| 504 | 3300025926 | Ga0207659_10020490 | Ga0207659_100204903 | 184 |
| 505 | 3300025926 | Ga0207659_10138499 | Ga0207659_101384992 | 184 |
| 506 | 3300025926 | Ga0207659_10260594 | Ga0207659_102605942 | 184 |
| 507 | 3300025926 | Ga0207659_10504640 | Ga0207659_105046402 | 184 |
| 508 | 3300025926 | Ga0207659_10693881 | Ga0207659_106938811 | 184 |
| 509 | 3300025927 | Ga0207687_10231983 | Ga0207687_102319832 | 184 |
| 510 | 3300025927 | Ga0207687_10241112 | Ga0207687_102411122 | 184 |
| 511 | 3300025932 | Ga0207690_10095883 | Ga0207690_100958832 | 184 |
| 512 | 3300025932 | Ga0207690_10503538 | Ga0207690_105035382 | 184 |
| 513 | 3300025933 | Ga0207706_10045478 | Ga0207706_100454785 | 184 |
| 514 | 3300025933 | Ga0207706_10152950 | Ga0207706_101529502 | 184 |
| 515 | 3300025933 | Ga0207706_10206870 | Ga0207706_102068702 | 184 |
| 516 | 3300025933 | Ga0207706_10661657 | Ga0207706_106616572 | 184 |
| 517 | 3300025934 | Ga0207686_10071853 | Ga0207686_100718532 | 184 |
| 518 | 3300025934 | Ga0207686_10201916 | Ga0207686_102019162 | 184 |
| 519 | 3300025935 | Ga0207709_10021397 | Ga0207709_100213973 | 184 |
| 520 | 3300025935 | Ga0207709_10120378 | Ga0207709_101203782 | 184 |
| 521 | 3300025937 | Ga0207669_10026733 | Ga0207669_100267332 | 184 |
| 522 | 3300025937 | Ga0207669_10186688 | Ga0207669_101866882 | 184 |
| 523 | 3300025937 | Ga0207669_10515161 | Ga0207669_105151612 | 184 |
| 524 | 3300025938 | Ga0207704_10217717 | Ga0207704_102177172 | 184 |
| 525 | 3300025939 | Ga0207665_10062982 | Ga0207665_100629822 | 184 |
| 526 | 3300025940 | Ga0207691_10017865 | Ga0207691_100178656 | 184 |
| 527 | 3300025940 | Ga0207691_10038713 | Ga0207691_100387135 | 184 |
| 528 | 3300025940 | Ga0207691_10168616 | Ga0207691_101686162 | 184 |
| 529 | 3300025940 | Ga0207691_10196626 | Ga0207691_101966262 | 184 |
| 530 | 3300025940 | Ga0207691_10204227 | Ga0207691_102042272 | 184 |
| 531 | 3300025940 | Ga0207691_10320459 | Ga0207691_103204592 | 184 |
| 532 | 3300025940 | Ga0207691_10472773 | Ga0207691_104727732 | 184 |
| 533 | 3300025940 | Ga0207691_10633375 | Ga0207691_106333752 | 184 |
| 534 | 3300025941 | Ga0207711_10019765 | Ga0207711_100197655 | 184 |
| 535 | 3300025941 | Ga0207711_10054755 | Ga0207711_100547552 | 184 |
| 536 | 3300025941 | Ga0207711_10679055 | Ga0207711_106790552 | 184 |
| 537 | 3300025941 | Ga0207711_10680977 | Ga0207711_106809772 | 184 |
| 538 | 3300025942 | Ga0207689_10001957 | Ga0207689_1000195716 | 184 |
| 539 | 3300025942 | Ga0207689_10057292 | Ga0207689_100572922 | 184 |
| 540 | 3300025942 | Ga0207689_10295671 | Ga0207689_102956712 | 184 |
| 541 | 3300025944 | Ga0207661_10382422 | Ga0207661_103824221 | 184 |
| 542 | 3300025945 | Ga0207679_10277308 | Ga0207679_102773082 | 184 |
| 543 | 3300025945 | Ga0207679_10360161 | Ga0207679_103601612 | 184 |
| 544 | 3300025945 | Ga0207679_10559851 | Ga0207679_105598512 | 184 |
| 545 | 3300025945 | Ga0207679_10693491 | Ga0207679_106934912 | 184 |
| 546 | 3300025960 | Ga0207651_10048641 | Ga0207651_100486412 | 184 |
| 547 | 3300025960 | Ga0207651_10198016 | Ga0207651_101980162 | 184 |
| 548 | 3300025960 | Ga0207651_10597533 | Ga0207651_105975332 | 184 |
| 549 | 3300025961 | Ga0207712_10085529 | Ga0207712_100855292 | 184 |
| 550 | 3300025961 | Ga0207712_10312278 | Ga0207712_103122782 | 184 |
| 551 | 3300025961 | Ga0207712_10665561 | Ga0207712_106655612 | 184 |
| 552 | 3300025972 | Ga0207668_10013103 | Ga0207668_100131036 | 184 |
| 553 | 3300025972 | Ga0207668_10140566 | Ga0207668_101405662 | 184 |
| 554 | 3300025972 | Ga0207668_10256489 | Ga0207668_102564892 | 184 |
| 555 | 3300025986 | Ga0207658_10040984 | Ga0207658_100409842 | 184 |
| 556 | 3300025986 | Ga0207658_10086776 | Ga0207658_100867763 | 184 |
| 557 | 3300025986 | Ga0207658_10358044 | Ga0207658_103580442 | 184 |
| 558 | 3300026023 | Ga0207677_10013473 | Ga0207677_100134732 | 184 |
| 559 | 3300026035 | Ga0207703_10007902 | Ga0207703_100079023 | 184 |
| 560 | 3300026035 | Ga0207703_10021291 | Ga0207703_100212915 | 184 |
| 561 | 3300026035 | Ga0207703_10252155 | Ga0207703_102521552 | 184 |
| 562 | 3300026041 | Ga0207639_10016030 | Ga0207639_100160304 | 184 |
| 563 | 3300026041 | Ga0207639_11478983 | Ga0207639_114789831 | 184 |
| 564 | 3300026067 | Ga0207678_10360782 | Ga0207678_103607822 | 184 |
| 565 | 3300026067 | Ga0207678_10677685 | Ga0207678_106776851 | 184 |
| 566 | 3300026075 | Ga0207708_10211045 | Ga0207708_102110452 | 184 |
| 567 | 3300026075 | Ga0207708_10557909 | Ga0207708_105579092 | 184 |
| 568 | 3300026078 | Ga0207702_10121901 | Ga0207702_101219013 | 184 |
| 569 | 3300026088 | Ga0207641_10012091 | Ga0207641_100120917 | 184 |
| 570 | 3300026088 | Ga0207641_10021771 | Ga0207641_100217716 | 184 |
| 571 | 3300026088 | Ga0207641_10677285 | Ga0207641_106772852 | 184 |
| 572 | 3300026088 | Ga0207641_10860190 | Ga0207641_108601902 | 184 |
| 573 | 3300026089 | Ga0207648_10120272 | Ga0207648_101202723 | 184 |
| 574 | 3300026089 | Ga0207648_10177046 | Ga0207648_101770462 | 184 |
| 575 | 3300026089 | Ga0207648_10210706 | Ga0207648_102107061 | 184 |
| 576 | 3300026089 | Ga0207648_10399361 | Ga0207648_103993612 | 184 |
| 577 | 3300026089 | Ga0207648_10479927 | Ga0207648_104799272 | 184 |
| 578 | 3300026089 | Ga0207648_10614029 | Ga0207648_106140292 | 184 |
| 579 | 3300026095 | Ga0207676_10005921 | Ga0207676_100059219 | 184 |
| 580 | 3300026095 | Ga0207676_10037212 | Ga0207676_100372122 | 184 |
| 581 | 3300026095 | Ga0207676_10067533 | Ga0207676_100675333 | 184 |
| 582 | 3300026095 | Ga0207676_10342735 | Ga0207676_103427352 | 184 |
| 583 | 3300026095 | Ga0207676_10996626 | Ga0207676_109966261 | 184 |
| 584 | 3300026095 | Ga0207676_11214535 | Ga0207676_112145352 | 184 |
| 585 | 3300026116 | Ga0207674_10205009 | Ga0207674_102050092 | 184 |
| 586 | 3300026116 | Ga0207674_11105118 | Ga0207674_111051182 | 184 |
| 587 | 3300026118 | Ga0207675_100004245 | Ga0207675_1000042453 | 184 |
| 588 | 3300026118 | Ga0207675_100004891 | Ga0207675_1000048915 | 184 |
| 589 | 3300026118 | Ga0207675_100563902 | Ga0207675_1005639022 | 184 |
| 590 | 3300026118 | Ga0207675_100782674 | Ga0207675_1007826742 | 184 |
| 591 | 3300026118 | Ga0207675_100927088 | Ga0207675_1009270882 | 184 |
| 592 | 3300026121 | Ga0207683_10009318 | Ga0207683_100093186 | 184 |
| 593 | 3300026121 | Ga0207683_10037761 | Ga0207683_100377612 | 184 |
| 594 | 3300026121 | Ga0207683_10051292 | Ga0207683_100512923 | 184 |
| 595 | 3300026121 | Ga0207683_10066018 | Ga0207683_100660182 | 184 |
| 596 | 3300026121 | Ga0207683_10269765 | Ga0207683_102697652 | 184 |
| 597 | 3300026121 | Ga0207683_10458882 | Ga0207683_104588822 | 184 |
| 598 | 3300026121 | Ga0207683_10553535 | Ga0207683_105535352 | 184 |
| 599 | 3300026121 | Ga0207683_10606326 | Ga0207683_106063261 | 184 |
| 600 | 3300026142 | Ga0207698_10183741 | Ga0207698_101837412 | 184 |
| 601 | 3300026142 | Ga0207698_10669334 | Ga0207698_106693342 | 184 |
| 602 | 3300026142 | Ga0207698_10804346 | Ga0207698_108043462 | 184 |
| 603 | 3300026142 | Ga0207698_10858230 | Ga0207698_108582302 | 184 |
| 604 | 3300026142 | Ga0207698_11257245 | Ga0207698_112572452 | 184 |
| 605 | 3300027111 | Ga0209281_1023406 | Ga0209281_10234062 | 184 |
| 606 | 3300027666 | Ga0209282_1000307 | Ga0209282_10003074 | 184 |
| 607 | 3300028379 | Ga0268266_11040786 | Ga0268266_110407861 | 184 |
| 608 | 3300028380 | Ga0268265_10118750 | Ga0268265_101187502 | 184 |
| 609 | 3300028380 | Ga0268265_10979518 | Ga0268265_109795181 | 184 |
| 610 | 3300028381 | Ga0268264_10004057 | Ga0268264_100040579 | 184 |
| 611 | 3300028381 | Ga0268264_10015030 | Ga0268264_100150302 | 184 |
| 612 | 3300028794 | Ga0307515_10000064 | Ga0307515_10000064112 | 184 |
| 613 | 3300030735 | Ga0316178_1126380 | Ga0316178_11263803 | 184 |
| 614 | 3300030742 | Ga0316183_1110495 | Ga0316183_11104952 | 184 |
| 615 | 3300030745 | Ga0316182_1084678 | Ga0316182_10846782 | 184 |
| 616 | 3300031456 | Ga0307513_10000090 | Ga0307513_1000009038 | 184 |
| 617 | 3300031456 | Ga0307513_10116438 | Ga0307513_101164383 | 184 |
| 618 | 3300031456 | Ga0307513_10499229 | Ga0307513_104992292 | 184 |
| 619 | 3300031548 | Ga0307408_100005621 | Ga0307408_1000056211 | 184 |
| 620 | 3300031548 | Ga0307408_100039727 | Ga0307408_1000397272 | 184 |
| 621 | 3300031548 | Ga0307408_100086585 | Ga0307408_1000865852 | 184 |
| 622 | 3300031548 | Ga0307408_100096359 | Ga0307408_1000963592 | 184 |
| 623 | 3300031548 | Ga0307408_100132717 | Ga0307408_1001327172 | 184 |
| 624 | 3300031548 | Ga0307408_100304331 | Ga0307408_1003043312 | 184 |
| 625 | 3300031548 | Ga0307408_100422714 | Ga0307408_1004227142 | 184 |
| 626 | 3300031548 | Ga0307408_100438115 | Ga0307408_1004381152 | 184 |
| 627 | 3300031548 | Ga0307408_100530569 | Ga0307408_1005305692 | 184 |
| 628 | 3300031649 | Ga0307514_10011166 | Ga0307514_100111663 | 184 |
| 629 | 3300031731 | Ga0307405_10005918 | Ga0307405_100059185 | 184 |
| 630 | 3300031731 | Ga0307405_10037668 | Ga0307405_100376684 | 184 |
| 631 | 3300031731 | Ga0307405_10073841 | Ga0307405_100738412 | 184 |
| 632 | 3300031731 | Ga0307405_10086027 | Ga0307405_100860272 | 184 |
| 633 | 3300031731 | Ga0307405_10098412 | Ga0307405_100984122 | 184 |
| 634 | 3300031731 | Ga0307405_10176158 | Ga0307405_101761582 | 184 |
| 635 | 3300031731 | Ga0307405_10202895 | Ga0307405_102028952 | 184 |
| 636 | 3300031731 | Ga0307405_10421922 | Ga0307405_104219222 | 184 |
| 637 | 3300031731 | Ga0307405_10491745 | Ga0307405_104917452 | 184 |
| 638 | 3300031824 | Ga0307413_10056403 | Ga0307413_100564032 | 184 |
| 639 | 3300031824 | Ga0307413_10221699 | Ga0307413_102216992 | 184 |
| 640 | 3300031824 | Ga0307413_10842566 | Ga0307413_108425661 | 184 |
| 641 | 3300031852 | Ga0307410_10042903 | Ga0307410_100429033 | 184 |
| 642 | 3300031852 | Ga0307410_10052712 | Ga0307410_100527122 | 184 |
| 643 | 3300031852 | Ga0307410_10413332 | Ga0307410_104133322 | 184 |
| 644 | 3300031901 | Ga0307406_10006495 | Ga0307406_100064958 | 184 |
| 645 | 3300031901 | Ga0307406_10018017 | Ga0307406_100180174 | 184 |
| 646 | 3300031901 | Ga0307406_10056965 | Ga0307406_100569653 | 184 |
| 647 | 3300031901 | Ga0307406_10252847 | Ga0307406_102528472 | 184 |
| 648 | 3300031901 | Ga0307406_10376040 | Ga0307406_103760402 | 184 |
| 649 | 3300031901 | Ga0307406_10431824 | Ga0307406_104318242 | 184 |
| 650 | 3300031901 | Ga0307406_10491338 | Ga0307406_104913382 | 184 |
| 651 | 3300031901 | Ga0307406_10706521 | Ga0307406_107065212 | 184 |
| 652 | 3300031903 | Ga0307407_10039408 | Ga0307407_100394082 | 184 |
| 653 | 3300031903 | Ga0307407_10259091 | Ga0307407_102590911 | 184 |
| 654 | 3300031911 | Ga0307412_10002222 | Ga0307412_100022228 | 184 |
| 655 | 3300031911 | Ga0307412_10029007 | Ga0307412_100290073 | 184 |
| 656 | 3300031911 | Ga0307412_10046332 | Ga0307412_100463323 | 184 |
| 657 | 3300031911 | Ga0307412_10071053 | Ga0307412_100710532 | 184 |
| 658 | 3300031911 | Ga0307412_10163776 | Ga0307412_101637762 | 184 |
| 659 | 3300031911 | Ga0307412_10249457 | Ga0307412_102494571 | 184 |
| 660 | 3300031911 | Ga0307412_10475267 | Ga0307412_104752672 | 184 |
| 661 | 3300031995 | Ga0307409_100000592 | Ga0307409_10000059213 | 184 |
| 662 | 3300032002 | Ga0307416_100006736 | Ga0307416_1000067365 | 184 |
| 663 | 3300032002 | Ga0307416_100030125 | Ga0307416_1000301254 | 184 |
| 664 | 3300032002 | Ga0307416_100078038 | Ga0307416_1000780383 | 184 |
| 665 | 3300032002 | Ga0307416_100093935 | Ga0307416_1000939353 | 184 |
| 666 | 3300032002 | Ga0307416_100176293 | Ga0307416_1001762932 | 184 |
| 667 | 3300032002 | Ga0307416_100214103 | Ga0307416_1002141032 | 184 |
| 668 | 3300032004 | Ga0307414_10011967 | Ga0307414_100119672 | 184 |
| 669 | 3300032004 | Ga0307414_10223393 | Ga0307414_102233932 | 184 |
| 670 | 3300032004 | Ga0307414_10385631 | Ga0307414_103856312 | 184 |
| 671 | 3300032004 | Ga0307414_10418882 | Ga0307414_104188822 | 184 |
| 672 | 3300032004 | Ga0307414_10888273 | Ga0307414_108882732 | 184 |
| 673 | 3300032005 | Ga0307411_10080376 | Ga0307411_100803762 | 184 |
| 674 | 3300032126 | Ga0307415_100002275 | Ga0307415_1000022752 | 184 |
| 675 | 3300032126 | Ga0307415_100454217 | Ga0307415_1004542172 | 184 |
| 676 | 3300035089 | Ga0373944_0292425 | Ga0373944_0292425_31_591 | 184 |
| 677 | 3300035172 | Ga0373955_0116903 | Ga0373955_0116903_628_1185 | 184 |
| 678 | 3300035691 | Ga0373931_0045475 | Ga0373931_0045475_1091_1660 | 184 |
| 679 | 3300035692 | Ga0373935_0338915 | Ga0373935_0338915_412_969 | 184 |
| 680 | 3300035692 | Ga0373935_0509997 | Ga0373935_0509997_154_714 | 184 |
| 681 | 3300035695 | Ga0373927_0219919 | Ga0373927_0219919_38_598 | 184 |
| 682 | 3300036401 | Ga0373937_0423920 | Ga0373937_0423920_237_794 | 184 |
| 683 | 3300037312 | Ga0395899_0003326 | Ga0395899_0003326_7455_8048 | 184 |
| 684 | 3300037466 | Ga0395898_0007717 | Ga0395898_0007717_4626_5219 | 184 |
| 685 | 3300037471 | Ga0395905_0000492 | Ga0395905_0000492_15757_16350 | 184 |
| 686 | 3300037471 | Ga0395905_0005285 | Ga0395905_0005285_3175_3768 | 184 |
| 687 | 3300038443 | Ga0395901_0345743 | Ga0395901_0345743_155_748 | 184 |
| 688 | 3300041404 | Ga0439436_0044193 | Ga0439436_0044193_212_769 | 184 |
| 689 | 3300041406 | Ga0439439_0017080 | Ga0439439_0017080_419_976 | 184 |
| 690 | 3300041407 | Ga0439447_014294 | Ga0439447_014294_1617_2174 | 184 |
| 691 | 3300041407 | Ga0439447_035437 | Ga0439447_035437_365_922 | 184 |
| 692 | 3300041411 | Ga0439466_0008218 | Ga0439466_0008218_1645_2202 | 184 |
| 693 | 3300041411 | Ga0439466_0012417 | Ga0439466_0012417_2140_2697 | 184 |
| 694 | 3300041411 | Ga0439466_0128780 | Ga0439466_0128780_109_666 | 184 |
| 695 | 3300041413 | Ga0439465_0021445 | Ga0439465_0021445_495_1052 | 184 |
| 696 | 3300041443 | Ga0451789_0567393 | Ga0451789_0567393_613_1191 | 184 |
| 697 | 3300041451 | Ga0451791_1410299 | Ga0451791_1410299_31_585 | 184 |
| 698 | 3300041456 | Ga0451795_1340527 | Ga0451795_1340527_33_590 | 184 |
| 699 | 3300041494 | Ga0451837_0128052 | Ga0451837_0128052_432_992 | 184 |
| 700 | 3300041496 | Ga0451839_0069363 | Ga0451839_0069363_19_573 | 184 |
| 701 | 3300041509 | Ga0451843_0600576 | Ga0451843_0600576_346_903 | 184 |
| 702 | 3300041512 | Ga0451853_2861878 | Ga0451853_2861878_1244_1804 | 184 |
| 703 | 3300041997 | Ga0439431_0034770 | Ga0439431_0034770_373_930 | 184 |
| 704 | 3300041997 | Ga0439431_0063027 | Ga0439431_0063027_76_636 | 184 |
| 705 | 3300041999 | Ga0439433_0008170 | Ga0439433_0008170_1150_1707 | 184 |
| 706 | 3300042002 | Ga0439442_030730 | Ga0439442_030730_436_993 | 184 |
| 707 | 3300042004 | Ga0439445_0001503 | Ga0439445_0001503_2122_2679 | 184 |
| 708 | 3300042004 | Ga0439445_0014743 | Ga0439445_0014743_110_667 | 184 |
| 709 | 3300042006 | Ga0439432_000751 | Ga0439432_000751_9087_9644 | 184 |
| 710 | 3300042007 | Ga0439449_0002753 | Ga0439449_0002753_2752_3309 | 184 |
| 711 | 3300042007 | Ga0439449_0042584 | Ga0439449_0042584_635_1192 | 184 |
| 712 | 3300042010 | Ga0439452_010200 | Ga0439452_010200_359_916 | 184 |
| 713 | 3300042010 | Ga0439452_020482 | Ga0439452_020482_107_664 | 184 |
| 714 | 3300042014 | Ga0439457_018482 | Ga0439457_018482_352_909 | 184 |
| 715 | 3300042015 | Ga0439462_0026957 | Ga0439462_0026957_606_1163 | 184 |
| 716 | 3300042115 | Ga0450911_000714 | Ga0450911_000714_6054_6611 | 184 |
| 717 | 3300042124 | Ga0450922_023042 | Ga0450922_023042_45_602 | 184 |
| 718 | 3300042128 | Ga0450897_007865 | Ga0450897_007865_52_609 | 184 |
| 719 | 3300042145 | Ga0450906_017658 | Ga0450906_017658_504_1061 | 184 |
| 720 | 3300042435 | Ga0439434_0000521 | Ga0439434_0000521_2833_3390 | 184 |
| 721 | 3300046455 | Ga0495603_0096110 | Ga0495603_0096110_242_802 | 184 |
| 722 | 3300046459 | Ga0495629_0181676 | Ga0495629_0181676_730_1290 | 184 |
| 723 | 3300046472 | Ga0495580_0030828 | Ga0495580_0030828_3146_3712 | 184 |
| 724 | 3300046473 | Ga0495582_0277582 | Ga0495582_0277582_209_769 | 184 |
| 725 | 3300046475 | Ga0495639_0104206 | Ga0495639_0104206_458_1015 | 184 |
| 726 | 3300046475 | Ga0495639_0304126 | Ga0495639_0304126_61_621 | 184 |
| 727 | 3300046522 | Ga0495643_0127369 | Ga0495643_0127369_301_858 | 184 |
| 728 | 3300046530 | Ga0495654_0003475 | Ga0495654_0003475_8867_9424 | 184 |
| 729 | 3300046530 | Ga0495654_0074893 | Ga0495654_0074893_487_1044 | 184 |
| 730 | 3300046558 | Ga0495633_0178835 | Ga0495633_0178835_32_592 | 184 |
| 731 | 3300046615 | Ga0495656_0002368 | Ga0495656_0002368_4223_4780 | 184 |
| 732 | 3300046615 | Ga0495656_0120241 | Ga0495656_0120241_415_975 | 184 |
| 733 | 3300046615 | Ga0495656_0176722 | Ga0495656_0176722_448_1005 | 184 |
| 734 | 3300046663 | Ga0495635_0144507 | Ga0495635_0144507_553_1110 | 184 |
| 735 | 3300046674 | Ga0495588_0084062 | Ga0495588_0084062_459_1016 | 184 |
| 736 | 3300046681 | Ga0495647_0134503 | Ga0495647_0134503_292_852 | 184 |
| 737 | 3300046691 | Ga0495670_0179989 | Ga0495670_0179989_17_577 | 184 |
| 738 | 3300046809 | Ga0495600_0047474 | Ga0495600_0047474_1296_1856 | 184 |
| 739 | 3300046809 | Ga0495600_0057169 | Ga0495600_0057169_844_1401 | 184 |
| 740 | 3300047315 | Ga0495581_0144641 | Ga0495581_0144641_345_902 | 184 |
| 741 | 3300047471 | Ga0495684_0126127 | Ga0495684_0126127_406_963 | 184 |
| 742 | 3300047673 | Ga0495593_0162601 | Ga0495593_0162601_34_591 | 184 |
| 743 | 3300048088 | Ga0495602_0401047 | Ga0495602_0401047_204_761 | 184 |
| 744 | 3300048904 | Ga0496101_0004340 | Ga0496101_0004340_2388_2945 | 184 |
| 745 | 3300048905 | Ga0496102_0043995 | Ga0496102_0043995_2426_2983 | 184 |
| 746 | 3300048905 | Ga0496102_0170224 | Ga0496102_0170224_978_1547 | 184 |
| 747 | 3300048906 | Ga0496103_0042834 | Ga0496103_0042834_1121_1678 | 184 |
| 748 | 3300048906 | Ga0496103_0065059 | Ga0496103_0065059_701_1270 | 184 |
| 749 | 3300048907 | Ga0496104_0075420 | Ga0496104_0075420_2368_2925 | 184 |
| 750 | 3300048907 | Ga0496104_0472587 | Ga0496104_0472587_306_875 | 184 |
| 751 | 3300048907 | Ga0496104_0907173 | Ga0496104_0907173_41_601 | 184 |
| 752 | 3300048908 | Ga0496105_0013954 | Ga0496105_0013954_2689_3246 | 184 |
| 753 | 3300048908 | Ga0496105_0189715 | Ga0496105_0189715_1070_1630 | 184 |
| 754 | 3300048908 | Ga0496105_0621609 | Ga0496105_0621609_41_601 | 184 |
| 755 | 3300048909 | Ga0496106_0113688 | Ga0496106_0113688_371_940 | 184 |
| 756 | 3300048909 | Ga0496106_0404266 | Ga0496106_0404266_42_599 | 184 |
| 757 | 3300048910 | Ga0496107_0037832 | Ga0496107_0037832_2075_2644 | 184 |
| 758 | 3300048910 | Ga0496107_0326915 | Ga0496107_0326915_197_754 | 184 |
| 759 | 3300048911 | Ga0496108_0245790 | Ga0496108_0245790_708_1268 | 184 |
| 760 | 3300048911 | Ga0496108_0348394 | Ga0496108_0348394_371_940 | 184 |
| 761 | 3300048911 | Ga0496108_0490135 | Ga0496108_0490135_348_905 | 184 |
| 762 | 3300048912 | Ga0496109_0316242 | Ga0496109_0316242_118_678 | 184 |
| 763 | 3300048912 | Ga0496109_0370781 | Ga0496109_0370781_448_1017 | 184 |
| 764 | 3300048913 | Ga0496110_0650962 | Ga0496110_0650962_78_635 | 184 |
| 765 | 3300048916 | Ga0496113_0158042 | Ga0496113_0158042_1018_1575 | 184 |
| 766 | 3300048916 | Ga0496113_0202107 | Ga0496113_0202107_649_1218 | 184 |
| 767 | 3300048917 | Ga0496114_0244812 | Ga0496114_0244812_283_852 | 184 |
| 768 | 3300048917 | Ga0496114_0614018 | Ga0496114_0614018_295_852 | 184 |
| 769 | 3300048918 | Ga0496115_0420280 | Ga0496115_0420280_134_694 | 184 |
| 770 | 3300048924 | Ga0496121_0004542 | Ga0496121_0004542_14030_14587 | 184 |
| 771 | 3300048925 | Ga0496122_0000184 | Ga0496122_0000184_64387_64944 | 184 |
| 772 | 3300048926 | Ga0496123_0000181 | Ga0496123_0000181_1334_1891 | 184 |
| 773 | 3300048926 | Ga0496123_0177131 | Ga0496123_0177131_421_978 | 184 |
| 774 | 3300048927 | Ga0496124_0033333 | Ga0496124_0033333_928_1485 | 184 |
| 775 | 3300048927 | Ga0496124_0082921 | Ga0496124_0082921_1425_1982 | 184 |
| 776 | 3300048928 | Ga0496125_0007111 | Ga0496125_0007111_1171_1728 | 184 |
| 777 | 3300048928 | Ga0496125_0007919 | Ga0496125_0007919_3637_4194 | 184 |
| 778 | 3300048929 | Ga0496126_0140326 | Ga0496126_0140326_551_1108 | 184 |
| 779 | 3300048929 | Ga0496126_0319076 | Ga0496126_0319076_42_599 | 184 |
| 780 | 3300049671 | Ga0501238_010778 | Ga0501238_010778_104_661 | 184 |
| 781 | 3300049705 | Ga0501225_0006440 | Ga0501225_0006440_927_1520 | 184 |
| 782 | 3300049758 | Ga0501241_027674 | Ga0501241_027674_79_672 | 184 |
| 783 | 3300049759 | Ga0501262_000209 | Ga0501262_000209_2547_3104 | 184 |
| 784 | 3300050489 | nmdc:mga03683_7048_c1 | nmdc:mga03683_7048_c1_313_873 | 184 |
| 785 | 3300050490 | nmdc:mga03n38_290553_c1 | nmdc:mga03n38_290553_c1_16_570 | 184 |
| 786 | 3300050490 | nmdc:mga03n38_74275_c1 | nmdc:mga03n38_74275_c1_145_720 | 184 |
| 787 | 3300050490 | nmdc:mga03n38_88366_c1 | nmdc:mga03n38_88366_c1_334_894 | 184 |
| 788 | 3300050491 | nmdc:mga00v17_58579_c1 | nmdc:mga00v17_58579_c1_1265_1819 | 184 |
| 789 | 3300050491 | nmdc:mga00v17_85049_c1 | nmdc:mga00v17_85049_c1_461_1021 | 184 |
| 790 | 3300050493 | nmdc:mga0k408_131946_c1 | nmdc:mga0k408_131946_c1_620_1174 | 184 |
| 791 | 3300050493 | nmdc:mga0k408_234171_c1 | nmdc:mga0k408_234171_c1_210_767 | 184 |
| 792 | 3300050493 | nmdc:mga0k408_29966_c1 | nmdc:mga0k408_29966_c1_65_640 | 184 |
| 793 | 3300050493 | nmdc:mga0k408_552740_c1 | nmdc:mga0k408_552740_c1_88_645 | 184 |
| 794 | 3300050508 | nmdc:mga09592_745833_c1 | nmdc:mga09592_745833_c1_169_729 | 184 |
| 795 | 3300050511 | nmdc:mga08y16_712602_c1 | nmdc:mga08y16_712602_c1_416_976 | 184 |
| 796 | 3300050512 | nmdc:mga0n895_613493_c1 | nmdc:mga0n895_613493_c1_474_1043 | 184 |
| 797 | 3300053077 | Ga0495601_0461740 | Ga0495601_0461740_248_805 | 184 |
| 798 | 3300053077 | Ga0495601_0496587 | Ga0495601_0496587_188_745 | 184 |
| 799 | 3300053085 | Ga0495619_0200255 | Ga0495619_0200255_424_984 | 184 |
| 800 | 3300053085 | Ga0495619_0275516 | Ga0495619_0275516_420_977 | 184 |
| 801 | 3300053088 | Ga0500644_0001138 | Ga0500644_0001138_2142_2696 | 184 |
| 802 | 3300053088 | Ga0500644_0003553 | Ga0500644_0003553_2532_3089 | 184 |
| 803 | 3300053093 | Ga0500651_0005197 | Ga0500651_0005197_6473_7030 | 184 |
| 804 | 3300053094 | Ga0500566_0230164 | Ga0500566_0230164_93_647 | 184 |
| 805 | 3300053098 | Ga0500650_0118545 | Ga0500650_0118545_487_1041 | 184 |
| 806 | 3300053108 | Ga0500562_008265 | Ga0500562_008265_1150_1821 | 184 |
| 807 | 3300053117 | Ga0500593_002149 | Ga0500593_002149_5071_5625 | 184 |
| 808 | 3300053118 | Ga0500594_0009084 | Ga0500594_0009084_223_780 | 184 |
| 809 | 3300053129 | Ga0500628_007338 | Ga0500628_007338_432_986 | 184 |
| 810 | 3300053136 | Ga0500559_0040781 | Ga0500559_0040781_594_1151 | 184 |
| 811 | 3300053145 | Ga0500586_090956 | Ga0500586_090956_412_969 | 184 |
| 812 | 3300053153 | Ga0500616_0034346 | Ga0500616_0034346_626_1183 | 184 |
| 813 | 3300053156 | Ga0500622_0128002 | Ga0500622_0128002_565_1122 | 184 |
| 814 | 3300053730 | Ga0500645_000061 | Ga0500645_000061_79194_79748 | 184 |
| 815 | 3300053730 | Ga0500645_001674 | Ga0500645_001674_9678_10232 | 184 |
| 816 | 3300053730 | Ga0500645_021334 | Ga0500645_021334_759_1313 | 184 |
| 817 | 3300055283 | Ga0500661_000809 | Ga0500661_000809_2685_3239 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2m1l-assembly1.cif.gz_B | solution nmr structure of cyclin-dependent kinase 2-associated protein 2 (cdk2ap2, doc-1r) from homo sapiens, northeast structural genomics consortium (nesg) target hr8910c | 0.6292 | 13 | 83 |
| 2m1l-assembly1.cif.gz_B | solution nmr structure of cyclin-dependent kinase 2-associated protein 2 (cdk2ap2, doc-1r) from homo sapiens, northeast structural genomics consortium (nesg) target hr8910c | 0.5989 | 13 | 83 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.5904 | 26 | 165 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.5645 | 27 | 172 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.5474 | 26 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F084_1008_1283_2.60.210.10 | Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | 0.8477 | 96 | 160 | 2.60.210.10 |
| af_Q9TYQ6_401_530_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7691 | 97 | 175 | 3.30.40.10 |
| 1rq0B01 | Special;Helix non-globular;Helix Hairpins; | 0.732 | 80 | 159 | 6.10.140.160 |
| af_Q500Z2_70_197_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7201 | 101 | 179 | 3.30.40.10 |
| af_Q54PF0_152_283_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6903 | 101 | 180 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520CLX1-F1-model_v4 | TRAP transporter small permease protein | 0.8084 | 1 | 85 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A1W9LHI8-F1-model_v4 | C4-dicarboxylate ABC transporter permease | 0.8008 | 27 | 170 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A3C0HI20-F1-model_v4 | TRAP transporter small permease protein | 0.7912 | 27 | 164 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A359B8B9-F1-model_v4 | TRAP transporter small permease | 0.7903 | 30 | 170 |
GO:0005886
|
| AF-A0A5N0T9W7-F1-model_v4 | TRAP transporter small permease protein | 0.7845 | 22 | 167 |
GO:0005886
GO:0015740 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar