F482095

General Info

Members Datasets Scaffolds Average Seq Length
817 338 801 186

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10290769|Ga0207669_102907692
Length 180
Sequence MTEEQKIIDEEGHFHAEDEVVDLSDTIAEGWIALGIFWVLGLTVFYQFVTRYVLNDSAAWTEEVARYMLIGVVFVGAAIGVSKNLMIQVDFFYRFMPPWRAVDVLRIAFFAAAVVMTVQMMIKIGNQTRMTIVDAPMNIVYGLCLFGFAAMCFRSVQVARVHWRRGYSILERPESSLIDN

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221683 Variovorax sp. Root473 Isolate Unclassified
3 2738543013 Variovorax sp. BT01 Isolate Unclassified
4 2842677519 Variovorax sp. R-72495 Isolate Unclassified
5 2842733646 Variovorax sp. R-72446 Isolate Unclassified
6 2842747753 Variovorax sp. R-72060 Isolate Unclassified
7 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
8 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
9 2904456579 Variovorax sp. 2002 Isolate Unclassified
10 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
11 2929520902 Variovorax beijingensis 502 Isolate Unclassified
12 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
13 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
14 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
15 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
16 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
118 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
119 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
120 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
217 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
218 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
245 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
249 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
250 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
251 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
252 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
253 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
254 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
258 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
263 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
264 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
265 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
266 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
267 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
268 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
271 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
312 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
313 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
314 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
326 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
327 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
328 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
329 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
338 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.81
Nodule 0.73
Rhizoplane 4.04
Rhizosphere 76.25
Stem 0
Stem Tuber 0
Unclassified 4.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000013 3300002705 Bacteria 189553
2 JGI25154J39366_1000032 3300002738 Bacteria 189265
3 JGI25157J39369_1000017 3300002741 Bacteria 189553
4 JGI25150J39212_1006693 3300002774 Bacteria 2360
5 JGI25150J39212_1008334 3300002774 Bacteria 2032
6 JGI25150J39212_1014251 3300002774 Bacteria 1355
7 JGI25159J45721_1004214 3300002987 Bacteria 4848
8 JGI25159J45721_1006741 3300002987 Bacteria 3385
9 JGI25151J46595_10008595 3300003187 Bacteria 4895
10 JGI25151J46595_10026532 3300003187 Bacteria 2336
11 rootL2_10093584 3300003322 Bacteria 1137
12 JGI25160J50197_1000106 3300003354 Bacteria 80449
13 JGI25161J50226_1000041 3300003374 Bacteria 124485
14 Ga0055526_1006939 3300003771 Bacteria 6021
15 Ga0055526_1006976 3300003771 Bacteria 5993
16 Ga0055537_1000029 3300003773 Bacteria 101797
17 Ga0055537_1000229 3300003773 Bacteria 41052
18 Ga0055537_1008434 3300003773 Bacteria 2379
19 Ga0055524_1000040 3300003775 Bacteria 157409
20 Ga0055536_1003958 3300003781 Bacteria 7764
21 Ga0055536_1005991 3300003781 Bacteria 5784
22 Ga0055536_1028010 3300003781 Bacteria 1544
23 Ga0055536_1037502 3300003781 Bacteria 1185
24 Ga0055534_1000081 3300003784 Bacteria 75591
25 Ga0055534_1001320 3300003784 Bacteria 9970
26 Ga0055534_1004555 3300003784 Bacteria 3972
27 Ga0055528_1000107 3300003790 Bacteria 67056
28 Ga0055528_1003803 3300003790 Bacteria 7436
29 Ga0055530_10000493 3300003791 Bacteria 34162
30 Ga0055530_10076700 3300003791 Bacteria 710
31 Ga0055540_1000030 3300003792 Bacteria 177871
32 Ga0055540_1001837 3300003792 Bacteria 11979
33 Ga0055540_1002684 3300003792 Bacteria 9173
34 Ga0055531_10009620 3300003794 Bacteria 4920
35 Ga0055543_1001200 3300004625 Bacteria 10901
36 Ga0065165_1017710 3300005262 Bacteria 2612
37 Ga0065165_1023849 3300005262 Bacteria 2066
38 Ga0065165_1024861 3300005262 Bacteria 2003
39 Ga0065165_1032070 3300005262 Bacteria 1652
40 Ga0065165_1073283 3300005262 Bacteria 905
41 Ga0065704_10083585 3300005289 Bacteria 3445
42 Ga0065715_10021301 3300005293 Bacteria 1978
43 Ga0065715_10176942 3300005293 Bacteria 1504
44 Ga0070676_10049045 3300005328 Bacteria 2470
45 Ga0070676_10381142 3300005328 Bacteria 976
46 Ga0070683_100538148 3300005329 Bacteria 1117
47 Ga0070690_100069129 3300005330 Bacteria 2291
48 Ga0070670_100049162 3300005331 Bacteria 3626
49 Ga0070670_100155929 3300005331 Bacteria 1977
50 Ga0070670_100186040 3300005331 Bacteria 1803
51 Ga0070670_100246589 3300005331 Bacteria 1555
52 Ga0070670_100276301 3300005331 Bacteria 1466
53 Ga0070670_100340987 3300005331 Bacteria 1315
54 Ga0070670_100389658 3300005331 Bacteria 1228
55 Ga0070670_100614428 3300005331 Bacteria 973
56 Ga0070677_10029393 3300005333 Bacteria 2083
57 Ga0070677_10031593 3300005333 Bacteria 2025
58 Ga0070677_10052088 3300005333 Bacteria 1659
59 Ga0070677_10075091 3300005333 Bacteria 1432
60 Ga0070677_10108316 3300005333 Bacteria 1236
61 Ga0068869_100005126 3300005334 Bacteria 8215
62 Ga0070666_10007413 3300005335 Bacteria 6762
63 Ga0070666_10134319 3300005335 Bacteria 1720
64 Ga0070666_10236303 3300005335 Bacteria 1291
65 Ga0070666_10500287 3300005335 Bacteria 881
66 Ga0070680_100112248 3300005336 Bacteria 2270
67 Ga0068868_100001955 3300005338 Bacteria 14135
68 Ga0068868_100282015 3300005338 Bacteria 1406
69 Ga0068868_100419487 3300005338 Bacteria 1158
70 Ga0068868_100449658 3300005338 Bacteria 1120
71 Ga0068868_100460577 3300005338 Bacteria 1107
72 Ga0070660_100104911 3300005339 Bacteria 2242
73 Ga0070660_100222446 3300005339 Bacteria 1534
74 Ga0070687_100020504 3300005343 Bacteria 3092
75 Ga0070687_100165126 3300005343 Bacteria 1312
76 Ga0070661_100236750 3300005344 Bacteria 1404
77 Ga0070692_10443012 3300005345 Bacteria 830
78 Ga0070668_100003555 3300005347 Bacteria 11496
79 Ga0070668_100212306 3300005347 Bacteria 1593
80 Ga0070668_100289407 3300005347 Bacteria 1371
81 Ga0070668_100838589 3300005347 Bacteria 818
82 Ga0070669_100017475 3300005353 Bacteria 5115
83 Ga0070669_100031658 3300005353 Bacteria 3821
84 Ga0070669_100060905 3300005353 Bacteria 2773
85 Ga0070669_100789470 3300005353 Bacteria 806
86 Ga0070669_100862666 3300005353 Bacteria 772
87 Ga0070675_100005320 3300005354 Bacteria 9835
88 Ga0070675_100061363 3300005354 Bacteria 3104
89 Ga0070675_100159556 3300005354 Bacteria 1938
90 Ga0070675_100161306 3300005354 Bacteria 1928
91 Ga0070675_100203777 3300005354 Bacteria 1717
92 Ga0070671_100006632 3300005355 Bacteria 9251
93 Ga0070671_100043326 3300005355 Bacteria 3740
94 Ga0070671_100069616 3300005355 Bacteria 2935
95 Ga0070671_100281114 3300005355 Bacteria 1415
96 Ga0070671_101193515 3300005355 Bacteria 670
97 Ga0070674_100018239 3300005356 Bacteria 4433
98 Ga0070674_100070201 3300005356 Bacteria 2474
99 Ga0070674_100140602 3300005356 Bacteria 1811
100 Ga0070674_100284602 3300005356 Bacteria 1312
101 Ga0070673_100029782 3300005364 Bacteria 4075
102 Ga0070673_100243919 3300005364 Bacteria 1563
103 Ga0070673_100799803 3300005364 Bacteria 871
104 Ga0070673_100967278 3300005364 Bacteria 791
105 Ga0070688_100082736 3300005365 Bacteria 2081
106 Ga0070659_100135367 3300005366 Bacteria 2003
107 Ga0070659_100193210 3300005366 Bacteria 1673
108 Ga0070659_100717292 3300005366 Bacteria 866
109 Ga0070667_100018788 3300005367 Bacteria 5732
110 Ga0070667_100036122 3300005367 Bacteria 4142
111 Ga0070667_100038123 3300005367 Bacteria 4029
112 Ga0070667_100478037 3300005367 Bacteria 1140
113 Ga0070667_100557582 3300005367 Bacteria 1053
114 Ga0070667_100606696 3300005367 Bacteria 1009
115 Ga0070701_10167625 3300005438 Bacteria 1277
116 Ga0070663_100169733 3300005455 Bacteria 1685
117 Ga0070663_100497756 3300005455 Bacteria 1011
118 Ga0070678_100048400 3300005456 Bacteria 3061
119 Ga0070678_100053734 3300005456 Bacteria 2931
120 Ga0070678_100075327 3300005456 Bacteria 2538
121 Ga0070678_100169802 3300005456 Bacteria 1775
122 Ga0070678_100229311 3300005456 Bacteria 1547
123 Ga0070678_100441314 3300005456 Bacteria 1138
124 Ga0070678_100806755 3300005456 Bacteria 852
125 Ga0070662_100012157 3300005457 Bacteria 5700
126 Ga0070662_100023662 3300005457 Bacteria 4222
127 Ga0070662_100047737 3300005457 Bacteria 3081
128 Ga0070662_100091956 3300005457 Bacteria 2279
129 Ga0070662_100450243 3300005457 Bacteria 1068
130 Ga0070681_10130574 3300005458 Bacteria 2444
131 Ga0068867_100033665 3300005459 Bacteria 3712
132 Ga0068867_100218580 3300005459 Bacteria 1534
133 Ga0068867_100218856 3300005459 Bacteria 1533
134 Ga0068867_100450506 3300005459 Bacteria 1096
135 Ga0068867_100535071 3300005459 Bacteria 1012
136 Ga0068867_101136767 3300005459 Bacteria 714
137 Ga0070685_10092534 3300005466 Bacteria 1832
138 Ga0070685_10480390 3300005466 Bacteria 876
139 Ga0070679_100010948 3300005530 Bacteria 8620
140 Ga0070679_100349390 3300005530 Bacteria 1427
141 Ga0070684_100019585 3300005535 Bacteria 5600
142 Ga0070684_100404076 3300005535 Bacteria 1259
143 Ga0068853_100046393 3300005539 Bacteria 3725
144 Ga0068853_100311331 3300005539 Bacteria 1458
145 Ga0068853_100441130 3300005539 Bacteria 1223
146 Ga0068853_100501800 3300005539 Bacteria 1145
147 Ga0068853_100947748 3300005539 Bacteria 827
148 Ga0070672_100020940 3300005543 Bacteria 4779
149 Ga0070672_100060460 3300005543 Bacteria 2983
150 Ga0070672_100086261 3300005543 Bacteria 2524
151 Ga0070672_100153963 3300005543 Bacteria 1903
152 Ga0070672_100217852 3300005543 Bacteria 1600
153 Ga0070672_100254895 3300005543 Bacteria 1478
154 Ga0070672_100294887 3300005543 Bacteria 1373
155 Ga0070672_100356649 3300005543 Bacteria 1247
156 Ga0070672_100540988 3300005543 Bacteria 1010
157 Ga0070672_100694902 3300005543 Bacteria 890
158 Ga0070686_100087148 3300005544 Bacteria 2081
159 Ga0068855_100039058 3300005563 Bacteria 5636
160 Ga0070664_100160693 3300005564 Bacteria 1987
161 Ga0070664_100174782 3300005564 Bacteria 1906
162 Ga0070664_100418007 3300005564 Bacteria 1228
163 Ga0070664_100419519 3300005564 Bacteria 1225
164 Ga0070664_100558804 3300005564 Bacteria 1059
165 Ga0068857_100174217 3300005577 Bacteria 1956
166 Ga0068854_100190261 3300005578 Bacteria 1608
167 Ga0068854_100246187 3300005578 Bacteria 1425
168 Ga0068856_100083350 3300005614 Bacteria 3174
169 Ga0068856_100828582 3300005614 Bacteria 944
170 Ga0070702_100553015 3300005615 Bacteria 855
171 Ga0068852_100179606 3300005616 Bacteria 1989
172 Ga0068852_100202806 3300005616 Bacteria 1877
173 Ga0068852_100226474 3300005616 Bacteria 1780
174 Ga0068852_100457566 3300005616 Bacteria 1264
175 Ga0068852_100761867 3300005616 Bacteria 980
176 Ga0068852_100807435 3300005616 Bacteria 952
177 Ga0068852_100860374 3300005616 Bacteria 922
178 Ga0068852_100925284 3300005616 Bacteria 889
179 Ga0068852_101039117 3300005616 Bacteria 838
180 Ga0068859_100004027 3300005617 Bacteria 14982
181 Ga0068859_100068114 3300005617 Bacteria 3594
182 Ga0068864_100009938 3300005618 Bacteria 7848
183 Ga0068864_100083775 3300005618 Bacteria 2800
184 Ga0068864_100126759 3300005618 Bacteria 2288
185 Ga0068864_100161904 3300005618 Bacteria 2034
186 Ga0068864_100299406 3300005618 Bacteria 1505
187 Ga0068864_100843530 3300005618 Bacteria 902
188 Ga0068866_10063423 3300005718 Bacteria 1926
189 Ga0068866_10131381 3300005718 Bacteria 1425
190 Ga0068861_100011946 3300005719 Bacteria 6048
191 Ga0068861_100059976 3300005719 Bacteria 2914
192 Ga0068861_100067050 3300005719 Bacteria 2768
193 Ga0068861_100173149 3300005719 Bacteria 1790
194 Ga0068861_100443501 3300005719 Bacteria 1161
195 Ga0068851_10087079 3300005834 Bacteria 1640
196 Ga0068851_10169368 3300005834 Bacteria 1204
197 Ga0068851_10299336 3300005834 Bacteria 924
198 Ga0068870_10252066 3300005840 Bacteria 1095
199 Ga0068870_10349408 3300005840 Bacteria 948
200 Ga0068863_100003466 3300005841 Bacteria 15562
201 Ga0068863_100004155 3300005841 Bacteria 14296
202 Ga0068863_100071438 3300005841 Bacteria 3283
203 Ga0068863_100167627 3300005841 Bacteria 2106
204 Ga0068863_100262952 3300005841 Bacteria 1668
205 Ga0068863_100379684 3300005841 Bacteria 1380
206 Ga0068863_100504607 3300005841 Bacteria 1191
207 Ga0068863_100725874 3300005841 Bacteria 988
208 Ga0068858_100002678 3300005842 Bacteria 17932
209 Ga0068858_100004898 3300005842 Bacteria 13122
210 Ga0068858_100127377 3300005842 Bacteria 2385
211 Ga0068860_100005443 3300005843 Bacteria 12906
212 Ga0068860_100033915 3300005843 Bacteria 4897
213 Ga0068860_100221249 3300005843 Bacteria 1838
214 Ga0068860_100760658 3300005843 Bacteria 981
215 Ga0068862_100107966 3300005844 Bacteria 2440
216 Ga0068862_100240628 3300005844 Bacteria 1645
217 Ga0075363_100010846 3300006048 Bacteria 4346
218 Ga0075363_100110179 3300006048 Bacteria 1530
219 Ga0075364_10064338 3300006051 Bacteria 2407
220 Ga0075364_10079127 3300006051 Bacteria 2172
221 Ga0075432_10044377 3300006058 Bacteria 1559
222 Ga0075362_10007059 3300006177 Bacteria 4224
223 Ga0075362_10216834 3300006177 Bacteria 934
224 Ga0075367_10092734 3300006178 Bacteria 1839
225 Ga0075366_10001983 3300006195 Bacteria 10365
226 Ga0075366_10512295 3300006195 Bacteria 742
227 Ga0097621_100055088 3300006237 Bacteria 3246
228 Ga0097621_100061406 3300006237 Bacteria 3082
229 Ga0097621_100117798 3300006237 Bacteria 2251
230 Ga0097621_100476730 3300006237 Bacteria 1127
231 Ga0097621_100649944 3300006237 Bacteria 967
232 Ga0097621_100891985 3300006237 Bacteria 828
233 Ga0097621_101006728 3300006237 Bacteria 780
234 Ga0097621_101049719 3300006237 Bacteria 764
235 Ga0075370_10010702 3300006353 Bacteria 4808
236 Ga0075370_10231396 3300006353 Bacteria 1094
237 Ga0068871_100040497 3300006358 Bacteria 3732
238 Ga0068871_100078417 3300006358 Bacteria 2731
239 Ga0068871_100143643 3300006358 Bacteria 2031
240 Ga0068871_100226512 3300006358 Bacteria 1621
241 Ga0068871_100489330 3300006358 Bacteria 1107
242 Ga0068871_100520155 3300006358 Bacteria 1074
243 Ga0075430_100009841 3300006846 Bacteria 8087
244 Ga0075429_100003178 3300006880 Bacteria 13964
245 Ga0075429_101371786 3300006880 Bacteria 616
246 Ga0068865_100017528 3300006881 Bacteria 4607
247 Ga0068865_100520592 3300006881 Bacteria 994
248 Ga0068865_100880386 3300006881 Bacteria 777
249 Ga0097620_100004027 3300006931 Bacteria 14982
250 Ga0097620_100068114 3300006931 Bacteria 3594
251 Ga0079104_1011880 3300006946 Bacteria 2770
252 Ga0099826_10000087 3300006948 Bacteria 46364
253 Ga0099826_10073699 3300006948 Bacteria 2156
254 Ga0099826_10106542 3300006948 Bacteria 1680
255 Ga0105250_10099215 3300009092 Bacteria 1188
256 Ga0105240_11660554 3300009093 Bacteria 668
257 Ga0111539_11389437 3300009094 Bacteria 814
258 Ga0105245_10380447 3300009098 Bacteria 1406
259 Ga0105245_11357543 3300009098 Bacteria 760
260 Ga0105243_10068322 3300009148 Bacteria 2864
261 Ga0105242_10210395 3300009176 Bacteria 1733
262 Ga0105242_10369020 3300009176 Bacteria 1331
263 Ga0105242_10427266 3300009176 Bacteria 1243
264 Ga0105242_10704672 3300009176 Bacteria 988
265 Ga0105248_10051302 3300009177 Bacteria 4629
266 Ga0105248_10128074 3300009177 Bacteria 2864
267 Ga0105248_10234103 3300009177 Bacteria 2068
268 Ga0105248_10239358 3300009177 Bacteria 2043
269 Ga0105248_10274624 3300009177 Bacteria 1898
270 Ga0105248_10895276 3300009177 Bacteria 1002
271 Ga0105248_11022284 3300009177 Bacteria 934
272 Ga0105248_11090375 3300009177 Bacteria 902
273 Ga0105248_11137738 3300009177 Bacteria 882
274 Ga0105237_10060033 3300009545 Bacteria 3804
275 Ga0105238_10188351 3300009551 Bacteria 2040
276 Ga0105238_10768242 3300009551 Bacteria 978
277 Ga0105238_11194564 3300009551 Bacteria 785
278 Ga0105249_10017865 3300009553 Bacteria 6302
279 Ga0105249_10050443 3300009553 Bacteria 3794
280 Ga0105249_10753312 3300009553 Bacteria 1036
281 Ga0105239_10066299 3300010375 Bacteria 3966
282 Ga0105246_10524362 3300011119 Bacteria 1010
283 Ga0157323_1002135 3300012495 Bacteria 1071
284 Ga0157347_1000221 3300012502 Bacteria 3270
285 Ga0157327_1000947 3300012512 Bacteria 1713
286 Ga0157326_1000451 3300012513 Bacteria 4870
287 Ga0157373_10199882 3300013100 Bacteria 1409
288 Ga0157371_10554873 3300013102 Bacteria 852
289 Ga0157370_10003845 3300013104 Bacteria 17512
290 Ga0157370_10188740 3300013104 Bacteria 1913
291 Ga0157370_10912150 3300013104 Bacteria 797
292 Ga0157370_10998864 3300013104 Bacteria 757
293 Ga0157369_10166440 3300013105 Bacteria 2325
294 Ga0157369_11133031 3300013105 Bacteria 799
295 Ga0157374_10037741 3300013296 Bacteria 4437
296 Ga0157374_10100494 3300013296 Bacteria 2773
297 Ga0157374_10401056 3300013296 Bacteria 1368
298 Ga0157374_10992622 3300013296 Bacteria 859
299 Ga0157374_11422602 3300013296 Bacteria 716
300 Ga0157378_10397636 3300013297 Bacteria 1357
301 Ga0157378_10664449 3300013297 Bacteria 1059
302 Ga0157378_10832512 3300013297 Bacteria 950
303 Ga0163162_10038435 3300013306 Bacteria 4776
304 Ga0163162_10106194 3300013306 Bacteria 2903
305 Ga0163162_10222435 3300013306 Bacteria 2017
306 Ga0163162_10254580 3300013306 Bacteria 1888
307 Ga0163162_10339447 3300013306 Bacteria 1635
308 Ga0163162_10568379 3300013306 Bacteria 1261
309 Ga0163162_10688500 3300013306 Bacteria 1144
310 Ga0163162_10758646 3300013306 Bacteria 1089
311 Ga0157372_10355864 3300013307 Bacteria 1706
312 Ga0157372_10995705 3300013307 Bacteria 971
313 Ga0157375_10125411 3300013308 Bacteria 2682
314 Ga0157375_10171764 3300013308 Bacteria 2316
315 Ga0157375_10312197 3300013308 Bacteria 1737
316 Ga0157375_10702613 3300013308 Bacteria 1165
317 Ga0157375_10736169 3300013308 Bacteria 1138
318 Ga0157375_10759448 3300013308 Bacteria 1120
319 Ga0157375_10763925 3300013308 Bacteria 1117
320 Ga0163163_10016809 3300014325 Bacteria 6810
321 Ga0163163_10704698 3300014325 Bacteria 1073
322 Ga0157380_10019496 3300014326 Bacteria 5055
323 Ga0157380_10019525 3300014326 Bacteria 5051
324 Ga0157380_10111348 3300014326 Bacteria 2301
325 Ga0157380_10176244 3300014326 Bacteria 1874
326 Ga0157380_10218221 3300014326 Bacteria 1705
327 Ga0182008_10008214 3300014497 Bacteria 5711
328 Ga0182008_10119643 3300014497 Bacteria 1309
329 Ga0157377_10012265 3300014745 Bacteria 4304
330 Ga0157377_10197256 3300014745 Bacteria 1276
331 Ga0157379_10318866 3300014968 Bacteria 1419
332 Ga0157379_10398164 3300014968 Bacteria 1265
333 Ga0157376_10103751 3300014969 Bacteria 2490
334 Ga0157376_10120479 3300014969 Bacteria 2324
335 Ga0157376_10257822 3300014969 Bacteria 1632
336 Ga0157376_10830816 3300014969 Bacteria 938
337 Ga0182006_1017723 3300015261 Bacteria 3020
338 Ga0182006_1079020 3300015261 Bacteria 1203
339 Ga0182007_10021566 3300015262 Bacteria 2286
340 Ga0163161_10000329 3300017792 Bacteria 40476
341 Ga0163161_10013701 3300017792 Bacteria 5646
342 Ga0163161_10053805 3300017792 Bacteria 2920
343 Ga0163161_10321025 3300017792 Bacteria 1224
344 Ga0163161_10362833 3300017792 Bacteria 1154
345 Ga0163161_11166137 3300017792 Bacteria 665
346 Ga0209435_100003 3300025206 Bacteria 669534
347 Ga0209436_105046 3300025208 Bacteria 3126
348 Ga0207425_1001243 3300025245 Bacteria 11182
349 Ga0207425_1007648 3300025245 Bacteria 2831
350 Ga0209646_1000008 3300025246 Bacteria 669534
351 Ga0209026_1000007 3300025250 Bacteria 669534
352 Ga0209759_1000026 3300025256 Bacteria 311743
353 Ga0209129_1007409 3300025258 Bacteria 3276
354 Ga0209129_1032236 3300025258 Bacteria 867
355 Ga0209565_1000026 3300025263 Bacteria 365910
356 Ga0209565_1000150 3300025263 Bacteria 94073
357 Ga0209565_1001312 3300025263 Bacteria 11421
358 Ga0209565_1061899 3300025263 Bacteria 647
359 Ga0207666_1001766 3300025271 Bacteria 2567
360 Ga0209673_1000009 3300025273 Bacteria 620735
361 Ga0209673_1000012 3300025273 Bacteria 579480
362 Ga0209673_1000114 3300025273 Bacteria 178557
363 Ga0209673_1008634 3300025273 Bacteria 4514
364 Ga0209673_1066189 3300025273 Bacteria 879
365 Ga0209130_1000099 3300025284 Bacteria 141717
366 Ga0209130_1000123 3300025284 Bacteria 125840
367 Ga0209130_1006153 3300025284 Bacteria 3960
368 Ga0209675_1000062 3300025291 Bacteria 178557
369 Ga0209675_1000155 3300025291 Bacteria 89020
370 Ga0209675_1004791 3300025291 Bacteria 5878
371 Ga0209675_1005864 3300025291 Bacteria 5045
372 Ga0209676_1000051 3300025292 Bacteria 389016
373 Ga0209676_1000325 3300025292 Bacteria 91840
374 Ga0209676_1008862 3300025292 Bacteria 4423
375 Ga0209025_1004061 3300025294 Bacteria 13090
376 Ga0209025_1007738 3300025294 Bacteria 7920
377 Ga0209025_1009286 3300025294 Bacteria 6885
378 Ga0209025_1016364 3300025294 Bacteria 4384
379 Ga0209564_1000211 3300025295 Bacteria 133277
380 Ga0209564_1000228 3300025295 Bacteria 125206
381 Ga0209564_1004815 3300025295 Bacteria 8037
382 Ga0209758_1083564 3300025297 Bacteria 957
383 Ga0209050_1000044 3300025298 Bacteria 391114
384 Ga0209050_1003950 3300025298 Bacteria 10477
385 Ga0209050_1010312 3300025298 Bacteria 4620
386 Ga0209050_1038509 3300025298 Bacteria 1362
387 Ga0209050_1057750 3300025298 Bacteria 936
388 Ga0209256_1000003 3300025299 Bacteria 1661127
389 Ga0209256_1025111 3300025299 Bacteria 1742
390 Ga0207426_1000062 3300025302 Bacteria 362040
391 Ga0209051_1000031 3300025303 Bacteria 391114
392 Ga0209051_1000208 3300025303 Bacteria 102967
393 Ga0209051_1000760 3300025303 Bacteria 34370
394 Ga0209051_1060818 3300025303 Bacteria 1190
395 Ga0209257_1000058 3300025304 Bacteria 381686
396 Ga0209257_1008393 3300025304 Bacteria 5887
397 Ga0209257_1013462 3300025304 Bacteria 3633
398 Ga0207697_10032926 3300025315 Bacteria 2122
399 Ga0207697_10241147 3300025315 Bacteria 799
400 Ga0207697_10255735 3300025315 Bacteria 775
401 Ga0207656_10062842 3300025321 Bacteria 1633
402 Ga0207656_10180936 3300025321 Bacteria 1012
403 Ga0207682_10009146 3300025893 Bacteria 3914
404 Ga0207682_10038424 3300025893 Bacteria 1942
405 Ga0207682_10061961 3300025893 Bacteria 1567
406 Ga0207682_10154994 3300025893 Bacteria 1035
407 Ga0207682_10286553 3300025893 Bacteria 771
408 Ga0207642_10015639 3300025899 Bacteria 2834
409 Ga0207642_10067435 3300025899 Bacteria 1689
410 Ga0207688_10033243 3300025901 Bacteria 2852
411 Ga0207688_10148393 3300025901 Bacteria 1384
412 Ga0207688_10234204 3300025901 Bacteria 1109
413 Ga0207680_10023828 3300025903 Bacteria 3349
414 Ga0207680_10363368 3300025903 Bacteria 1018
415 Ga0207680_10719171 3300025903 Bacteria 716
416 Ga0207645_10007091 3300025907 Bacteria 7965
417 Ga0207645_10027206 3300025907 Bacteria 3694
418 Ga0207645_10202394 3300025907 Bacteria 1306
419 Ga0207645_10401707 3300025907 Bacteria 922
420 Ga0207643_10445085 3300025908 Bacteria 824
421 Ga0207707_10208990 3300025912 Bacteria 1701
422 Ga0207671_10162669 3300025914 Bacteria 1729
423 Ga0207660_10007738 3300025917 Bacteria 6956
424 Ga0207662_10036429 3300025918 Bacteria 2875
425 Ga0207662_10063557 3300025918 Bacteria 2220
426 Ga0207662_10325602 3300025918 Bacteria 1027
427 Ga0207649_10450638 3300025920 Bacteria 971
428 Ga0207649_11110007 3300025920 Bacteria 624
429 Ga0207652_10005260 3300025921 Bacteria 10509
430 Ga0207681_10007401 3300025923 Bacteria 6721
431 Ga0207681_10018416 3300025923 Bacteria 4400
432 Ga0207681_10043750 3300025923 Bacteria 2998
433 Ga0207681_10402397 3300025923 Bacteria 1106
434 Ga0207681_10465468 3300025923 Bacteria 1030
435 Ga0207694_10076303 3300025924 Bacteria 2625
436 Ga0207650_10023527 3300025925 Bacteria 4369
437 Ga0207650_10069686 3300025925 Bacteria 2642
438 Ga0207650_10178246 3300025925 Bacteria 1692
439 Ga0207650_10189625 3300025925 Bacteria 1642
440 Ga0207650_10254052 3300025925 Bacteria 1424
441 Ga0207650_10357721 3300025925 Bacteria 1202
442 Ga0207650_10442076 3300025925 Bacteria 1081
443 Ga0207650_10507514 3300025925 Bacteria 1008
444 Ga0207650_10572600 3300025925 Bacteria 948
445 Ga0207659_10007169 3300025926 Bacteria 6843
446 Ga0207659_10020490 3300025926 Bacteria 4372
447 Ga0207659_10138499 3300025926 Bacteria 1887
448 Ga0207659_10260594 3300025926 Bacteria 1410
449 Ga0207659_10504640 3300025926 Bacteria 1024
450 Ga0207659_10693881 3300025926 Bacteria 871
451 Ga0207687_10231983 3300025927 Bacteria 1458
452 Ga0207687_10241112 3300025927 Bacteria 1433
453 Ga0207644_10000068 3300025931 Bacteria 76090
454 Ga0207644_10015661 3300025931 Bacteria 5094
455 Ga0207690_10095883 3300025932 Bacteria 2108
456 Ga0207690_10503538 3300025932 Bacteria 980
457 Ga0207706_10045478 3300025933 Bacteria 3889
458 Ga0207706_10152950 3300025933 Bacteria 2029
459 Ga0207706_10206870 3300025933 Bacteria 1721
460 Ga0207706_10259144 3300025933 Bacteria 1518
461 Ga0207706_10661657 3300025933 Bacteria 894
462 Ga0207686_10071853 3300025934 Bacteria 2228
463 Ga0207686_10155738 3300025934 Bacteria 1596
464 Ga0207686_10201916 3300025934 Bacteria 1424
465 Ga0207709_10021397 3300025935 Bacteria 3661
466 Ga0207709_10120378 3300025935 Bacteria 1771
467 Ga0207670_11063869 3300025936 Bacteria 682
468 Ga0207669_10026733 3300025937 Bacteria 3145
469 Ga0207669_10186688 3300025937 Bacteria 1491
470 Ga0207669_10290769 3300025937 Bacteria 1237
471 Ga0207669_10515161 3300025937 Bacteria 959
472 Ga0207704_10217717 3300025938 Bacteria 1410
473 Ga0207704_10516559 3300025938 Bacteria 965
474 Ga0207704_10973238 3300025938 Bacteria 717
475 Ga0207665_10062982 3300025939 Bacteria 2518
476 Ga0207691_10017865 3300025940 Bacteria 6721
477 Ga0207691_10038713 3300025940 Bacteria 4412
478 Ga0207691_10168616 3300025940 Bacteria 1918
479 Ga0207691_10196626 3300025940 Bacteria 1756
480 Ga0207691_10204227 3300025940 Bacteria 1719
481 Ga0207691_10320459 3300025940 Bacteria 1329
482 Ga0207691_10324822 3300025940 Bacteria 1319
483 Ga0207691_10472773 3300025940 Bacteria 1066
484 Ga0207691_10605827 3300025940 Bacteria 927
485 Ga0207691_10633375 3300025940 Bacteria 904
486 Ga0207711_10019765 3300025941 Bacteria 5612
487 Ga0207711_10048659 3300025941 Bacteria 3627
488 Ga0207711_10054755 3300025941 Bacteria 3424
489 Ga0207711_10214937 3300025941 Bacteria 1757
490 Ga0207711_10679055 3300025941 Bacteria 961
491 Ga0207711_10680977 3300025941 Bacteria 959
492 Ga0207689_10001957 3300025942 Bacteria 19463
493 Ga0207689_10028597 3300025942 Bacteria 4661
494 Ga0207689_10057292 3300025942 Bacteria 3206
495 Ga0207689_10295671 3300025942 Bacteria 1342
496 Ga0207661_10382422 3300025944 Bacteria 1274
497 Ga0207679_10277308 3300025945 Bacteria 1436
498 Ga0207679_10360161 3300025945 Bacteria 1270
499 Ga0207679_10559851 3300025945 Bacteria 1027
500 Ga0207679_10662694 3300025945 Bacteria 945
501 Ga0207679_10693491 3300025945 Bacteria 924
502 Ga0207651_10015897 3300025960 Bacteria 4389
503 Ga0207651_10048641 3300025960 Bacteria 2868
504 Ga0207651_10198016 3300025960 Bacteria 1607
505 Ga0207651_10597533 3300025960 Bacteria 964
506 Ga0207712_10085529 3300025961 Bacteria 2308
507 Ga0207712_10131078 3300025961 Bacteria 1911
508 Ga0207712_10312278 3300025961 Bacteria 1294
509 Ga0207712_10665561 3300025961 Bacteria 906
510 Ga0207668_10013103 3300025972 Bacteria 5096
511 Ga0207668_10140566 3300025972 Bacteria 1856
512 Ga0207668_10256489 3300025972 Bacteria 1423
513 Ga0207658_10040984 3300025986 Bacteria 3350
514 Ga0207658_10086776 3300025986 Bacteria 2414
515 Ga0207658_10139362 3300025986 Bacteria 1960
516 Ga0207658_10358044 3300025986 Bacteria 1272
517 Ga0207677_10010533 3300026023 Bacteria 5237
518 Ga0207677_10013473 3300026023 Bacteria 4740
519 Ga0207703_10005888 3300026035 Bacteria 9825
520 Ga0207703_10007902 3300026035 Bacteria 8412
521 Ga0207703_10021291 3300026035 Bacteria 5076
522 Ga0207703_10252155 3300026035 Bacteria 1591
523 Ga0207639_10016030 3300026041 Bacteria 5293
524 Ga0207639_11478983 3300026041 Bacteria 637
525 Ga0207678_10360782 3300026067 Bacteria 1254
526 Ga0207678_10677685 3300026067 Bacteria 907
527 Ga0207708_10211045 3300026075 Bacteria 1552
528 Ga0207708_10557909 3300026075 Bacteria 966
529 Ga0207702_10121901 3300026078 Bacteria 2335
530 Ga0207641_10005089 3300026088 Bacteria 11267
531 Ga0207641_10012091 3300026088 Bacteria 7079
532 Ga0207641_10021771 3300026088 Bacteria 5269
533 Ga0207641_10236646 3300026088 Bacteria 1699
534 Ga0207641_10677285 3300026088 Bacteria 1014
535 Ga0207641_10860190 3300026088 Bacteria 899
536 Ga0207648_10120272 3300026089 Bacteria 2309
537 Ga0207648_10135611 3300026089 Bacteria 2168
538 Ga0207648_10177046 3300026089 Bacteria 1887
539 Ga0207648_10210706 3300026089 Bacteria 1725
540 Ga0207648_10399361 3300026089 Bacteria 1245
541 Ga0207648_10479927 3300026089 Bacteria 1135
542 Ga0207648_10614029 3300026089 Bacteria 1003
543 Ga0207676_10005849 3300026095 Bacteria 8690
544 Ga0207676_10005921 3300026095 Bacteria 8637
545 Ga0207676_10037212 3300026095 Bacteria 3707
546 Ga0207676_10067533 3300026095 Bacteria 2856
547 Ga0207676_10311473 3300026095 Bacteria 1441
548 Ga0207676_10342735 3300026095 Bacteria 1379
549 Ga0207676_10996626 3300026095 Bacteria 825
550 Ga0207676_11214535 3300026095 Bacteria 747
551 Ga0207674_10205009 3300026116 Bacteria 1921
552 Ga0207674_11105118 3300026116 Bacteria 762
553 Ga0207675_100004245 3300026118 Bacteria 13857
554 Ga0207675_100004891 3300026118 Bacteria 12915
555 Ga0207675_100196069 3300026118 Bacteria 1938
556 Ga0207675_100457268 3300026118 Bacteria 1266
557 Ga0207675_100563902 3300026118 Bacteria 1139
558 Ga0207675_100782674 3300026118 Bacteria 966
559 Ga0207675_100927088 3300026118 Bacteria 888
560 Ga0207683_10009318 3300026121 Bacteria 8364
561 Ga0207683_10037761 3300026121 Bacteria 4207
562 Ga0207683_10051292 3300026121 Bacteria 3615
563 Ga0207683_10066018 3300026121 Bacteria 3190
564 Ga0207683_10082714 3300026121 Bacteria 2852
565 Ga0207683_10269765 3300026121 Bacteria 1554
566 Ga0207683_10458882 3300026121 Bacteria 1175
567 Ga0207683_10553535 3300026121 Bacteria 1064
568 Ga0207683_10606326 3300026121 Bacteria 1013
569 Ga0207698_10183741 3300026142 Bacteria 1855
570 Ga0207698_10669334 3300026142 Bacteria 1030
571 Ga0207698_10804346 3300026142 Bacteria 942
572 Ga0207698_10858230 3300026142 Bacteria 913
573 Ga0207698_11257245 3300026142 Bacteria 755
574 Ga0209281_1023406 3300027111 Bacteria 1171
575 Ga0209282_1000307 3300027666 Bacteria 24300
576 Ga0268266_10193231 3300028379 Bacteria 1859
577 Ga0268266_11040786 3300028379 Bacteria 792
578 Ga0268265_10118750 3300028380 Bacteria 2174
579 Ga0268265_10979518 3300028380 Bacteria 834
580 Ga0268264_10004057 3300028381 Bacteria 12533
581 Ga0268264_10015030 3300028381 Bacteria 6351
582 Ga0268264_10212368 3300028381 Bacteria 1777
583 Ga0307515_10000064 3300028794 Bacteria 245452
584 Ga0316178_1126380 3300030735 Bacteria 3798
585 Ga0316183_1110495 3300030742 Bacteria 3751
586 Ga0316182_1084678 3300030745 Bacteria 1898
587 Ga0307513_10000090 3300031456 Bacteria 129750
588 Ga0307513_10116438 3300031456 Bacteria 2652
589 Ga0307513_10499229 3300031456 Bacteria 934
590 Ga0307408_100005621 3300031548 Bacteria 8383
591 Ga0307408_100039727 3300031548 Bacteria 3329
592 Ga0307408_100086585 3300031548 Bacteria 2355
593 Ga0307408_100096359 3300031548 Bacteria 2244
594 Ga0307408_100132717 3300031548 Bacteria 1945
595 Ga0307408_100304331 3300031548 Bacteria 1337
596 Ga0307408_100422714 3300031548 Bacteria 1149
597 Ga0307408_100438115 3300031548 Bacteria 1131
598 Ga0307408_100530569 3300031548 Bacteria 1035
599 Ga0307514_10011166 3300031649 Bacteria 7476
600 Ga0307405_10005918 3300031731 Bacteria 5963
601 Ga0307405_10037668 3300031731 Bacteria 2908
602 Ga0307405_10073841 3300031731 Bacteria 2203
603 Ga0307405_10086027 3300031731 Bacteria 2068
604 Ga0307405_10098412 3300031731 Bacteria 1955
605 Ga0307405_10176158 3300031731 Bacteria 1530
606 Ga0307405_10202895 3300031731 Bacteria 1441
607 Ga0307405_10421922 3300031731 Bacteria 1050
608 Ga0307405_10491745 3300031731 Bacteria 981
609 Ga0307413_10056403 3300031824 Bacteria 2396
610 Ga0307413_10221699 3300031824 Bacteria 1382
611 Ga0307413_10842566 3300031824 Bacteria 774
612 Ga0307410_10042903 3300031852 Bacteria 2993
613 Ga0307410_10052712 3300031852 Bacteria 2749
614 Ga0307410_10413332 3300031852 Bacteria 1093
615 Ga0307406_10006495 3300031901 Bacteria 6459
616 Ga0307406_10018017 3300031901 Bacteria 4119
617 Ga0307406_10056965 3300031901 Bacteria 2505
618 Ga0307406_10252847 3300031901 Bacteria 1329
619 Ga0307406_10376040 3300031901 Bacteria 1118
620 Ga0307406_10431824 3300031901 Bacteria 1052
621 Ga0307406_10491338 3300031901 Bacteria 993
622 Ga0307406_10706521 3300031901 Bacteria 842
623 Ga0307407_10039408 3300031903 Bacteria 2627
624 Ga0307407_10259091 3300031903 Bacteria 1195
625 Ga0307412_10002222 3300031911 Bacteria 10777
626 Ga0307412_10029007 3300031911 Bacteria 3469
627 Ga0307412_10046332 3300031911 Bacteria 2848
628 Ga0307412_10071053 3300031911 Bacteria 2375
629 Ga0307412_10163776 3300031911 Bacteria 1655
630 Ga0307412_10249457 3300031911 Bacteria 1377
631 Ga0307412_10475267 3300031911 Bacteria 1035
632 Ga0307409_100000592 3300031995 Bacteria 15808
633 Ga0307416_100006736 3300032002 Bacteria 7222
634 Ga0307416_100030125 3300032002 Bacteria 4068
635 Ga0307416_100078038 3300032002 Bacteria 2784
636 Ga0307416_100093935 3300032002 Bacteria 2585
637 Ga0307416_100176293 3300032002 Bacteria 1997
638 Ga0307416_100214103 3300032002 Bacteria 1841
639 Ga0307414_10011967 3300032004 Bacteria 5115
640 Ga0307414_10223393 3300032004 Bacteria 1548
641 Ga0307414_10385631 3300032004 Bacteria 1213
642 Ga0307414_10418882 3300032004 Bacteria 1167
643 Ga0307414_10888273 3300032004 Bacteria 816
644 Ga0307411_10080376 3300032005 Bacteria 2241
645 Ga0307415_100002275 3300032126 Bacteria 9522
646 Ga0307415_100454217 3300032126 Bacteria 1108
647 Ga0373944_0292425 3300035089 Bacteria 610
648 Ga0373955_0116903 3300035172 Bacteria 1547
649 Ga0373931_0045475 3300035691 Bacteria 2318
650 Ga0373935_0338915 3300035692 Bacteria 1070
651 Ga0373935_0509997 3300035692 Bacteria 874
652 Ga0373927_0219919 3300035695 Bacteria 1248
653 Ga0373937_0423920 3300036401 Bacteria 1263
654 Ga0373937_0687698 3300036401 Bacteria 969
655 Ga0395899_0003326 3300037312 Bacteria 12743
656 Ga0395898_0007717 3300037466 Bacteria 11423
657 Ga0395905_0000492 3300037471 Bacteria 54399
658 Ga0395905_0005285 3300037471 Bacteria 13205
659 Ga0395905_0024428 3300037471 Bacteria 5704
660 Ga0395901_0345743 3300038443 Bacteria 1536
661 Ga0439436_0044193 3300041404 Bacteria 1269
662 Ga0439439_0017080 3300041406 Bacteria 1781
663 Ga0439447_014294 3300041407 Bacteria 2231
664 Ga0439447_035437 3300041407 Bacteria 1237
665 Ga0439466_0008218 3300041411 Bacteria 3935
666 Ga0439466_0012417 3300041411 Bacteria 3138
667 Ga0439466_0128780 3300041411 Bacteria 779
668 Ga0439465_0021445 3300041413 Bacteria 2025
669 Ga0451789_0567393 3300041443 Bacteria 1248
670 Ga0451791_1410299 3300041451 Bacteria 796
671 Ga0451795_1340527 3300041456 Bacteria 708
672 Ga0451804_0402448 3300041463 Bacteria 646
673 Ga0451837_0128052 3300041494 Bacteria 1128
674 Ga0451839_0069363 3300041496 Bacteria 618
675 Ga0451843_0600576 3300041509 Bacteria 1233
676 Ga0451853_2861878 3300041512 Bacteria 1975
677 Ga0439431_0034770 3300041997 Bacteria 1264
678 Ga0439431_0063027 3300041997 Bacteria 978
679 Ga0439433_0008170 3300041999 Bacteria 2266
680 Ga0439442_030730 3300042002 Bacteria 1121
681 Ga0439445_0001503 3300042004 Bacteria 5070
682 Ga0439445_0014743 3300042004 Bacteria 1907
683 Ga0439432_000751 3300042006 Bacteria 12131
684 Ga0439449_0002753 3300042007 Bacteria 6842
685 Ga0439449_0042584 3300042007 Bacteria 1686
686 Ga0439452_010200 3300042010 Bacteria 2742
687 Ga0439452_020482 3300042010 Bacteria 1734
688 Ga0439457_018482 3300042014 Bacteria 1549
689 Ga0439462_0026957 3300042015 Bacteria 1515
690 Ga0450911_000714 3300042115 Bacteria 9675
691 Ga0450922_023042 3300042124 Bacteria 650
692 Ga0450897_007865 3300042128 Bacteria 981
693 Ga0450906_017658 3300042145 Bacteria 1285
694 Ga0439434_0000521 3300042435 Bacteria 10979
695 Ga0439464_0009427 3300042439 Bacteria 2570
696 Ga0453683_0193090 3300044673 Bacteria 1292
697 Ga0466960_0034266 3300044901 Bacteria 2365
698 Ga0495603_0096110 3300046455 Bacteria 1731
699 Ga0495603_0320633 3300046455 Bacteria 890
700 Ga0495629_0181676 3300046459 Bacteria 1458
701 Ga0495580_0030828 3300046472 Bacteria 3879
702 Ga0495582_0277582 3300046473 Bacteria 962
703 Ga0495639_0104206 3300046475 Bacteria 1341
704 Ga0495639_0304126 3300046475 Bacteria 796
705 Ga0495643_0127369 3300046522 Bacteria 1281
706 Ga0495654_0003475 3300046530 Bacteria 9623
707 Ga0495654_0074893 3300046530 Bacteria 1598
708 Ga0495598_0017719 3300046537 Bacteria 1840
709 Ga0495633_0178835 3300046558 Bacteria 977
710 Ga0495656_0002368 3300046615 Bacteria 6248
711 Ga0495656_0120241 3300046615 Bacteria 1239
712 Ga0495656_0176722 3300046615 Bacteria 1047
713 Ga0495635_0144507 3300046663 Bacteria 1620
714 Ga0495588_0084062 3300046674 Bacteria 1663
715 Ga0495647_0134503 3300046681 Bacteria 1050
716 Ga0495670_0179989 3300046691 Bacteria 1116
717 Ga0495600_0047474 3300046809 Bacteria 2801
718 Ga0495600_0057169 3300046809 Bacteria 2549
719 Ga0495581_0144641 3300047315 Bacteria 1388
720 Ga0495684_0126127 3300047471 Bacteria 1926
721 Ga0495593_0162601 3300047673 Bacteria 1127
722 Ga0495602_0401047 3300048088 Bacteria 978
723 Ga0496101_0004340 3300048904 Bacteria 8899
724 Ga0496102_0043995 3300048905 Bacteria 4050
725 Ga0496102_0170224 3300048905 Bacteria 2051
726 Ga0496103_0042834 3300048906 Bacteria 2786
727 Ga0496103_0065059 3300048906 Bacteria 2274
728 Ga0496104_0075420 3300048907 Bacteria 3211
729 Ga0496104_0135850 3300048907 Bacteria 2363
730 Ga0496104_0472587 3300048907 Bacteria 1165
731 Ga0496104_0907173 3300048907 Bacteria 786
732 Ga0496105_0013954 3300048908 Bacteria 6387
733 Ga0496105_0053857 3300048908 Bacteria 3323
734 Ga0496105_0189715 3300048908 Bacteria 1681
735 Ga0496105_0621609 3300048908 Bacteria 836
736 Ga0496106_0113688 3300048909 Bacteria 2110
737 Ga0496106_0404266 3300048909 Bacteria 1097
738 Ga0496107_0037832 3300048910 Bacteria 3463
739 Ga0496107_0326915 3300048910 Bacteria 1141
740 Ga0496108_0245790 3300048911 Bacteria 1556
741 Ga0496108_0348394 3300048911 Bacteria 1292
742 Ga0496108_0372746 3300048911 Bacteria 1246
743 Ga0496108_0490135 3300048911 Bacteria 1073
744 Ga0496109_0316242 3300048912 Bacteria 1473
745 Ga0496109_0370781 3300048912 Bacteria 1352
746 Ga0496110_0650962 3300048913 Bacteria 953
747 Ga0496113_0158042 3300048916 Bacteria 1791
748 Ga0496113_0202107 3300048916 Bacteria 1579
749 Ga0496114_0244812 3300048917 Bacteria 1577
750 Ga0496114_0614018 3300048917 Bacteria 958
751 Ga0496115_0420280 3300048918 Bacteria 1083
752 Ga0496121_0004542 3300048924 Bacteria 18558
753 Ga0496122_0000184 3300048925 Bacteria 144437
754 Ga0496123_0000181 3300048926 Bacteria 127092
755 Ga0496123_0177131 3300048926 Bacteria 1118
756 Ga0496124_0033333 3300048927 Bacteria 4530
757 Ga0496124_0082921 3300048927 Bacteria 2631
758 Ga0496125_0007111 3300048928 Bacteria 11945
759 Ga0496125_0007919 3300048928 Bacteria 11218
760 Ga0496126_0140326 3300048929 Bacteria 2081
761 Ga0496126_0319076 3300048929 Bacteria 1278
762 Ga0501238_010778 3300049671 Bacteria 1223
763 Ga0501225_0006440 3300049705 Bacteria 3427
764 Ga0501241_027674 3300049758 Bacteria 1061
765 Ga0501262_000209 3300049759 Bacteria 7284
766 nmdc:mga03683_7048_c1 3300050489 Bacteria 3880
767 nmdc:mga03n38_290553_c1 3300050490 Bacteria 875
768 nmdc:mga03n38_74275_c1 3300050490 Bacteria 1581
769 nmdc:mga03n38_88366_c1 3300050490 Bacteria 1470
770 nmdc:mga00v17_58579_c1 3300050491 Bacteria 2360
771 nmdc:mga00v17_85049_c1 3300050491 Bacteria 1980
772 nmdc:mga0k408_131946_c1 3300050493 Bacteria 1483
773 nmdc:mga0k408_234171_c1 3300050493 Bacteria 1096
774 nmdc:mga0k408_29966_c1 3300050493 Bacteria 3101
775 nmdc:mga0k408_552740_c1 3300050493 Bacteria 680
776 nmdc:mga09592_745833_c1 3300050508 Bacteria 831
777 nmdc:mga09592_7768_c1 3300050508 Bacteria 8715
778 nmdc:mga0qj67_8225_c2 3300050509 Bacteria 6603
779 nmdc:mga08y16_712602_c1 3300050511 Bacteria 1002
780 nmdc:mga0n895_613493_c1 3300050512 Bacteria 1089
781 Ga0495601_0461740 3300053077 Bacteria 821
782 Ga0495601_0496587 3300053077 Bacteria 788
783 Ga0495619_0200255 3300053085 Bacteria 1382
784 Ga0495619_0275516 3300053085 Bacteria 1166
785 Ga0500644_0001138 3300053088 Bacteria 7751
786 Ga0500644_0003553 3300053088 Bacteria 3867
787 Ga0500651_0005197 3300053093 Bacteria 7409
788 Ga0500566_0230164 3300053094 Bacteria 915
789 Ga0500650_0118545 3300053098 Bacteria 1234
790 Ga0500562_008265 3300053108 Bacteria 2628
791 Ga0500593_002149 3300053117 Bacteria 7169
792 Ga0500594_0009084 3300053118 Bacteria 2281
793 Ga0500628_007338 3300053129 Bacteria 1887
794 Ga0500559_0040781 3300053136 Bacteria 2022
795 Ga0500586_090956 3300053145 Bacteria 1071
796 Ga0500616_0034346 3300053153 Bacteria 2762
797 Ga0500622_0128002 3300053156 Bacteria 1224
798 Ga0500645_000061 3300053730 Bacteria 85703
799 Ga0500645_001674 3300053730 Bacteria 10874
800 Ga0500645_021334 3300053730 Bacteria 2000
801 Ga0500661_000809 3300055283 Bacteria 5830

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025936 Ga0207670_11063869 Ga0207670_110638691 166
2 3300025920 Ga0207649_11110007 Ga0207649_111100071 173
3 3300025937 Ga0207669_10290769 Ga0207669_102907692 178
4 iso_pu_bacteria 2511231002 2511243465 180
5 iso_pu_bacteria 2643221683 2644466122 181
6 iso_pu_bacteria 2842677519 2842681153 181
7 iso_pu_bacteria 2842733646 2842737419 181
8 iso_pu_bacteria 2842747753 2842749840 181
9 iso_pu_bacteria 2885192300 2885196589 181
10 iso_pu_bacteria 2904449895 2904454127 181
11 iso_pu_bacteria 2904456579 2904462016 181
12 iso_pu_bacteria 2919462493 2919465272 181
13 iso_pu_bacteria 2929520902 2929521858 181
14 iso_pu_bacteria 2945909444 2945914376 181
15 iso_pu_bacteria 2945945610 2945949907 181
16 iso_pu_bacteria 2945972063 2945973926 181
17 iso_pu_bacteria 2945984333 2945990229 181
18 iso_pu_bacteria 2954767861 2954770486 181
19 iso_pu_bacteria 2738543013 2739251826 182
20 3300005293 Ga0065715_10176942 Ga0065715_101769422 183
21 3300005330 Ga0070690_100069129 Ga0070690_1000691291 183
22 3300005331 Ga0070670_100246589 Ga0070670_1002465892 183
23 3300005333 Ga0070677_10075091 Ga0070677_100750912 183
24 3300005335 Ga0070666_10007413 Ga0070666_100074132 183
25 3300005338 Ga0068868_100001955 Ga0068868_10000195510 183
26 3300005354 Ga0070675_100005320 Ga0070675_1000053207 183
27 3300005355 Ga0070671_100006632 Ga0070671_1000066323 183
28 3300005364 Ga0070673_100029782 Ga0070673_1000297822 183
29 3300005365 Ga0070688_100082736 Ga0070688_1000827362 183
30 3300005367 Ga0070667_100036122 Ga0070667_1000361225 183
31 3300005456 Ga0070678_100075327 Ga0070678_1000753272 183
32 3300005457 Ga0070662_100047737 Ga0070662_1000477373 183
33 3300005459 Ga0068867_100218856 Ga0068867_1002188562 183
34 3300005466 Ga0070685_10092534 Ga0070685_100925342 183
35 3300005539 Ga0068853_100947748 Ga0068853_1009477481 183
36 3300005543 Ga0070672_100060460 Ga0070672_1000604604 183
37 3300005543 Ga0070672_100294887 Ga0070672_1002948872 183
38 3300005543 Ga0070672_100356649 Ga0070672_1003566492 183
39 3300005564 Ga0070664_100418007 Ga0070664_1004180072 183
40 3300005617 Ga0068859_100004027 Ga0068859_10000402712 183
41 3300005618 Ga0068864_100009938 Ga0068864_1000099386 183
42 3300005618 Ga0068864_100299406 Ga0068864_1002994062 183
43 3300005718 Ga0068866_10063423 Ga0068866_100634232 183
44 3300005719 Ga0068861_100059976 Ga0068861_1000599763 183
45 3300005719 Ga0068861_100173149 Ga0068861_1001731492 183
46 3300005834 Ga0068851_10087079 Ga0068851_100870792 183
47 3300005840 Ga0068870_10252066 Ga0068870_102520662 183
48 3300005841 Ga0068863_100004155 Ga0068863_1000041557 183
49 3300005841 Ga0068863_100262952 Ga0068863_1002629522 183
50 3300005841 Ga0068863_100725874 Ga0068863_1007258742 183
51 3300005842 Ga0068858_100002678 Ga0068858_1000026787 183
52 3300005843 Ga0068860_100221249 Ga0068860_1002212492 183
53 3300005844 Ga0068862_100240628 Ga0068862_1002406282 183
54 3300006237 Ga0097621_100055088 Ga0097621_1000550882 183
55 3300006237 Ga0097621_100117798 Ga0097621_1001177982 183
56 3300006237 Ga0097621_100649944 Ga0097621_1006499442 183
57 3300006358 Ga0068871_100143643 Ga0068871_1001436432 183
58 3300006358 Ga0068871_100489330 Ga0068871_1004893302 183
59 3300006846 Ga0075430_100009841 Ga0075430_1000098414 183
60 3300006880 Ga0075429_100003178 Ga0075429_1000031789 183
61 3300006881 Ga0068865_100520592 Ga0068865_1005205922 183
62 3300006931 Ga0097620_100004027 Ga0097620_10000402712 183
63 3300009176 Ga0105242_10427266 Ga0105242_104272662 183
64 3300009177 Ga0105248_10128074 Ga0105248_101280742 183
65 3300009177 Ga0105248_10239358 Ga0105248_102393582 183
66 3300009177 Ga0105248_11022284 Ga0105248_110222842 183
67 3300009553 Ga0105249_10017865 Ga0105249_100178652 183
68 3300013102 Ga0157371_10554873 Ga0157371_105548731 183
69 3300013296 Ga0157374_10100494 Ga0157374_101004942 183
70 3300013296 Ga0157374_10401056 Ga0157374_104010562 183
71 3300013296 Ga0157374_11422602 Ga0157374_114226022 183
72 3300013297 Ga0157378_10397636 Ga0157378_103976362 183
73 3300013306 Ga0163162_10106194 Ga0163162_101061942 183
74 3300013306 Ga0163162_10254580 Ga0163162_102545802 183
75 3300013306 Ga0163162_10568379 Ga0163162_105683792 183
76 3300013307 Ga0157372_10995705 Ga0157372_109957051 183
77 3300013308 Ga0157375_10171764 Ga0157375_101717642 183
78 3300013308 Ga0157375_10312197 Ga0157375_103121972 183
79 3300014325 Ga0163163_10016809 Ga0163163_100168094 183
80 3300014326 Ga0157380_10111348 Ga0157380_101113482 183
81 3300014969 Ga0157376_10120479 Ga0157376_101204792 183
82 3300025271 Ga0207666_1001766 Ga0207666_10017663 183
83 3300025321 Ga0207656_10180936 Ga0207656_101809362 183
84 3300025893 Ga0207682_10286553 Ga0207682_102865532 183
85 3300025899 Ga0207642_10067435 Ga0207642_100674352 183
86 3300025903 Ga0207680_10023828 Ga0207680_100238282 183
87 3300025908 Ga0207643_10445085 Ga0207643_104450852 183
88 3300025923 Ga0207681_10007401 Ga0207681_100074014 183
89 3300025926 Ga0207659_10007169 Ga0207659_100071694 183
90 3300025931 Ga0207644_10000068 Ga0207644_1000006816 183
91 3300025931 Ga0207644_10015661 Ga0207644_100156615 183
92 3300025933 Ga0207706_10259144 Ga0207706_102591442 183
93 3300025934 Ga0207686_10155738 Ga0207686_101557382 183
94 3300025938 Ga0207704_10516559 Ga0207704_105165592 183
95 3300025938 Ga0207704_10973238 Ga0207704_109732382 183
96 3300025940 Ga0207691_10324822 Ga0207691_103248222 183
97 3300025940 Ga0207691_10605827 Ga0207691_106058272 183
98 3300025941 Ga0207711_10048659 Ga0207711_100486592 183
99 3300025941 Ga0207711_10214937 Ga0207711_102149372 183
100 3300025942 Ga0207689_10028597 Ga0207689_100285974 183
101 3300025945 Ga0207679_10662694 Ga0207679_106626942 183
102 3300025960 Ga0207651_10015897 Ga0207651_100158972 183
103 3300025961 Ga0207712_10131078 Ga0207712_101310782 183
104 3300025986 Ga0207658_10139362 Ga0207658_101393622 183
105 3300026023 Ga0207677_10010533 Ga0207677_100105333 183
106 3300026035 Ga0207703_10005888 Ga0207703_100058887 183
107 3300026088 Ga0207641_10005089 Ga0207641_100050898 183
108 3300026088 Ga0207641_10236646 Ga0207641_102366462 183
109 3300026089 Ga0207648_10135611 Ga0207648_101356112 183
110 3300026095 Ga0207676_10005849 Ga0207676_100058496 183
111 3300026095 Ga0207676_10311473 Ga0207676_103114732 183
112 3300026118 Ga0207675_100196069 Ga0207675_1001960692 183
113 3300026118 Ga0207675_100457268 Ga0207675_1004572682 183
114 3300026121 Ga0207683_10082714 Ga0207683_100827142 183
115 3300028379 Ga0268266_10193231 Ga0268266_101932312 183
116 3300028381 Ga0268264_10212368 Ga0268264_102123682 183
117 3300036401 Ga0373937_0687698 Ga0373937_0687698_347_904 183
118 3300037471 Ga0395905_0024428 Ga0395905_0024428_1771_2358 183
119 3300041463 Ga0451804_0402448 Ga0451804_0402448_54_611 183
120 3300042439 Ga0439464_0009427 Ga0439464_0009427_1568_2134 183
121 3300044673 Ga0453683_0193090 Ga0453683_0193090_368_937 183
122 3300044901 Ga0466960_0034266 Ga0466960_0034266_1576_2130 183
123 3300046455 Ga0495603_0320633 Ga0495603_0320633_274_831 183
124 3300046537 Ga0495598_0017719 Ga0495598_0017719_928_1485 183
125 3300048907 Ga0496104_0135850 Ga0496104_0135850_270_827 183
126 3300048908 Ga0496105_0053857 Ga0496105_0053857_860_1417 183
127 3300048911 Ga0496108_0372746 Ga0496108_0372746_582_1139 183
128 3300050508 nmdc:mga09592_7768_c1 nmdc:mga09592_7768_c1_6812_7372 183
129 3300050509 nmdc:mga0qj67_8225_c2 nmdc:mga0qj67_8225_c2_4476_5036 183
130 3300002705 JGI25156J39149_1000013 JGI25156J39149_100001333 184
131 3300002738 JGI25154J39366_1000032 JGI25154J39366_100003233 184
132 3300002741 JGI25157J39369_1000017 JGI25157J39369_100001733 184
133 3300002774 JGI25150J39212_1006693 JGI25150J39212_10066931 184
134 3300002774 JGI25150J39212_1008334 JGI25150J39212_10083342 184
135 3300002774 JGI25150J39212_1014251 JGI25150J39212_10142512 184
136 3300002987 JGI25159J45721_1004214 JGI25159J45721_10042142 184
137 3300002987 JGI25159J45721_1006741 JGI25159J45721_10067413 184
138 3300003187 JGI25151J46595_10008595 JGI25151J46595_100085954 184
139 3300003187 JGI25151J46595_10026532 JGI25151J46595_100265323 184
140 3300003322 rootL2_10093584 rootL2_100935841 184
141 3300003354 JGI25160J50197_1000106 JGI25160J50197_10001064 184
142 3300003374 JGI25161J50226_1000041 JGI25161J50226_100004144 184
143 3300003771 Ga0055526_1006939 Ga0055526_10069392 184
144 3300003771 Ga0055526_1006976 Ga0055526_10069762 184
145 3300003773 Ga0055537_1000029 Ga0055537_100002992 184
146 3300003773 Ga0055537_1000229 Ga0055537_100022920 184
147 3300003773 Ga0055537_1008434 Ga0055537_10084342 184
148 3300003775 Ga0055524_1000040 Ga0055524_100004040 184
149 3300003781 Ga0055536_1003958 Ga0055536_10039586 184
150 3300003781 Ga0055536_1005991 Ga0055536_10059913 184
151 3300003781 Ga0055536_1028010 Ga0055536_10280102 184
152 3300003781 Ga0055536_1037502 Ga0055536_10375021 184
153 3300003784 Ga0055534_1000081 Ga0055534_100008153 184
154 3300003784 Ga0055534_1001320 Ga0055534_10013209 184
155 3300003784 Ga0055534_1004555 Ga0055534_10045552 184
156 3300003790 Ga0055528_1000107 Ga0055528_100010753 184
157 3300003790 Ga0055528_1003803 Ga0055528_10038034 184
158 3300003791 Ga0055530_10000493 Ga0055530_1000049324 184
159 3300003791 Ga0055530_10076700 Ga0055530_100767001 184
160 3300003792 Ga0055540_1000030 Ga0055540_1000030118 184
161 3300003792 Ga0055540_1001837 Ga0055540_10018373 184
162 3300003792 Ga0055540_1002684 Ga0055540_10026849 184
163 3300003794 Ga0055531_10009620 Ga0055531_100096204 184
164 3300004625 Ga0055543_1001200 Ga0055543_10012004 184
165 3300005262 Ga0065165_1017710 Ga0065165_10177103 184
166 3300005262 Ga0065165_1023849 Ga0065165_10238492 184
167 3300005262 Ga0065165_1024861 Ga0065165_10248612 184
168 3300005262 Ga0065165_1032070 Ga0065165_10320702 184
169 3300005262 Ga0065165_1073283 Ga0065165_10732832 184
170 3300005289 Ga0065704_10083585 Ga0065704_100835853 184
171 3300005293 Ga0065715_10021301 Ga0065715_100213012 184
172 3300005328 Ga0070676_10049045 Ga0070676_100490453 184
173 3300005328 Ga0070676_10381142 Ga0070676_103811422 184
174 3300005329 Ga0070683_100538148 Ga0070683_1005381482 184
175 3300005331 Ga0070670_100049162 Ga0070670_1000491622 184
176 3300005331 Ga0070670_100155929 Ga0070670_1001559292 184
177 3300005331 Ga0070670_100186040 Ga0070670_1001860402 184
178 3300005331 Ga0070670_100276301 Ga0070670_1002763012 184
179 3300005331 Ga0070670_100340987 Ga0070670_1003409872 184
180 3300005331 Ga0070670_100389658 Ga0070670_1003896582 184
181 3300005331 Ga0070670_100614428 Ga0070670_1006144282 184
182 3300005333 Ga0070677_10029393 Ga0070677_100293932 184
183 3300005333 Ga0070677_10031593 Ga0070677_100315931 184
184 3300005333 Ga0070677_10052088 Ga0070677_100520882 184
185 3300005333 Ga0070677_10108316 Ga0070677_101083162 184
186 3300005334 Ga0068869_100005126 Ga0068869_1000051268 184
187 3300005335 Ga0070666_10134319 Ga0070666_101343192 184
188 3300005335 Ga0070666_10236303 Ga0070666_102363031 184
189 3300005335 Ga0070666_10500287 Ga0070666_105002872 184
190 3300005336 Ga0070680_100112248 Ga0070680_1001122482 184
191 3300005338 Ga0068868_100282015 Ga0068868_1002820152 184
192 3300005338 Ga0068868_100419487 Ga0068868_1004194872 184
193 3300005338 Ga0068868_100449658 Ga0068868_1004496582 184
194 3300005338 Ga0068868_100460577 Ga0068868_1004605772 184
195 3300005339 Ga0070660_100104911 Ga0070660_1001049113 184
196 3300005339 Ga0070660_100222446 Ga0070660_1002224462 184
197 3300005343 Ga0070687_100020504 Ga0070687_1000205042 184
198 3300005343 Ga0070687_100165126 Ga0070687_1001651262 184
199 3300005344 Ga0070661_100236750 Ga0070661_1002367502 184
200 3300005345 Ga0070692_10443012 Ga0070692_104430121 184
201 3300005347 Ga0070668_100003555 Ga0070668_1000035552 184
202 3300005347 Ga0070668_100212306 Ga0070668_1002123062 184
203 3300005347 Ga0070668_100289407 Ga0070668_1002894072 184
204 3300005347 Ga0070668_100838589 Ga0070668_1008385891 184
205 3300005353 Ga0070669_100017475 Ga0070669_1000174755 184
206 3300005353 Ga0070669_100031658 Ga0070669_1000316582 184
207 3300005353 Ga0070669_100060905 Ga0070669_1000609052 184
208 3300005353 Ga0070669_100789470 Ga0070669_1007894702 184
209 3300005353 Ga0070669_100862666 Ga0070669_1008626662 184
210 3300005354 Ga0070675_100061363 Ga0070675_1000613632 184
211 3300005354 Ga0070675_100159556 Ga0070675_1001595562 184
212 3300005354 Ga0070675_100161306 Ga0070675_1001613062 184
213 3300005354 Ga0070675_100203777 Ga0070675_1002037772 184
214 3300005355 Ga0070671_100043326 Ga0070671_1000433262 184
215 3300005355 Ga0070671_100069616 Ga0070671_1000696161 184
216 3300005355 Ga0070671_100281114 Ga0070671_1002811142 184
217 3300005355 Ga0070671_101193515 Ga0070671_1011935151 184
218 3300005356 Ga0070674_100018239 Ga0070674_1000182393 184
219 3300005356 Ga0070674_100070201 Ga0070674_1000702012 184
220 3300005356 Ga0070674_100140602 Ga0070674_1001406021 184
221 3300005356 Ga0070674_100284602 Ga0070674_1002846022 184
222 3300005364 Ga0070673_100243919 Ga0070673_1002439192 184
223 3300005364 Ga0070673_100799803 Ga0070673_1007998032 184
224 3300005364 Ga0070673_100967278 Ga0070673_1009672781 184
225 3300005366 Ga0070659_100135367 Ga0070659_1001353672 184
226 3300005366 Ga0070659_100193210 Ga0070659_1001932102 184
227 3300005366 Ga0070659_100717292 Ga0070659_1007172921 184
228 3300005367 Ga0070667_100018788 Ga0070667_1000187883 184
229 3300005367 Ga0070667_100038123 Ga0070667_1000381234 184
230 3300005367 Ga0070667_100478037 Ga0070667_1004780372 184
231 3300005367 Ga0070667_100557582 Ga0070667_1005575822 184
232 3300005367 Ga0070667_100606696 Ga0070667_1006066961 184
233 3300005438 Ga0070701_10167625 Ga0070701_101676251 184
234 3300005455 Ga0070663_100169733 Ga0070663_1001697332 184
235 3300005455 Ga0070663_100497756 Ga0070663_1004977562 184
236 3300005456 Ga0070678_100048400 Ga0070678_1000484003 184
237 3300005456 Ga0070678_100053734 Ga0070678_1000537343 184
238 3300005456 Ga0070678_100169802 Ga0070678_1001698022 184
239 3300005456 Ga0070678_100229311 Ga0070678_1002293112 184
240 3300005456 Ga0070678_100441314 Ga0070678_1004413142 184
241 3300005456 Ga0070678_100806755 Ga0070678_1008067552 184
242 3300005457 Ga0070662_100012157 Ga0070662_1000121573 184
243 3300005457 Ga0070662_100023662 Ga0070662_1000236622 184
244 3300005457 Ga0070662_100091956 Ga0070662_1000919562 184
245 3300005457 Ga0070662_100450243 Ga0070662_1004502431 184
246 3300005458 Ga0070681_10130574 Ga0070681_101305742 184
247 3300005459 Ga0068867_100033665 Ga0068867_1000336654 184
248 3300005459 Ga0068867_100218580 Ga0068867_1002185802 184
249 3300005459 Ga0068867_100450506 Ga0068867_1004505062 184
250 3300005459 Ga0068867_100535071 Ga0068867_1005350712 184
251 3300005459 Ga0068867_101136767 Ga0068867_1011367671 184
252 3300005466 Ga0070685_10480390 Ga0070685_104803902 184
253 3300005530 Ga0070679_100010948 Ga0070679_1000109489 184
254 3300005530 Ga0070679_100349390 Ga0070679_1003493902 184
255 3300005535 Ga0070684_100019585 Ga0070684_1000195854 184
256 3300005535 Ga0070684_100404076 Ga0070684_1004040762 184
257 3300005539 Ga0068853_100046393 Ga0068853_1000463933 184
258 3300005539 Ga0068853_100311331 Ga0068853_1003113312 184
259 3300005539 Ga0068853_100441130 Ga0068853_1004411302 184
260 3300005539 Ga0068853_100501800 Ga0068853_1005018002 184
261 3300005543 Ga0070672_100020940 Ga0070672_1000209402 184
262 3300005543 Ga0070672_100086261 Ga0070672_1000862612 184
263 3300005543 Ga0070672_100153963 Ga0070672_1001539632 184
264 3300005543 Ga0070672_100217852 Ga0070672_1002178522 184
265 3300005543 Ga0070672_100254895 Ga0070672_1002548952 184
266 3300005543 Ga0070672_100540988 Ga0070672_1005409882 184
267 3300005543 Ga0070672_100694902 Ga0070672_1006949022 184
268 3300005544 Ga0070686_100087148 Ga0070686_1000871482 184
269 3300005563 Ga0068855_100039058 Ga0068855_1000390583 184
270 3300005564 Ga0070664_100160693 Ga0070664_1001606932 184
271 3300005564 Ga0070664_100174782 Ga0070664_1001747822 184
272 3300005564 Ga0070664_100419519 Ga0070664_1004195192 184
273 3300005564 Ga0070664_100558804 Ga0070664_1005588042 184
274 3300005577 Ga0068857_100174217 Ga0068857_1001742172 184
275 3300005578 Ga0068854_100190261 Ga0068854_1001902612 184
276 3300005578 Ga0068854_100246187 Ga0068854_1002461872 184
277 3300005614 Ga0068856_100083350 Ga0068856_1000833502 184
278 3300005614 Ga0068856_100828582 Ga0068856_1008285821 184
279 3300005615 Ga0070702_100553015 Ga0070702_1005530152 184
280 3300005616 Ga0068852_100179606 Ga0068852_1001796062 184
281 3300005616 Ga0068852_100202806 Ga0068852_1002028062 184
282 3300005616 Ga0068852_100226474 Ga0068852_1002264742 184
283 3300005616 Ga0068852_100457566 Ga0068852_1004575662 184
284 3300005616 Ga0068852_100761867 Ga0068852_1007618672 184
285 3300005616 Ga0068852_100807435 Ga0068852_1008074352 184
286 3300005616 Ga0068852_100860374 Ga0068852_1008603742 184
287 3300005616 Ga0068852_100925284 Ga0068852_1009252841 184
288 3300005616 Ga0068852_101039117 Ga0068852_1010391172 184
289 3300005617 Ga0068859_100068114 Ga0068859_1000681143 184
290 3300005618 Ga0068864_100083775 Ga0068864_1000837753 184
291 3300005618 Ga0068864_100126759 Ga0068864_1001267593 184
292 3300005618 Ga0068864_100161904 Ga0068864_1001619042 184
293 3300005618 Ga0068864_100843530 Ga0068864_1008435302 184
294 3300005718 Ga0068866_10131381 Ga0068866_101313811 184
295 3300005719 Ga0068861_100011946 Ga0068861_1000119465 184
296 3300005719 Ga0068861_100067050 Ga0068861_1000670502 184
297 3300005719 Ga0068861_100443501 Ga0068861_1004435012 184
298 3300005834 Ga0068851_10169368 Ga0068851_101693682 184
299 3300005834 Ga0068851_10299336 Ga0068851_102993362 184
300 3300005840 Ga0068870_10349408 Ga0068870_103494082 184
301 3300005841 Ga0068863_100003466 Ga0068863_1000034662 184
302 3300005841 Ga0068863_100071438 Ga0068863_1000714384 184
303 3300005841 Ga0068863_100167627 Ga0068863_1001676272 184
304 3300005841 Ga0068863_100379684 Ga0068863_1003796842 184
305 3300005841 Ga0068863_100504607 Ga0068863_1005046072 184
306 3300005842 Ga0068858_100004898 Ga0068858_10000489814 184
307 3300005842 Ga0068858_100127377 Ga0068858_1001273772 184
308 3300005843 Ga0068860_100005443 Ga0068860_1000054434 184
309 3300005843 Ga0068860_100033915 Ga0068860_1000339152 184
310 3300005843 Ga0068860_100760658 Ga0068860_1007606582 184
311 3300005844 Ga0068862_100107966 Ga0068862_1001079662 184
312 3300006048 Ga0075363_100010846 Ga0075363_1000108463 184
313 3300006048 Ga0075363_100110179 Ga0075363_1001101792 184
314 3300006051 Ga0075364_10064338 Ga0075364_100643382 184
315 3300006051 Ga0075364_10079127 Ga0075364_100791273 184
316 3300006058 Ga0075432_10044377 Ga0075432_100443772 184
317 3300006177 Ga0075362_10007059 Ga0075362_100070592 184
318 3300006177 Ga0075362_10216834 Ga0075362_102168342 184
319 3300006178 Ga0075367_10092734 Ga0075367_100927342 184
320 3300006195 Ga0075366_10001983 Ga0075366_100019834 184
321 3300006195 Ga0075366_10512295 Ga0075366_105122952 184
322 3300006237 Ga0097621_100061406 Ga0097621_1000614063 184
323 3300006237 Ga0097621_100476730 Ga0097621_1004767302 184
324 3300006237 Ga0097621_100891985 Ga0097621_1008919852 184
325 3300006237 Ga0097621_101006728 Ga0097621_1010067282 184
326 3300006237 Ga0097621_101049719 Ga0097621_1010497192 184
327 3300006353 Ga0075370_10010702 Ga0075370_100107022 184
328 3300006353 Ga0075370_10231396 Ga0075370_102313962 184
329 3300006358 Ga0068871_100040497 Ga0068871_1000404973 184
330 3300006358 Ga0068871_100078417 Ga0068871_1000784173 184
331 3300006358 Ga0068871_100226512 Ga0068871_1002265122 184
332 3300006358 Ga0068871_100520155 Ga0068871_1005201552 184
333 3300006880 Ga0075429_101371786 Ga0075429_1013717861 184
334 3300006881 Ga0068865_100017528 Ga0068865_1000175282 184
335 3300006881 Ga0068865_100880386 Ga0068865_1008803861 184
336 3300006931 Ga0097620_100068114 Ga0097620_1000681143 184
337 3300006946 Ga0079104_1011880 Ga0079104_10118802 184
338 3300006948 Ga0099826_10000087 Ga0099826_100000878 184
339 3300006948 Ga0099826_10073699 Ga0099826_100736992 184
340 3300006948 Ga0099826_10106542 Ga0099826_101065422 184
341 3300009092 Ga0105250_10099215 Ga0105250_100992152 184
342 3300009093 Ga0105240_11660554 Ga0105240_116605541 184
343 3300009094 Ga0111539_11389437 Ga0111539_113894371 184
344 3300009098 Ga0105245_10380447 Ga0105245_103804472 184
345 3300009098 Ga0105245_11357543 Ga0105245_113575432 184
346 3300009148 Ga0105243_10068322 Ga0105243_100683222 184
347 3300009176 Ga0105242_10210395 Ga0105242_102103952 184
348 3300009176 Ga0105242_10369020 Ga0105242_103690202 184
349 3300009176 Ga0105242_10704672 Ga0105242_107046722 184
350 3300009177 Ga0105248_10051302 Ga0105248_100513025 184
351 3300009177 Ga0105248_10234103 Ga0105248_102341032 184
352 3300009177 Ga0105248_10274624 Ga0105248_102746242 184
353 3300009177 Ga0105248_10895276 Ga0105248_108952762 184
354 3300009177 Ga0105248_11090375 Ga0105248_110903751 184
355 3300009177 Ga0105248_11137738 Ga0105248_111377382 184
356 3300009545 Ga0105237_10060033 Ga0105237_100600333 184
357 3300009551 Ga0105238_10188351 Ga0105238_101883512 184
358 3300009551 Ga0105238_10768242 Ga0105238_107682422 184
359 3300009551 Ga0105238_11194564 Ga0105238_111945642 184
360 3300009553 Ga0105249_10050443 Ga0105249_100504432 184
361 3300009553 Ga0105249_10753312 Ga0105249_107533121 184
362 3300010375 Ga0105239_10066299 Ga0105239_100662993 184
363 3300011119 Ga0105246_10524362 Ga0105246_105243622 184
364 3300012495 Ga0157323_1002135 Ga0157323_10021352 184
365 3300012502 Ga0157347_1000221 Ga0157347_10002212 184
366 3300012512 Ga0157327_1000947 Ga0157327_10009471 184
367 3300012513 Ga0157326_1000451 Ga0157326_10004512 184
368 3300013100 Ga0157373_10199882 Ga0157373_101998822 184
369 3300013104 Ga0157370_10003845 Ga0157370_1000384517 184
370 3300013104 Ga0157370_10188740 Ga0157370_101887402 184
371 3300013104 Ga0157370_10912150 Ga0157370_109121501 184
372 3300013104 Ga0157370_10998864 Ga0157370_109988641 184
373 3300013105 Ga0157369_10166440 Ga0157369_101664402 184
374 3300013105 Ga0157369_11133031 Ga0157369_111330312 184
375 3300013296 Ga0157374_10037741 Ga0157374_100377413 184
376 3300013296 Ga0157374_10992622 Ga0157374_109926222 184
377 3300013297 Ga0157378_10664449 Ga0157378_106644491 184
378 3300013297 Ga0157378_10832512 Ga0157378_108325122 184
379 3300013306 Ga0163162_10038435 Ga0163162_100384355 184
380 3300013306 Ga0163162_10222435 Ga0163162_102224352 184
381 3300013306 Ga0163162_10339447 Ga0163162_103394472 184
382 3300013306 Ga0163162_10688500 Ga0163162_106885002 184
383 3300013306 Ga0163162_10758646 Ga0163162_107586462 184
384 3300013307 Ga0157372_10355864 Ga0157372_103558642 184
385 3300013308 Ga0157375_10125411 Ga0157375_101254112 184
386 3300013308 Ga0157375_10702613 Ga0157375_107026132 184
387 3300013308 Ga0157375_10736169 Ga0157375_107361692 184
388 3300013308 Ga0157375_10759448 Ga0157375_107594482 184
389 3300013308 Ga0157375_10763925 Ga0157375_107639252 184
390 3300014325 Ga0163163_10704698 Ga0163163_107046982 184
391 3300014326 Ga0157380_10019496 Ga0157380_100194964 184
392 3300014326 Ga0157380_10019525 Ga0157380_100195256 184
393 3300014326 Ga0157380_10176244 Ga0157380_101762442 184
394 3300014326 Ga0157380_10218221 Ga0157380_102182212 184
395 3300014497 Ga0182008_10008214 Ga0182008_100082142 184
396 3300014497 Ga0182008_10119643 Ga0182008_101196432 184
397 3300014745 Ga0157377_10012265 Ga0157377_100122655 184
398 3300014745 Ga0157377_10197256 Ga0157377_101972561 184
399 3300014968 Ga0157379_10318866 Ga0157379_103188662 184
400 3300014968 Ga0157379_10398164 Ga0157379_103981642 184
401 3300014969 Ga0157376_10103751 Ga0157376_101037513 184
402 3300014969 Ga0157376_10257822 Ga0157376_102578222 184
403 3300014969 Ga0157376_10830816 Ga0157376_108308162 184
404 3300015261 Ga0182006_1017723 Ga0182006_10177233 184
405 3300015261 Ga0182006_1079020 Ga0182006_10790202 184
406 3300015262 Ga0182007_10021566 Ga0182007_100215662 184
407 3300017792 Ga0163161_10000329 Ga0163161_1000032911 184
408 3300017792 Ga0163161_10013701 Ga0163161_100137015 184
409 3300017792 Ga0163161_10053805 Ga0163161_100538052 184
410 3300017792 Ga0163161_10321025 Ga0163161_103210252 184
411 3300017792 Ga0163161_10362833 Ga0163161_103628332 184
412 3300017792 Ga0163161_11166137 Ga0163161_111661371 184
413 3300025206 Ga0209435_100003 Ga0209435_100003139 184
414 3300025208 Ga0209436_105046 Ga0209436_1050464 184
415 3300025245 Ga0207425_1001243 Ga0207425_10012439 184
416 3300025245 Ga0207425_1007648 Ga0207425_10076482 184
417 3300025246 Ga0209646_1000008 Ga0209646_1000008139 184
418 3300025250 Ga0209026_1000007 Ga0209026_1000007139 184
419 3300025256 Ga0209759_1000026 Ga0209759_1000026141 184
420 3300025258 Ga0209129_1007409 Ga0209129_10074092 184
421 3300025258 Ga0209129_1032236 Ga0209129_10322361 184
422 3300025263 Ga0209565_1000026 Ga0209565_1000026342 184
423 3300025263 Ga0209565_1000150 Ga0209565_100015037 184
424 3300025263 Ga0209565_1001312 Ga0209565_10013128 184
425 3300025263 Ga0209565_1061899 Ga0209565_10618991 184
426 3300025273 Ga0209673_1000009 Ga0209673_1000009349 184
427 3300025273 Ga0209673_1000012 Ga0209673_1000012250 184
428 3300025273 Ga0209673_1000114 Ga0209673_1000114119 184
429 3300025273 Ga0209673_1008634 Ga0209673_10086343 184
430 3300025273 Ga0209673_1066189 Ga0209673_10661892 184
431 3300025284 Ga0209130_1000099 Ga0209130_100009992 184
432 3300025284 Ga0209130_1000123 Ga0209130_10001234 184
433 3300025284 Ga0209130_1006153 Ga0209130_10061533 184
434 3300025291 Ga0209675_1000062 Ga0209675_1000062119 184
435 3300025291 Ga0209675_1000155 Ga0209675_100015513 184
436 3300025291 Ga0209675_1004791 Ga0209675_10047912 184
437 3300025291 Ga0209675_1005864 Ga0209675_10058642 184
438 3300025292 Ga0209676_1000051 Ga0209676_1000051118 184
439 3300025292 Ga0209676_1000325 Ga0209676_100032557 184
440 3300025292 Ga0209676_1008862 Ga0209676_10088623 184
441 3300025294 Ga0209025_1004061 Ga0209025_10040619 184
442 3300025294 Ga0209025_1007738 Ga0209025_10077389 184
443 3300025294 Ga0209025_1009286 Ga0209025_10092868 184
444 3300025294 Ga0209025_1016364 Ga0209025_10163644 184
445 3300025295 Ga0209564_1000211 Ga0209564_100021124 184
446 3300025295 Ga0209564_1000228 Ga0209564_100022824 184
447 3300025295 Ga0209564_1004815 Ga0209564_10048155 184
448 3300025297 Ga0209758_1083564 Ga0209758_10835642 184
449 3300025298 Ga0209050_1000044 Ga0209050_1000044228 184
450 3300025298 Ga0209050_1003950 Ga0209050_10039504 184
451 3300025298 Ga0209050_1010312 Ga0209050_10103122 184
452 3300025298 Ga0209050_1038509 Ga0209050_10385092 184
453 3300025298 Ga0209050_1057750 Ga0209050_10577502 184
454 3300025299 Ga0209256_1000003 Ga0209256_1000003504 184
455 3300025299 Ga0209256_1025111 Ga0209256_10251112 184
456 3300025302 Ga0207426_1000062 Ga0207426_1000062257 184
457 3300025303 Ga0209051_1000031 Ga0209051_1000031228 184
458 3300025303 Ga0209051_1000208 Ga0209051_100020826 184
459 3300025303 Ga0209051_1000760 Ga0209051_100076028 184
460 3300025303 Ga0209051_1060818 Ga0209051_10608182 184
461 3300025304 Ga0209257_1000058 Ga0209257_1000058222 184
462 3300025304 Ga0209257_1008393 Ga0209257_10083934 184
463 3300025304 Ga0209257_1013462 Ga0209257_10134623 184
464 3300025315 Ga0207697_10032926 Ga0207697_100329263 184
465 3300025315 Ga0207697_10241147 Ga0207697_102411472 184
466 3300025315 Ga0207697_10255735 Ga0207697_102557352 184
467 3300025321 Ga0207656_10062842 Ga0207656_100628422 184
468 3300025893 Ga0207682_10009146 Ga0207682_100091462 184
469 3300025893 Ga0207682_10038424 Ga0207682_100384242 184
470 3300025893 Ga0207682_10061961 Ga0207682_100619612 184
471 3300025893 Ga0207682_10154994 Ga0207682_101549942 184
472 3300025899 Ga0207642_10015639 Ga0207642_100156393 184
473 3300025901 Ga0207688_10033243 Ga0207688_100332432 184
474 3300025901 Ga0207688_10148393 Ga0207688_101483932 184
475 3300025901 Ga0207688_10234204 Ga0207688_102342042 184
476 3300025903 Ga0207680_10363368 Ga0207680_103633682 184
477 3300025903 Ga0207680_10719171 Ga0207680_107191712 184
478 3300025907 Ga0207645_10007091 Ga0207645_100070915 184
479 3300025907 Ga0207645_10027206 Ga0207645_100272063 184
480 3300025907 Ga0207645_10202394 Ga0207645_102023942 184
481 3300025907 Ga0207645_10401707 Ga0207645_104017072 184
482 3300025912 Ga0207707_10208990 Ga0207707_102089902 184
483 3300025914 Ga0207671_10162669 Ga0207671_101626691 184
484 3300025917 Ga0207660_10007738 Ga0207660_100077382 184
485 3300025918 Ga0207662_10036429 Ga0207662_100364292 184
486 3300025918 Ga0207662_10063557 Ga0207662_100635572 184
487 3300025918 Ga0207662_10325602 Ga0207662_103256021 184
488 3300025920 Ga0207649_10450638 Ga0207649_104506382 184
489 3300025921 Ga0207652_10005260 Ga0207652_100052602 184
490 3300025923 Ga0207681_10018416 Ga0207681_100184164 184
491 3300025923 Ga0207681_10043750 Ga0207681_100437504 184
492 3300025923 Ga0207681_10402397 Ga0207681_104023972 184
493 3300025923 Ga0207681_10465468 Ga0207681_104654682 184
494 3300025924 Ga0207694_10076303 Ga0207694_100763033 184
495 3300025925 Ga0207650_10023527 Ga0207650_100235272 184
496 3300025925 Ga0207650_10069686 Ga0207650_100696862 184
497 3300025925 Ga0207650_10178246 Ga0207650_101782462 184
498 3300025925 Ga0207650_10189625 Ga0207650_101896252 184
499 3300025925 Ga0207650_10254052 Ga0207650_102540522 184
500 3300025925 Ga0207650_10357721 Ga0207650_103577212 184
501 3300025925 Ga0207650_10442076 Ga0207650_104420762 184
502 3300025925 Ga0207650_10507514 Ga0207650_105075142 184
503 3300025925 Ga0207650_10572600 Ga0207650_105726002 184
504 3300025926 Ga0207659_10020490 Ga0207659_100204903 184
505 3300025926 Ga0207659_10138499 Ga0207659_101384992 184
506 3300025926 Ga0207659_10260594 Ga0207659_102605942 184
507 3300025926 Ga0207659_10504640 Ga0207659_105046402 184
508 3300025926 Ga0207659_10693881 Ga0207659_106938811 184
509 3300025927 Ga0207687_10231983 Ga0207687_102319832 184
510 3300025927 Ga0207687_10241112 Ga0207687_102411122 184
511 3300025932 Ga0207690_10095883 Ga0207690_100958832 184
512 3300025932 Ga0207690_10503538 Ga0207690_105035382 184
513 3300025933 Ga0207706_10045478 Ga0207706_100454785 184
514 3300025933 Ga0207706_10152950 Ga0207706_101529502 184
515 3300025933 Ga0207706_10206870 Ga0207706_102068702 184
516 3300025933 Ga0207706_10661657 Ga0207706_106616572 184
517 3300025934 Ga0207686_10071853 Ga0207686_100718532 184
518 3300025934 Ga0207686_10201916 Ga0207686_102019162 184
519 3300025935 Ga0207709_10021397 Ga0207709_100213973 184
520 3300025935 Ga0207709_10120378 Ga0207709_101203782 184
521 3300025937 Ga0207669_10026733 Ga0207669_100267332 184
522 3300025937 Ga0207669_10186688 Ga0207669_101866882 184
523 3300025937 Ga0207669_10515161 Ga0207669_105151612 184
524 3300025938 Ga0207704_10217717 Ga0207704_102177172 184
525 3300025939 Ga0207665_10062982 Ga0207665_100629822 184
526 3300025940 Ga0207691_10017865 Ga0207691_100178656 184
527 3300025940 Ga0207691_10038713 Ga0207691_100387135 184
528 3300025940 Ga0207691_10168616 Ga0207691_101686162 184
529 3300025940 Ga0207691_10196626 Ga0207691_101966262 184
530 3300025940 Ga0207691_10204227 Ga0207691_102042272 184
531 3300025940 Ga0207691_10320459 Ga0207691_103204592 184
532 3300025940 Ga0207691_10472773 Ga0207691_104727732 184
533 3300025940 Ga0207691_10633375 Ga0207691_106333752 184
534 3300025941 Ga0207711_10019765 Ga0207711_100197655 184
535 3300025941 Ga0207711_10054755 Ga0207711_100547552 184
536 3300025941 Ga0207711_10679055 Ga0207711_106790552 184
537 3300025941 Ga0207711_10680977 Ga0207711_106809772 184
538 3300025942 Ga0207689_10001957 Ga0207689_1000195716 184
539 3300025942 Ga0207689_10057292 Ga0207689_100572922 184
540 3300025942 Ga0207689_10295671 Ga0207689_102956712 184
541 3300025944 Ga0207661_10382422 Ga0207661_103824221 184
542 3300025945 Ga0207679_10277308 Ga0207679_102773082 184
543 3300025945 Ga0207679_10360161 Ga0207679_103601612 184
544 3300025945 Ga0207679_10559851 Ga0207679_105598512 184
545 3300025945 Ga0207679_10693491 Ga0207679_106934912 184
546 3300025960 Ga0207651_10048641 Ga0207651_100486412 184
547 3300025960 Ga0207651_10198016 Ga0207651_101980162 184
548 3300025960 Ga0207651_10597533 Ga0207651_105975332 184
549 3300025961 Ga0207712_10085529 Ga0207712_100855292 184
550 3300025961 Ga0207712_10312278 Ga0207712_103122782 184
551 3300025961 Ga0207712_10665561 Ga0207712_106655612 184
552 3300025972 Ga0207668_10013103 Ga0207668_100131036 184
553 3300025972 Ga0207668_10140566 Ga0207668_101405662 184
554 3300025972 Ga0207668_10256489 Ga0207668_102564892 184
555 3300025986 Ga0207658_10040984 Ga0207658_100409842 184
556 3300025986 Ga0207658_10086776 Ga0207658_100867763 184
557 3300025986 Ga0207658_10358044 Ga0207658_103580442 184
558 3300026023 Ga0207677_10013473 Ga0207677_100134732 184
559 3300026035 Ga0207703_10007902 Ga0207703_100079023 184
560 3300026035 Ga0207703_10021291 Ga0207703_100212915 184
561 3300026035 Ga0207703_10252155 Ga0207703_102521552 184
562 3300026041 Ga0207639_10016030 Ga0207639_100160304 184
563 3300026041 Ga0207639_11478983 Ga0207639_114789831 184
564 3300026067 Ga0207678_10360782 Ga0207678_103607822 184
565 3300026067 Ga0207678_10677685 Ga0207678_106776851 184
566 3300026075 Ga0207708_10211045 Ga0207708_102110452 184
567 3300026075 Ga0207708_10557909 Ga0207708_105579092 184
568 3300026078 Ga0207702_10121901 Ga0207702_101219013 184
569 3300026088 Ga0207641_10012091 Ga0207641_100120917 184
570 3300026088 Ga0207641_10021771 Ga0207641_100217716 184
571 3300026088 Ga0207641_10677285 Ga0207641_106772852 184
572 3300026088 Ga0207641_10860190 Ga0207641_108601902 184
573 3300026089 Ga0207648_10120272 Ga0207648_101202723 184
574 3300026089 Ga0207648_10177046 Ga0207648_101770462 184
575 3300026089 Ga0207648_10210706 Ga0207648_102107061 184
576 3300026089 Ga0207648_10399361 Ga0207648_103993612 184
577 3300026089 Ga0207648_10479927 Ga0207648_104799272 184
578 3300026089 Ga0207648_10614029 Ga0207648_106140292 184
579 3300026095 Ga0207676_10005921 Ga0207676_100059219 184
580 3300026095 Ga0207676_10037212 Ga0207676_100372122 184
581 3300026095 Ga0207676_10067533 Ga0207676_100675333 184
582 3300026095 Ga0207676_10342735 Ga0207676_103427352 184
583 3300026095 Ga0207676_10996626 Ga0207676_109966261 184
584 3300026095 Ga0207676_11214535 Ga0207676_112145352 184
585 3300026116 Ga0207674_10205009 Ga0207674_102050092 184
586 3300026116 Ga0207674_11105118 Ga0207674_111051182 184
587 3300026118 Ga0207675_100004245 Ga0207675_1000042453 184
588 3300026118 Ga0207675_100004891 Ga0207675_1000048915 184
589 3300026118 Ga0207675_100563902 Ga0207675_1005639022 184
590 3300026118 Ga0207675_100782674 Ga0207675_1007826742 184
591 3300026118 Ga0207675_100927088 Ga0207675_1009270882 184
592 3300026121 Ga0207683_10009318 Ga0207683_100093186 184
593 3300026121 Ga0207683_10037761 Ga0207683_100377612 184
594 3300026121 Ga0207683_10051292 Ga0207683_100512923 184
595 3300026121 Ga0207683_10066018 Ga0207683_100660182 184
596 3300026121 Ga0207683_10269765 Ga0207683_102697652 184
597 3300026121 Ga0207683_10458882 Ga0207683_104588822 184
598 3300026121 Ga0207683_10553535 Ga0207683_105535352 184
599 3300026121 Ga0207683_10606326 Ga0207683_106063261 184
600 3300026142 Ga0207698_10183741 Ga0207698_101837412 184
601 3300026142 Ga0207698_10669334 Ga0207698_106693342 184
602 3300026142 Ga0207698_10804346 Ga0207698_108043462 184
603 3300026142 Ga0207698_10858230 Ga0207698_108582302 184
604 3300026142 Ga0207698_11257245 Ga0207698_112572452 184
605 3300027111 Ga0209281_1023406 Ga0209281_10234062 184
606 3300027666 Ga0209282_1000307 Ga0209282_10003074 184
607 3300028379 Ga0268266_11040786 Ga0268266_110407861 184
608 3300028380 Ga0268265_10118750 Ga0268265_101187502 184
609 3300028380 Ga0268265_10979518 Ga0268265_109795181 184
610 3300028381 Ga0268264_10004057 Ga0268264_100040579 184
611 3300028381 Ga0268264_10015030 Ga0268264_100150302 184
612 3300028794 Ga0307515_10000064 Ga0307515_10000064112 184
613 3300030735 Ga0316178_1126380 Ga0316178_11263803 184
614 3300030742 Ga0316183_1110495 Ga0316183_11104952 184
615 3300030745 Ga0316182_1084678 Ga0316182_10846782 184
616 3300031456 Ga0307513_10000090 Ga0307513_1000009038 184
617 3300031456 Ga0307513_10116438 Ga0307513_101164383 184
618 3300031456 Ga0307513_10499229 Ga0307513_104992292 184
619 3300031548 Ga0307408_100005621 Ga0307408_1000056211 184
620 3300031548 Ga0307408_100039727 Ga0307408_1000397272 184
621 3300031548 Ga0307408_100086585 Ga0307408_1000865852 184
622 3300031548 Ga0307408_100096359 Ga0307408_1000963592 184
623 3300031548 Ga0307408_100132717 Ga0307408_1001327172 184
624 3300031548 Ga0307408_100304331 Ga0307408_1003043312 184
625 3300031548 Ga0307408_100422714 Ga0307408_1004227142 184
626 3300031548 Ga0307408_100438115 Ga0307408_1004381152 184
627 3300031548 Ga0307408_100530569 Ga0307408_1005305692 184
628 3300031649 Ga0307514_10011166 Ga0307514_100111663 184
629 3300031731 Ga0307405_10005918 Ga0307405_100059185 184
630 3300031731 Ga0307405_10037668 Ga0307405_100376684 184
631 3300031731 Ga0307405_10073841 Ga0307405_100738412 184
632 3300031731 Ga0307405_10086027 Ga0307405_100860272 184
633 3300031731 Ga0307405_10098412 Ga0307405_100984122 184
634 3300031731 Ga0307405_10176158 Ga0307405_101761582 184
635 3300031731 Ga0307405_10202895 Ga0307405_102028952 184
636 3300031731 Ga0307405_10421922 Ga0307405_104219222 184
637 3300031731 Ga0307405_10491745 Ga0307405_104917452 184
638 3300031824 Ga0307413_10056403 Ga0307413_100564032 184
639 3300031824 Ga0307413_10221699 Ga0307413_102216992 184
640 3300031824 Ga0307413_10842566 Ga0307413_108425661 184
641 3300031852 Ga0307410_10042903 Ga0307410_100429033 184
642 3300031852 Ga0307410_10052712 Ga0307410_100527122 184
643 3300031852 Ga0307410_10413332 Ga0307410_104133322 184
644 3300031901 Ga0307406_10006495 Ga0307406_100064958 184
645 3300031901 Ga0307406_10018017 Ga0307406_100180174 184
646 3300031901 Ga0307406_10056965 Ga0307406_100569653 184
647 3300031901 Ga0307406_10252847 Ga0307406_102528472 184
648 3300031901 Ga0307406_10376040 Ga0307406_103760402 184
649 3300031901 Ga0307406_10431824 Ga0307406_104318242 184
650 3300031901 Ga0307406_10491338 Ga0307406_104913382 184
651 3300031901 Ga0307406_10706521 Ga0307406_107065212 184
652 3300031903 Ga0307407_10039408 Ga0307407_100394082 184
653 3300031903 Ga0307407_10259091 Ga0307407_102590911 184
654 3300031911 Ga0307412_10002222 Ga0307412_100022228 184
655 3300031911 Ga0307412_10029007 Ga0307412_100290073 184
656 3300031911 Ga0307412_10046332 Ga0307412_100463323 184
657 3300031911 Ga0307412_10071053 Ga0307412_100710532 184
658 3300031911 Ga0307412_10163776 Ga0307412_101637762 184
659 3300031911 Ga0307412_10249457 Ga0307412_102494571 184
660 3300031911 Ga0307412_10475267 Ga0307412_104752672 184
661 3300031995 Ga0307409_100000592 Ga0307409_10000059213 184
662 3300032002 Ga0307416_100006736 Ga0307416_1000067365 184
663 3300032002 Ga0307416_100030125 Ga0307416_1000301254 184
664 3300032002 Ga0307416_100078038 Ga0307416_1000780383 184
665 3300032002 Ga0307416_100093935 Ga0307416_1000939353 184
666 3300032002 Ga0307416_100176293 Ga0307416_1001762932 184
667 3300032002 Ga0307416_100214103 Ga0307416_1002141032 184
668 3300032004 Ga0307414_10011967 Ga0307414_100119672 184
669 3300032004 Ga0307414_10223393 Ga0307414_102233932 184
670 3300032004 Ga0307414_10385631 Ga0307414_103856312 184
671 3300032004 Ga0307414_10418882 Ga0307414_104188822 184
672 3300032004 Ga0307414_10888273 Ga0307414_108882732 184
673 3300032005 Ga0307411_10080376 Ga0307411_100803762 184
674 3300032126 Ga0307415_100002275 Ga0307415_1000022752 184
675 3300032126 Ga0307415_100454217 Ga0307415_1004542172 184
676 3300035089 Ga0373944_0292425 Ga0373944_0292425_31_591 184
677 3300035172 Ga0373955_0116903 Ga0373955_0116903_628_1185 184
678 3300035691 Ga0373931_0045475 Ga0373931_0045475_1091_1660 184
679 3300035692 Ga0373935_0338915 Ga0373935_0338915_412_969 184
680 3300035692 Ga0373935_0509997 Ga0373935_0509997_154_714 184
681 3300035695 Ga0373927_0219919 Ga0373927_0219919_38_598 184
682 3300036401 Ga0373937_0423920 Ga0373937_0423920_237_794 184
683 3300037312 Ga0395899_0003326 Ga0395899_0003326_7455_8048 184
684 3300037466 Ga0395898_0007717 Ga0395898_0007717_4626_5219 184
685 3300037471 Ga0395905_0000492 Ga0395905_0000492_15757_16350 184
686 3300037471 Ga0395905_0005285 Ga0395905_0005285_3175_3768 184
687 3300038443 Ga0395901_0345743 Ga0395901_0345743_155_748 184
688 3300041404 Ga0439436_0044193 Ga0439436_0044193_212_769 184
689 3300041406 Ga0439439_0017080 Ga0439439_0017080_419_976 184
690 3300041407 Ga0439447_014294 Ga0439447_014294_1617_2174 184
691 3300041407 Ga0439447_035437 Ga0439447_035437_365_922 184
692 3300041411 Ga0439466_0008218 Ga0439466_0008218_1645_2202 184
693 3300041411 Ga0439466_0012417 Ga0439466_0012417_2140_2697 184
694 3300041411 Ga0439466_0128780 Ga0439466_0128780_109_666 184
695 3300041413 Ga0439465_0021445 Ga0439465_0021445_495_1052 184
696 3300041443 Ga0451789_0567393 Ga0451789_0567393_613_1191 184
697 3300041451 Ga0451791_1410299 Ga0451791_1410299_31_585 184
698 3300041456 Ga0451795_1340527 Ga0451795_1340527_33_590 184
699 3300041494 Ga0451837_0128052 Ga0451837_0128052_432_992 184
700 3300041496 Ga0451839_0069363 Ga0451839_0069363_19_573 184
701 3300041509 Ga0451843_0600576 Ga0451843_0600576_346_903 184
702 3300041512 Ga0451853_2861878 Ga0451853_2861878_1244_1804 184
703 3300041997 Ga0439431_0034770 Ga0439431_0034770_373_930 184
704 3300041997 Ga0439431_0063027 Ga0439431_0063027_76_636 184
705 3300041999 Ga0439433_0008170 Ga0439433_0008170_1150_1707 184
706 3300042002 Ga0439442_030730 Ga0439442_030730_436_993 184
707 3300042004 Ga0439445_0001503 Ga0439445_0001503_2122_2679 184
708 3300042004 Ga0439445_0014743 Ga0439445_0014743_110_667 184
709 3300042006 Ga0439432_000751 Ga0439432_000751_9087_9644 184
710 3300042007 Ga0439449_0002753 Ga0439449_0002753_2752_3309 184
711 3300042007 Ga0439449_0042584 Ga0439449_0042584_635_1192 184
712 3300042010 Ga0439452_010200 Ga0439452_010200_359_916 184
713 3300042010 Ga0439452_020482 Ga0439452_020482_107_664 184
714 3300042014 Ga0439457_018482 Ga0439457_018482_352_909 184
715 3300042015 Ga0439462_0026957 Ga0439462_0026957_606_1163 184
716 3300042115 Ga0450911_000714 Ga0450911_000714_6054_6611 184
717 3300042124 Ga0450922_023042 Ga0450922_023042_45_602 184
718 3300042128 Ga0450897_007865 Ga0450897_007865_52_609 184
719 3300042145 Ga0450906_017658 Ga0450906_017658_504_1061 184
720 3300042435 Ga0439434_0000521 Ga0439434_0000521_2833_3390 184
721 3300046455 Ga0495603_0096110 Ga0495603_0096110_242_802 184
722 3300046459 Ga0495629_0181676 Ga0495629_0181676_730_1290 184
723 3300046472 Ga0495580_0030828 Ga0495580_0030828_3146_3712 184
724 3300046473 Ga0495582_0277582 Ga0495582_0277582_209_769 184
725 3300046475 Ga0495639_0104206 Ga0495639_0104206_458_1015 184
726 3300046475 Ga0495639_0304126 Ga0495639_0304126_61_621 184
727 3300046522 Ga0495643_0127369 Ga0495643_0127369_301_858 184
728 3300046530 Ga0495654_0003475 Ga0495654_0003475_8867_9424 184
729 3300046530 Ga0495654_0074893 Ga0495654_0074893_487_1044 184
730 3300046558 Ga0495633_0178835 Ga0495633_0178835_32_592 184
731 3300046615 Ga0495656_0002368 Ga0495656_0002368_4223_4780 184
732 3300046615 Ga0495656_0120241 Ga0495656_0120241_415_975 184
733 3300046615 Ga0495656_0176722 Ga0495656_0176722_448_1005 184
734 3300046663 Ga0495635_0144507 Ga0495635_0144507_553_1110 184
735 3300046674 Ga0495588_0084062 Ga0495588_0084062_459_1016 184
736 3300046681 Ga0495647_0134503 Ga0495647_0134503_292_852 184
737 3300046691 Ga0495670_0179989 Ga0495670_0179989_17_577 184
738 3300046809 Ga0495600_0047474 Ga0495600_0047474_1296_1856 184
739 3300046809 Ga0495600_0057169 Ga0495600_0057169_844_1401 184
740 3300047315 Ga0495581_0144641 Ga0495581_0144641_345_902 184
741 3300047471 Ga0495684_0126127 Ga0495684_0126127_406_963 184
742 3300047673 Ga0495593_0162601 Ga0495593_0162601_34_591 184
743 3300048088 Ga0495602_0401047 Ga0495602_0401047_204_761 184
744 3300048904 Ga0496101_0004340 Ga0496101_0004340_2388_2945 184
745 3300048905 Ga0496102_0043995 Ga0496102_0043995_2426_2983 184
746 3300048905 Ga0496102_0170224 Ga0496102_0170224_978_1547 184
747 3300048906 Ga0496103_0042834 Ga0496103_0042834_1121_1678 184
748 3300048906 Ga0496103_0065059 Ga0496103_0065059_701_1270 184
749 3300048907 Ga0496104_0075420 Ga0496104_0075420_2368_2925 184
750 3300048907 Ga0496104_0472587 Ga0496104_0472587_306_875 184
751 3300048907 Ga0496104_0907173 Ga0496104_0907173_41_601 184
752 3300048908 Ga0496105_0013954 Ga0496105_0013954_2689_3246 184
753 3300048908 Ga0496105_0189715 Ga0496105_0189715_1070_1630 184
754 3300048908 Ga0496105_0621609 Ga0496105_0621609_41_601 184
755 3300048909 Ga0496106_0113688 Ga0496106_0113688_371_940 184
756 3300048909 Ga0496106_0404266 Ga0496106_0404266_42_599 184
757 3300048910 Ga0496107_0037832 Ga0496107_0037832_2075_2644 184
758 3300048910 Ga0496107_0326915 Ga0496107_0326915_197_754 184
759 3300048911 Ga0496108_0245790 Ga0496108_0245790_708_1268 184
760 3300048911 Ga0496108_0348394 Ga0496108_0348394_371_940 184
761 3300048911 Ga0496108_0490135 Ga0496108_0490135_348_905 184
762 3300048912 Ga0496109_0316242 Ga0496109_0316242_118_678 184
763 3300048912 Ga0496109_0370781 Ga0496109_0370781_448_1017 184
764 3300048913 Ga0496110_0650962 Ga0496110_0650962_78_635 184
765 3300048916 Ga0496113_0158042 Ga0496113_0158042_1018_1575 184
766 3300048916 Ga0496113_0202107 Ga0496113_0202107_649_1218 184
767 3300048917 Ga0496114_0244812 Ga0496114_0244812_283_852 184
768 3300048917 Ga0496114_0614018 Ga0496114_0614018_295_852 184
769 3300048918 Ga0496115_0420280 Ga0496115_0420280_134_694 184
770 3300048924 Ga0496121_0004542 Ga0496121_0004542_14030_14587 184
771 3300048925 Ga0496122_0000184 Ga0496122_0000184_64387_64944 184
772 3300048926 Ga0496123_0000181 Ga0496123_0000181_1334_1891 184
773 3300048926 Ga0496123_0177131 Ga0496123_0177131_421_978 184
774 3300048927 Ga0496124_0033333 Ga0496124_0033333_928_1485 184
775 3300048927 Ga0496124_0082921 Ga0496124_0082921_1425_1982 184
776 3300048928 Ga0496125_0007111 Ga0496125_0007111_1171_1728 184
777 3300048928 Ga0496125_0007919 Ga0496125_0007919_3637_4194 184
778 3300048929 Ga0496126_0140326 Ga0496126_0140326_551_1108 184
779 3300048929 Ga0496126_0319076 Ga0496126_0319076_42_599 184
780 3300049671 Ga0501238_010778 Ga0501238_010778_104_661 184
781 3300049705 Ga0501225_0006440 Ga0501225_0006440_927_1520 184
782 3300049758 Ga0501241_027674 Ga0501241_027674_79_672 184
783 3300049759 Ga0501262_000209 Ga0501262_000209_2547_3104 184
784 3300050489 nmdc:mga03683_7048_c1 nmdc:mga03683_7048_c1_313_873 184
785 3300050490 nmdc:mga03n38_290553_c1 nmdc:mga03n38_290553_c1_16_570 184
786 3300050490 nmdc:mga03n38_74275_c1 nmdc:mga03n38_74275_c1_145_720 184
787 3300050490 nmdc:mga03n38_88366_c1 nmdc:mga03n38_88366_c1_334_894 184
788 3300050491 nmdc:mga00v17_58579_c1 nmdc:mga00v17_58579_c1_1265_1819 184
789 3300050491 nmdc:mga00v17_85049_c1 nmdc:mga00v17_85049_c1_461_1021 184
790 3300050493 nmdc:mga0k408_131946_c1 nmdc:mga0k408_131946_c1_620_1174 184
791 3300050493 nmdc:mga0k408_234171_c1 nmdc:mga0k408_234171_c1_210_767 184
792 3300050493 nmdc:mga0k408_29966_c1 nmdc:mga0k408_29966_c1_65_640 184
793 3300050493 nmdc:mga0k408_552740_c1 nmdc:mga0k408_552740_c1_88_645 184
794 3300050508 nmdc:mga09592_745833_c1 nmdc:mga09592_745833_c1_169_729 184
795 3300050511 nmdc:mga08y16_712602_c1 nmdc:mga08y16_712602_c1_416_976 184
796 3300050512 nmdc:mga0n895_613493_c1 nmdc:mga0n895_613493_c1_474_1043 184
797 3300053077 Ga0495601_0461740 Ga0495601_0461740_248_805 184
798 3300053077 Ga0495601_0496587 Ga0495601_0496587_188_745 184
799 3300053085 Ga0495619_0200255 Ga0495619_0200255_424_984 184
800 3300053085 Ga0495619_0275516 Ga0495619_0275516_420_977 184
801 3300053088 Ga0500644_0001138 Ga0500644_0001138_2142_2696 184
802 3300053088 Ga0500644_0003553 Ga0500644_0003553_2532_3089 184
803 3300053093 Ga0500651_0005197 Ga0500651_0005197_6473_7030 184
804 3300053094 Ga0500566_0230164 Ga0500566_0230164_93_647 184
805 3300053098 Ga0500650_0118545 Ga0500650_0118545_487_1041 184
806 3300053108 Ga0500562_008265 Ga0500562_008265_1150_1821 184
807 3300053117 Ga0500593_002149 Ga0500593_002149_5071_5625 184
808 3300053118 Ga0500594_0009084 Ga0500594_0009084_223_780 184
809 3300053129 Ga0500628_007338 Ga0500628_007338_432_986 184
810 3300053136 Ga0500559_0040781 Ga0500559_0040781_594_1151 184
811 3300053145 Ga0500586_090956 Ga0500586_090956_412_969 184
812 3300053153 Ga0500616_0034346 Ga0500616_0034346_626_1183 184
813 3300053156 Ga0500622_0128002 Ga0500622_0128002_565_1122 184
814 3300053730 Ga0500645_000061 Ga0500645_000061_79194_79748 184
815 3300053730 Ga0500645_001674 Ga0500645_001674_9678_10232 184
816 3300053730 Ga0500645_021334 Ga0500645_021334_759_1313 184
817 3300055283 Ga0500661_000809 Ga0500661_000809_2685_3239 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

40

165

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m1l-assembly1.cif.gz_B solution nmr structure of cyclin-dependent kinase 2-associated protein 2 (cdk2ap2, doc-1r) from homo sapiens, northeast structural genomics consortium (nesg) target hr8910c 0.6292 13 83
2m1l-assembly1.cif.gz_B solution nmr structure of cyclin-dependent kinase 2-associated protein 2 (cdk2ap2, doc-1r) from homo sapiens, northeast structural genomics consortium (nesg) target hr8910c 0.5989 13 83
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.5904 26 165
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.5645 27 172
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.5474 26 165
ID Description Score Start End Superfamily
af_E7F084_1008_1283_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.8477 96 160 2.60.210.10
af_Q9TYQ6_401_530_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7691 97 175 3.30.40.10
1rq0B01 Special;Helix non-globular;Helix Hairpins; 0.732 80 159 6.10.140.160
af_Q500Z2_70_197_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7201 101 179 3.30.40.10
af_Q54PF0_152_283_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6903 101 180 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A520CLX1-F1-model_v4 TRAP transporter small permease protein 0.8084 1 85 GO:0005886
GO:0015740
GO:0022857
AF-A0A1W9LHI8-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.8008 27 170 GO:0005886
GO:0015740
GO:0022857
AF-A0A3C0HI20-F1-model_v4 TRAP transporter small permease protein 0.7912 27 164 GO:0005886
GO:0015740
GO:0022857
AF-A0A359B8B9-F1-model_v4 TRAP transporter small permease 0.7903 30 170 GO:0005886
AF-A0A5N0T9W7-F1-model_v4 TRAP transporter small permease protein 0.7845 22 167 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
74.61 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map