F482104

General Info

Members Datasets Scaffolds Average Seq Length
817 427 1634 140

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0009001|Ga0495618_0009001_4748_5251
Length 167
Sequence LRRTTEWYALGLASLSVQPLTPDTFAMTRLRITSCGHEFIAETHPDAPHTVAAFLKLLPYRQKIIHVRWSGEGCWVPLGDFKLENDGAAVGFENHTSHPSVGDILFYPGGYSETEIILAYGSCCFASKLGQLAGNHFLTVVEGRDKLRELGTKVLWEGAQEVLFEKI

Samples

Sample ID Description Type Environment
1 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
154 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
162 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
163 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
201 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
207 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
208 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
212 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
355 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
356 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
357 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
358 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
363 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
364 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
365 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
371 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
374 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
375 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
378 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
379 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
382 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
385 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
386 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
387 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
388 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
389 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
390 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
391 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
392 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
393 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
394 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
395 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
396 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
397 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
398 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
399 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
400 2818991450 Burkholderia sp. 604 Isolate Unclassified
401 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
402 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
403 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
404 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
405 2842733646 Variovorax sp. R-72446 Isolate Unclassified
406 2842747753 Variovorax sp. R-72060 Isolate Unclassified
407 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
408 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
409 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
410 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
411 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
412 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
413 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
414 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
415 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
416 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
417 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
418 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
419 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
420 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
421 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
422 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
423 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
424 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
425 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
426 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
427 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.25
Metatranscriptomes 0.37
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.83
Nodule 2.2
Rhizoplane 5.39
Rhizosphere 68.67
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495618_0009001 3300046514 Bacteria 6025
2 SwRhRL2b_contig_723786 2162886007 Bacteria 3476
3 MRS1b_contig_3039797 2162886011 Bacteria 2285
4 JGI24740J21852_10015992 3300001979 Bacteria 2723
5 JGI24739J22299_10026643 3300001989 Bacteria 2026
6 JGI24739J22299_10030987 3300001989 Bacteria 1851
7 JGI24735J21928_10020829 3300002067 Bacteria 2006
8 JGI24738J21930_10004613 3300002075 Bacteria 3361
9 JGI25156J39149_1000745 3300002705 Bacteria 17106
10 JGI25156J39149_1002132 3300002705 Bacteria 7465
11 JGI25156J39149_1002348 3300002705 Bacteria 6885
12 JGI25151J46595_10001565 3300003187 Bacteria 15277
13 JGI25151J46595_10002188 3300003187 Bacteria 12099
14 JGI25151J46595_10005632 3300003187 Bacteria 6440
15 JGI25165J46597_1000617 3300003214 Bacteria 30066
16 rootL2_10043431 3300003322 Bacteria 4723
17 rootH1_10061248 3300003323 Bacteria 3109
18 Ga0055533_1000256 3300003756 Bacteria 31945
19 Ga0055532_1000007 3300003758 Bacteria 429810
20 Ga0055527_1000007 3300003760 Bacteria 429810
21 Ga0055535_1000005 3300003761 Bacteria 429810
22 Ga0055542_1000008 3300003762 Bacteria 429810
23 Ga0055529_1000005 3300003763 Bacteria 429810
24 Ga0055526_1001856 3300003771 Bacteria 14634
25 Ga0055526_1021726 3300003771 Bacteria 2217
26 Ga0055524_1000168 3300003775 Bacteria 74672
27 Ga0055524_1006684 3300003775 Bacteria 4983
28 Ga0055536_1000034 3300003781 Bacteria 148178
29 Ga0055530_10000534 3300003791 Bacteria 32971
30 Ga0065704_10073347 3300005289 Bacteria 7270
31 Ga0065712_10067891 3300005290 Bacteria 22597
32 Ga0065707_10095279 3300005295 Bacteria 3397
33 Ga0065707_10527801 3300005295 Bacteria 737
34 Ga0070683_101182514 3300005329 Bacteria 735
35 Ga0070670_100000014 3300005331 Bacteria 234648
36 Ga0070670_100040346 3300005331 Bacteria 4014
37 Ga0070682_101298586 3300005337 Bacteria 618
38 Ga0070660_100115816 3300005339 Bacteria 2137
39 Ga0070660_100595868 3300005339 Bacteria 924
40 Ga0070689_100024768 3300005340 Bacteria 4504
41 Ga0070661_101341672 3300005344 Bacteria 601
42 Ga0070669_100021049 3300005353 Bacteria 4660
43 Ga0070669_100621296 3300005353 Bacteria 907
44 Ga0070669_101291542 3300005353 Bacteria 632
45 Ga0070671_100191823 3300005355 Bacteria 1732
46 Ga0070671_101046869 3300005355 Bacteria 716
47 Ga0070674_100535352 3300005356 Bacteria 980
48 Ga0070673_100028695 3300005364 Bacteria 4141
49 Ga0070673_100510640 3300005364 Bacteria 1088
50 Ga0070688_100040773 3300005365 Bacteria 2847
51 Ga0070667_100000370 3300005367 Bacteria 49010
52 Ga0070667_100012862 3300005367 Bacteria 6915
53 Ga0070714_101279647 3300005435 Bacteria 716
54 Ga0070713_100696694 3300005436 Bacteria 969
55 Ga0070710_10976448 3300005437 Bacteria 616
56 Ga0070711_100958035 3300005439 Bacteria 733
57 Ga0070678_100105826 3300005456 Bacteria 2191
58 Ga0070678_101055151 3300005456 Bacteria 749
59 Ga0070662_100074405 3300005457 Bacteria 2513
60 Ga0070662_100846508 3300005457 Bacteria 779
61 Ga0070681_10219222 3300005458 Bacteria 1818
62 Ga0068867_101206351 3300005459 Bacteria 695
63 Ga0070706_100637950 3300005467 Bacteria 989
64 Ga0068853_100694827 3300005539 Bacteria 970
65 Ga0070672_100222629 3300005543 Bacteria 1583
66 Ga0070665_100536408 3300005548 Bacteria 1182
67 Ga0070665_100608766 3300005548 Bacteria 1105
68 Ga0068855_100738617 3300005563 Bacteria 1050
69 Ga0070664_100426704 3300005564 Bacteria 1215
70 Ga0068856_101469050 3300005614 Bacteria 696
71 Ga0068852_100437171 3300005616 Bacteria 1293
72 Ga0068864_100000021 3300005618 Bacteria 262378
73 Ga0068866_10232138 3300005718 Bacteria 1119
74 Ga0068861_101359165 3300005719 Bacteria 692
75 Ga0068863_100000009 3300005841 Bacteria 250538
76 Ga0068858_100222328 3300005842 Bacteria 1789
77 Ga0068858_100928747 3300005842 Bacteria 851
78 Ga0068862_100000017 3300005844 Bacteria 247616
79 Ga0068862_101779994 3300005844 Bacteria 625
80 Ga0070717_10430379 3300006028 Bacteria 1187
81 Ga0075363_100300465 3300006048 Bacteria 931
82 Ga0075363_100390025 3300006048 Bacteria 817
83 Ga0075364_10000807 3300006051 Bacteria 16518
84 Ga0075364_10003334 3300006051 Bacteria 9112
85 Ga0075362_10110203 3300006177 Bacteria 1295
86 Ga0075362_10207504 3300006177 Bacteria 955
87 Ga0075367_10119500 3300006178 Bacteria 1623
88 Ga0075369_10003090 3300006186 Bacteria 6029
89 Ga0097621_100548637 3300006237 Bacteria 1052
90 Ga0075370_10090068 3300006353 Bacteria 1769
91 Ga0075370_10414993 3300006353 Bacteria 808
92 Ga0068871_101280319 3300006358 Bacteria 689
93 Ga0079104_1000012 3300006946 Bacteria 355143
94 Ga0079104_1070129 3300006946 Bacteria 738
95 Ga0099826_10000004 3300006948 Bacteria 802669
96 Ga0105251_10002594 3300009011 Bacteria 14005
97 Ga0105251_10132699 3300009011 Bacteria 1128
98 Ga0105244_10000519 3300009036 Bacteria 34428
99 Ga0105244_10028791 3300009036 Bacteria 2976
100 Ga0105240_10060061 3300009093 Bacteria 4741
101 Ga0105240_10811019 3300009093 Bacteria 1013
102 Ga0105240_11086689 3300009093 Bacteria 852
103 Ga0105247_10009801 3300009101 Bacteria 5806
104 Ga0105247_10224905 3300009101 Bacteria 1272
105 Ga0105243_10133074 3300009148 Bacteria 2112
106 Ga0105243_10269270 3300009148 Bacteria 1529
107 Ga0105241_10823560 3300009174 Bacteria 857
108 Ga0105241_11291878 3300009174 Bacteria 695
109 Ga0105248_10000030 3300009177 Bacteria 206609
110 Ga0105237_11324187 3300009545 Bacteria 727
111 Ga0105238_10537619 3300009551 Bacteria 1172
112 Ga0105238_11077645 3300009551 Bacteria 826
113 Ga0105249_10000164 3300009553 Bacteria 79042
114 Ga0105239_11309727 3300010375 Bacteria 836
115 Ga0105246_10138849 3300011119 Bacteria 1825
116 Ga0157369_10045565 3300013105 Bacteria 4769
117 Ga0157369_10281069 3300013105 Bacteria 1733
118 Ga0157378_11142800 3300013297 Bacteria 817
119 Ga0163162_10036388 3300013306 Bacteria 4906
120 Ga0163162_10043008 3300013306 Bacteria 4522
121 Ga0163162_10458609 3300013306 Bacteria 1406
122 Ga0157375_10457591 3300013308 Bacteria 1442
123 Ga0163163_10122471 3300014325 Bacteria 2635
124 Ga0163163_10702995 3300014325 Bacteria 1074
125 Ga0163163_11092159 3300014325 Bacteria 861
126 Ga0182008_10028054 3300014497 Bacteria 2848
127 Ga0182008_10048948 3300014497 Bacteria 2099
128 Ga0157377_10468753 3300014745 Bacteria 873
129 Ga0157379_10048150 3300014968 Bacteria 3805
130 Ga0157376_10437471 3300014969 Bacteria 1273
131 Ga0182007_10000258 3300015262 Bacteria 35539
132 Ga0163161_10028414 3300017792 Bacteria 3972
133 Ga0213875_10234508 3300021388 Bacteria 864
134 Ga0213871_10152771 3300021441 Bacteria 703
135 Ga0224712_10224554 3300022467 Bacteria 861
136 Ga0209674_100020 3300025226 Bacteria 672397
137 Ga0209672_100013 3300025228 Bacteria 740693
138 Ga0209147_100013 3300025229 Bacteria 660057
139 Ga0209563_100244 3300025230 Bacteria 26055
140 Ga0207427_100702 3300025231 Bacteria 15704
141 Ga0209258_100016 3300025242 Bacteria 668622
142 Ga0207425_1074709 3300025245 Bacteria 575
143 Ga0209148_1000020 3300025254 Bacteria 740693
144 Ga0209759_1000010 3300025256 Bacteria 430463
145 Ga0209759_1000086 3300025256 Bacteria 167075
146 Ga0209759_1000203 3300025256 Bacteria 94040
147 Ga0209759_1025664 3300025256 Bacteria 1249
148 Ga0209129_1040790 3300025258 Bacteria 736
149 Ga0209233_1000055 3300025261 Bacteria 439422
150 Ga0209233_1045482 3300025261 Bacteria 923
151 Ga0209565_1000066 3300025263 Bacteria 173062
152 Ga0209455_1000017 3300025272 Bacteria 740693
153 Ga0209673_1019818 3300025273 Bacteria 2403
154 Ga0209675_1034186 3300025291 Bacteria 1171
155 Ga0209676_1000014 3300025292 Bacteria 793514
156 Ga0209025_1000323 3300025294 Bacteria 106442
157 Ga0209025_1000409 3300025294 Bacteria 86577
158 Ga0209025_1001111 3300025294 Bacteria 38546
159 Ga0209025_1038721 3300025294 Bacteria 2091
160 Ga0209564_1000182 3300025295 Bacteria 150744
161 Ga0209564_1000679 3300025295 Bacteria 50214
162 Ga0209758_1011370 3300025297 Bacteria 5166
163 Ga0209050_1006532 3300025298 Bacteria 6869
164 Ga0209256_1013023 3300025299 Bacteria 3119
165 Ga0207713_1000561 3300025735 Bacteria 36948
166 Ga0207713_1003828 3300025735 Bacteria 10068
167 Ga0207642_10103590 3300025899 Bacteria 1434
168 Ga0207710_10004885 3300025900 Bacteria 5812
169 Ga0207710_10444121 3300025900 Bacteria 669
170 Ga0207680_10037559 3300025903 Bacteria 2797
171 Ga0207647_10001546 3300025904 Bacteria 17710
172 Ga0207647_10032193 3300025904 Bacteria 3371
173 Ga0207647_10035783 3300025904 Bacteria 3161
174 Ga0207645_10039810 3300025907 Bacteria 3011
175 Ga0207663_10292317 3300025916 Bacteria 1214
176 Ga0207657_10167937 3300025919 Bacteria 1779
177 Ga0207694_10655159 3300025924 Bacteria 885
178 Ga0207650_10000189 3300025925 Bacteria 71611
179 Ga0207650_10019169 3300025925 Bacteria 4806
180 Ga0207659_10174305 3300025926 Bacteria 1699
181 Ga0207700_10656258 3300025928 Bacteria 935
182 Ga0207664_10286642 3300025929 Bacteria 1446
183 Ga0207644_10019704 3300025931 Bacteria 4581
184 Ga0207644_10053819 3300025931 Bacteria 2897
185 Ga0207706_10078679 3300025933 Bacteria 2900
186 Ga0207706_10127865 3300025933 Bacteria 2234
187 Ga0207709_10079116 3300025935 Bacteria 2113
188 Ga0207709_10266210 3300025935 Bacteria 1259
189 Ga0207670_10005817 3300025936 Bacteria 6808
190 Ga0207704_10536575 3300025938 Bacteria 949
191 Ga0207691_10423151 3300025940 Bacteria 1135
192 Ga0207711_10000029 3300025941 Bacteria 206826
193 Ga0207689_10245875 3300025942 Bacteria 1479
194 Ga0207679_10173131 3300025945 Bacteria 1779
195 Ga0207667_11747164 3300025949 Bacteria 587
196 Ga0207651_10053237 3300025960 Bacteria 2765
197 Ga0207712_10000342 3300025961 Bacteria 42366
198 Ga0207640_11452700 3300025981 Bacteria 615
199 Ga0207658_10000484 3300025986 Bacteria 36724
200 Ga0207658_10025374 3300025986 Bacteria 4151
201 Ga0207703_10838799 3300026035 Bacteria 879
202 Ga0207639_10224767 3300026041 Bacteria 1624
203 Ga0207639_11612044 3300026041 Bacteria 609
204 Ga0207678_10023796 3300026067 Bacteria 5356
205 Ga0207641_10000017 3300026088 Bacteria 299119
206 Ga0207648_10010276 3300026089 Bacteria 8886
207 Ga0207676_10000088 3300026095 Bacteria 82983
208 Ga0207676_11654515 3300026095 Bacteria 638
209 Ga0207675_100240794 3300026118 Bacteria 1748
210 Ga0207683_10107300 3300026121 Bacteria 2498
211 Ga0207683_10132293 3300026121 Bacteria 2244
212 Ga0209281_1000039 3300027111 Bacteria 355150
213 Ga0209281_1046303 3300027111 Bacteria 710
214 Ga0209371_1021959 3300027312 Bacteria 1536
215 Ga0209282_1000099 3300027666 Bacteria 59643
216 Ga0209813_10221273 3300027866 Bacteria 709
217 Ga0268266_10462629 3300028379 Bacteria 1207
218 Ga0268266_11183236 3300028379 Bacteria 739
219 Ga0268265_10000025 3300028380 Bacteria 250207
220 Ga0307517_10000131 3300028786 Bacteria 113233
221 Ga0307517_10197422 3300028786 Bacteria 1264
222 Ga0307515_10002916 3300028794 Bacteria 36334
223 Ga0307515_10786234 3300028794 Bacteria 573
224 Ga0268256_1003434 3300030500 Bacteria 7131
225 Ga0307512_10012765 3300030522 Bacteria 7908
226 Ga0307512_10108358 3300030522 Bacteria 1844
227 Ga0265762_1017580 3300030760 Bacteria 1302
228 Ga0265760_10127573 3300031090 Bacteria 821
229 Ga0265320_10061746 3300031240 Bacteria 1786
230 Ga0265340_10073370 3300031247 Bacteria 1619
231 Ga0307513_10034705 3300031456 Bacteria 5656
232 Ga0307513_10042207 3300031456 Bacteria 5025
233 Ga0307513_10493639 3300031456 Bacteria 942
234 Ga0307509_10007605 3300031507 Bacteria 14100
235 Ga0307408_100006014 3300031548 Bacteria 8076
236 Ga0307508_10138304 3300031616 Bacteria 2039
237 Ga0307508_10276744 3300031616 Bacteria 1272
238 Ga0307514_10001966 3300031649 Bacteria 22426
239 Ga0307514_10007054 3300031649 Bacteria 9703
240 Ga0265314_10266353 3300031711 Bacteria 976
241 Ga0307516_10163698 3300031730 Bacteria 1972
242 Ga0307516_10179039 3300031730 Bacteria 1855
243 Ga0307405_10086114 3300031731 Bacteria 2068
244 Ga0307405_10113229 3300031731 Bacteria 1842
245 Ga0307405_10327483 3300031731 Bacteria 1173
246 Ga0307518_10303312 3300031838 Bacteria 969
247 Ga0307410_10016050 3300031852 Bacteria 4455
248 Ga0307406_10759715 3300031901 Bacteria 815
249 Ga0307412_10000002 3300031911 Bacteria 743446
250 Ga0307412_10135416 3300031911 Bacteria 1796
251 Ga0307416_101256584 3300032002 Bacteria 846
252 Ga0307414_10367418 3300032004 Bacteria 1240
253 Ga0307411_10481199 3300032005 Bacteria 1045
254 Ga0307415_100217922 3300032126 Bacteria 1528
255 Ga0307507_10174167 3300033179 Bacteria 1555
256 Ga0307510_10287439 3300033180 Bacteria 1112
257 Ga0373945_0287914 3300035116 Bacteria 701
258 Ga0373957_0010069 3300035120 Bacteria 3113
259 Ga0373943_0358088 3300035170 Bacteria 837
260 Ga0373935_0464140 3300035692 Bacteria 916
261 Ga0373927_0086209 3300035695 Bacteria 2038
262 Ga0373933_0157908 3300035724 Bacteria 1439
263 Ga0373937_0402056 3300036401 Bacteria 1300
264 Ga0395899_0012316 3300037312 Bacteria 6552
265 Ga0395900_0095682 3300037418 Bacteria 3051
266 Ga0395898_0265933 3300037466 Bacteria 1635
267 Ga0436364_0740204 3300037853 Bacteria 2553
268 Ga0395901_0002262 3300038443 Bacteria 19647
269 Ga0436360_0353742 3300039438 Bacteria 544
270 Ga0436360_0653308 3300039438 Bacteria 1023
271 Ga0436360_0867937 3300039438 Bacteria 563
272 Ga0436361_0163419 3300039447 Bacteria 1697
273 Ga0436361_1210709 3300039447 Bacteria 1166
274 Ga0436363_1232577 3300039450 Bacteria 815
275 Ga0439436_0002141 3300041404 Bacteria 5903
276 Ga0439439_0000724 3300041406 Bacteria 5910
277 Ga0439466_0004795 3300041411 Bacteria 5198
278 Ga0439465_0000306 3300041413 Bacteria 13858
279 Ga0451795_0163026 3300041456 Bacteria 597
280 Ga0439431_0000537 3300041997 Bacteria 8043
281 Ga0439433_0001012 3300041999 Bacteria 5683
282 Ga0439442_018106 3300042002 Bacteria 1455
283 Ga0439445_0000841 3300042004 Bacteria 6488
284 Ga0439432_000424 3300042006 Bacteria 15760
285 Ga0439449_0000280 3300042007 Bacteria 18428
286 Ga0439452_000869 3300042010 Bacteria 13980
287 Ga0450909_003580 3300042185 Bacteria 2212
288 Ga0451577_0424792 3300042876 Bacteria 1207
289 Ga0466966_0087676 3300044684 Bacteria 1934
290 Ga0453684_1285557 3300044712 Unclassified 764
291 Ga0466957_0026441 3300044842 Bacteria 3443
292 Ga0466960_0162152 3300044901 Bacteria 1201
293 Ga0451576_0884034 3300045051 Unclassified 938
294 Ga0466967_0396005 3300045976 Bacteria 1343
295 Ga0495592_0018260 3300046454 Bacteria 5331
296 Ga0495592_0034263 3300046454 Bacteria 3828
297 Ga0495592_0099706 3300046454 Bacteria 2071
298 Ga0495592_0198480 3300046454 Bacteria 1355
299 Ga0495592_0199826 3300046454 Bacteria 1350
300 Ga0495603_0000683 3300046455 Bacteria 19244
301 Ga0495603_0003765 3300046455 Bacteria 9021
302 Ga0495603_0051296 3300046455 Bacteria 2452
303 Ga0495603_0093001 3300046455 Bacteria 1762
304 Ga0495590_0009087 3300046457 Bacteria 3774
305 Ga0495590_0034047 3300046457 Bacteria 1780
306 Ga0495591_009205 3300046458 Bacteria 3946
307 Ga0495591_056058 3300046458 Bacteria 1060
308 Ga0495629_0000100 3300046459 Bacteria 75845
309 Ga0495629_0000408 3300046459 Bacteria 35983
310 Ga0495629_0020048 3300046459 Bacteria 4774
311 Ga0495629_0028861 3300046459 Bacteria 3938
312 Ga0495629_0034520 3300046459 Bacteria 3576
313 Ga0495629_0062282 3300046459 Bacteria 2606
314 Ga0495629_0202157 3300046459 Bacteria 1373
315 Ga0495638_0012863 3300046460 Bacteria 5718
316 Ga0495638_0018898 3300046460 Bacteria 4568
317 Ga0495641_0039958 3300046461 Bacteria 2184
318 Ga0495641_0043901 3300046461 Bacteria 2065
319 Ga0495651_0017175 3300046462 Bacteria 5606
320 Ga0495651_0029980 3300046462 Bacteria 4242
321 Ga0495651_0039394 3300046462 Bacteria 3679
322 Ga0495651_0185830 3300046462 Bacteria 1467
323 Ga0495653_0000169 3300046463 Bacteria 54020
324 Ga0495653_0001524 3300046463 Bacteria 18111
325 Ga0495653_0006960 3300046463 Bacteria 9286
326 Ga0495653_0035749 3300046463 Bacteria 3918
327 Ga0495653_0057069 3300046463 Bacteria 2975
328 Ga0495653_0068576 3300046463 Bacteria 2660
329 Ga0495650_0000668 3300046471 Bacteria 44633
330 Ga0495650_0003498 3300046471 Bacteria 11397
331 Ga0495650_0008948 3300046471 Bacteria 5761
332 Ga0495650_0023319 3300046471 Bacteria 2948
333 Ga0495580_0000791 3300046472 Bacteria 27347
334 Ga0495580_0000905 3300046472 Bacteria 25846
335 Ga0495580_0001796 3300046472 Bacteria 18849
336 Ga0495580_0001965 3300046472 Bacteria 18056
337 Ga0495580_0007370 3300046472 Bacteria 8847
338 Ga0495580_0009937 3300046472 Bacteria 7448
339 Ga0495580_0023508 3300046472 Bacteria 4524
340 Ga0495580_0027817 3300046472 Bacteria 4112
341 Ga0495582_0010937 3300046473 Bacteria 4993
342 Ga0495582_0040306 3300046473 Bacteria 2572
343 Ga0495582_0047027 3300046473 Bacteria 2376
344 Ga0495582_0063145 3300046473 Bacteria 2046
345 Ga0495582_0186043 3300046473 Bacteria 1184
346 Ga0495605_0001926 3300046474 Bacteria 13203
347 Ga0495605_0002725 3300046474 Bacteria 10780
348 Ga0495605_0005584 3300046474 Bacteria 7314
349 Ga0495662_0012152 3300046476 Bacteria 4206
350 Ga0495662_0023751 3300046476 Bacteria 2961
351 Ga0495662_0132886 3300046476 Bacteria 1224
352 Ga0495662_0148750 3300046476 Bacteria 1153
353 Ga0495664_0012888 3300046477 Bacteria 4738
354 Ga0495664_0015445 3300046477 Bacteria 4340
355 Ga0495664_0076139 3300046477 Bacteria 2008
356 Ga0495664_0079223 3300046477 Bacteria 1969
357 Ga0495664_0632759 3300046477 Bacteria 635
358 Ga0495584_0367890 3300046491 Bacteria 730
359 Ga0495585_0559636 3300046492 Bacteria 540
360 Ga0495594_0043464 3300046499 Bacteria 2463
361 Ga0495594_0243725 3300046499 Bacteria 1024
362 Ga0495596_0002164 3300046500 Bacteria 10715
363 Ga0495596_0002614 3300046500 Bacteria 9555
364 Ga0495596_0023418 3300046500 Bacteria 2506
365 Ga0495607_0017647 3300046501 Bacteria 4574
366 Ga0495583_0025973 3300046506 Bacteria 2914
367 Ga0495583_0358655 3300046506 Bacteria 575
368 Ga0495606_0109964 3300046507 Bacteria 1664
369 Ga0495606_0114535 3300046507 Bacteria 1622
370 Ga0495606_0122444 3300046507 Bacteria 1555
371 Ga0495606_0131195 3300046507 Bacteria 1489
372 Ga0495608_0034219 3300046511 Bacteria 3431
373 Ga0495608_0120297 3300046511 Bacteria 1684
374 Ga0495608_0231294 3300046511 Bacteria 1157
375 Ga0495608_0263484 3300046511 Bacteria 1073
376 Ga0495608_0368728 3300046511 Bacteria 882
377 Ga0495610_0002352 3300046512 Bacteria 15976
378 Ga0495610_0201490 3300046512 Bacteria 815
379 Ga0495616_0042141 3300046513 Bacteria 2325
380 Ga0495618_0037267 3300046514 Bacteria 3053
381 Ga0495618_0123686 3300046514 Bacteria 1656
382 Ga0495618_0589515 3300046514 Bacteria 662
383 Ga0495620_0028858 3300046515 Bacteria 2574
384 Ga0495628_0001923 3300046516 Bacteria 18849
385 Ga0495628_0029993 3300046516 Bacteria 4405
386 Ga0495628_0076396 3300046516 Bacteria 2606
387 Ga0495628_0345511 3300046516 Bacteria 1094
388 Ga0495628_0926845 3300046516 Bacteria 603
389 Ga0495628_0994056 3300046516 Bacteria 577
390 Ga0495630_0006257 3300046517 Bacteria 8450
391 Ga0495630_0007202 3300046517 Bacteria 7928
392 Ga0495630_0010991 3300046517 Bacteria 6544
393 Ga0495630_0027298 3300046517 Bacteria 4233
394 Ga0495630_0070621 3300046517 Bacteria 2627
395 Ga0495630_0097336 3300046517 Bacteria 2225
396 Ga0495631_0203254 3300046518 Bacteria 847
397 Ga0495632_0383623 3300046519 Bacteria 615
398 Ga0495637_0097748 3300046520 Bacteria 1151
399 Ga0495643_0037702 3300046522 Bacteria 2649
400 Ga0495643_0257015 3300046522 Bacteria 813
401 Ga0495648_0000623 3300046524 Bacteria 37962
402 Ga0495648_0002083 3300046524 Bacteria 18920
403 Ga0495648_0023865 3300046524 Bacteria 4178
404 Ga0495648_0029125 3300046524 Bacteria 3668
405 Ga0495648_0053803 3300046524 Bacteria 2436
406 Ga0495648_0063962 3300046524 Bacteria 2169
407 Ga0495648_0183021 3300046524 Bacteria 1063
408 Ga0495666_0000410 3300046526 Bacteria 18945
409 Ga0495666_0001323 3300046526 Bacteria 11996
410 Ga0495666_0001765 3300046526 Bacteria 10667
411 Ga0495666_0005178 3300046526 Bacteria 6584
412 Ga0495666_0012763 3300046526 Bacteria 4188
413 Ga0495642_0002523 3300046528 Bacteria 7411
414 Ga0495642_0091913 3300046528 Bacteria 1285
415 Ga0495642_0215719 3300046528 Bacteria 837
416 Ga0495652_0002341 3300046529 Bacteria 19655
417 Ga0495652_0032805 3300046529 Bacteria 4538
418 Ga0495652_0253606 3300046529 Bacteria 1302
419 Ga0495652_0311018 3300046529 Bacteria 1141
420 Ga0495652_0554837 3300046529 Bacteria 789
421 Ga0495652_0724262 3300046529 Bacteria 667
422 Ga0495654_0003171 3300046530 Bacteria 10202
423 Ga0495654_0019899 3300046530 Bacteria 3504
424 Ga0495665_0000564 3300046531 Bacteria 18834
425 Ga0495665_0084778 3300046531 Bacteria 1665
426 Ga0495665_0089084 3300046531 Bacteria 1621
427 Ga0495640_0019998 3300046533 Bacteria 4935
428 Ga0495640_0098614 3300046533 Bacteria 1920
429 Ga0495640_0160228 3300046533 Bacteria 1442
430 Ga0495640_0168120 3300046533 Bacteria 1402
431 Ga0495586_0000751 3300046535 Bacteria 18664
432 Ga0495586_0018540 3300046535 Bacteria 3705
433 Ga0495586_0161736 3300046535 Bacteria 1263
434 Ga0495587_0001812 3300046536 Bacteria 14252
435 Ga0495587_0002913 3300046536 Bacteria 11448
436 Ga0495609_0008282 3300046538 Bacteria 5098
437 Ga0495597_0005066 3300046542 Bacteria 7040
438 Ga0495597_0022809 3300046542 Bacteria 2900
439 Ga0495597_0037022 3300046542 Bacteria 2193
440 Ga0495645_0000457 3300046543 Bacteria 28126
441 Ga0495645_0161416 3300046543 Bacteria 1549
442 Ga0495645_0175983 3300046543 Bacteria 1469
443 Ga0495645_0373013 3300046543 Bacteria 914
444 Ga0495633_0118746 3300046558 Unclassified 1225
445 Ga0495667_0055562 3300046559 Bacteria 2604
446 Ga0495667_0056939 3300046559 Bacteria 2570
447 Ga0495667_0065514 3300046559 Bacteria 2376
448 Ga0495667_0153183 3300046559 Bacteria 1484
449 Ga0495667_0277743 3300046559 Bacteria 1063
450 Ga0495667_0441927 3300046559 Bacteria 818
451 Ga0495656_0151949 3300046615 Bacteria 1119
452 Ga0495668_0073363 3300046616 Bacteria 1880
453 Ga0495668_0142236 3300046616 Bacteria 1313
454 Ga0495668_0158002 3300046616 Bacteria 1242
455 Ga0495668_0278321 3300046616 Bacteria 917
456 Ga0495634_0004396 3300046642 Bacteria 11087
457 Ga0495634_0011235 3300046642 Bacteria 6528
458 Ga0495634_0037266 3300046642 Bacteria 3323
459 Ga0495634_0133122 3300046642 Bacteria 1583
460 Ga0495611_0013221 3300046648 Bacteria 3512
461 Ga0495611_0446204 3300046648 Bacteria 590
462 Ga0495625_0029271 3300046660 Bacteria 4122
463 Ga0495625_0068668 3300046660 Bacteria 2491
464 Ga0495625_0130324 3300046660 Bacteria 1704
465 Ga0495625_0342847 3300046660 Bacteria 946
466 Ga0495635_0001145 3300046663 Bacteria 17682
467 Ga0495635_0019494 3300046663 Bacteria 4727
468 Ga0495635_0088145 3300046663 Bacteria 2123
469 Ga0495635_0297523 3300046663 Bacteria 1082
470 Ga0495635_0603801 3300046663 Bacteria 716
471 Ga0495661_0004538 3300046665 Bacteria 9999
472 Ga0495661_0019524 3300046665 Bacteria 4440
473 Ga0495661_0026221 3300046665 Bacteria 3755
474 Ga0495661_0029388 3300046665 Bacteria 3509
475 Ga0495661_0081872 3300046665 Bacteria 1859
476 Ga0495588_0005612 3300046674 Bacteria 5592
477 Ga0495588_0069897 3300046674 Bacteria 1825
478 Ga0495588_0286551 3300046674 Bacteria 868
479 Ga0495657_0387358 3300046675 Bacteria 824
480 Ga0495599_0007994 3300046678 Bacteria 6417
481 Ga0495599_0015972 3300046678 Bacteria 4659
482 Ga0495599_0120911 3300046678 Bacteria 1628
483 Ga0495599_0122504 3300046678 Bacteria 1616
484 Ga0495623_0006202 3300046679 Bacteria 7772
485 Ga0495623_0059911 3300046679 Bacteria 2390
486 Ga0495623_0076578 3300046679 Bacteria 2076
487 Ga0495623_0085793 3300046679 Bacteria 1941
488 Ga0495623_0094575 3300046679 Bacteria 1827
489 Ga0495623_0290055 3300046679 Bacteria 907
490 Ga0495646_0000933 3300046680 Bacteria 16614
491 Ga0495646_0008494 3300046680 Bacteria 6523
492 Ga0495646_0011843 3300046680 Bacteria 5546
493 Ga0495646_0026772 3300046680 Bacteria 3619
494 Ga0495646_0123029 3300046680 Bacteria 1466
495 Ga0495646_0123396 3300046680 Bacteria 1464
496 Ga0495646_0143135 3300046680 Bacteria 1335
497 Ga0495646_0239967 3300046680 Bacteria 974
498 Ga0495647_0046001 3300046681 Bacteria 1679
499 Ga0495647_0130432 3300046681 Bacteria 1065
500 Ga0495669_0021541 3300046684 Bacteria 2798
501 Ga0495669_0330961 3300046684 Bacteria 735
502 Ga0495669_0518181 3300046684 Bacteria 580
503 Ga0495613_0001968 3300046689 Bacteria 15595
504 Ga0495613_0006003 3300046689 Bacteria 9089
505 Ga0495613_0011571 3300046689 Bacteria 6559
506 Ga0495613_0012272 3300046689 Bacteria 6366
507 Ga0495613_0020500 3300046689 Bacteria 4928
508 Ga0495624_0000692 3300046690 Bacteria 26443
509 Ga0495624_0001696 3300046690 Bacteria 16880
510 Ga0495624_0004058 3300046690 Bacteria 10773
511 Ga0495624_0018963 3300046690 Bacteria 4596
512 Ga0495624_0045986 3300046690 Bacteria 2776
513 Ga0495624_0160519 3300046690 Bacteria 1373
514 Ga0495624_0454194 3300046690 Bacteria 767
515 Ga0495670_0207740 3300046691 Bacteria 1038
516 Ga0495671_0025935 3300046692 Bacteria 3042
517 Ga0495671_0028260 3300046692 Bacteria 2891
518 Ga0495671_0159555 3300046692 Unclassified 1097
519 Ga0495671_0268871 3300046692 Bacteria 822
520 Ga0495671_0346739 3300046692 Bacteria 712
521 Ga0495671_0527615 3300046692 Bacteria 563
522 Ga0495649_0017414 3300046694 Bacteria 4053
523 Ga0495649_0062328 3300046694 Bacteria 2004
524 Ga0495649_0068371 3300046694 Bacteria 1906
525 Ga0495649_0086806 3300046694 Bacteria 1669
526 Ga0495649_0176689 3300046694 Bacteria 1115
527 Ga0495649_0583950 3300046694 Bacteria 552
528 Ga0495589_0004858 3300046794 Bacteria 7130
529 Ga0495589_0028251 3300046794 Bacteria 2831
530 Ga0495589_0066847 3300046794 Bacteria 1760
531 Ga0495589_0425112 3300046794 Bacteria 609
532 Ga0495600_0025286 3300046809 Bacteria 3826
533 Ga0495600_0113897 3300046809 Bacteria 1761
534 Ga0495600_0233907 3300046809 Bacteria 1172
535 Ga0495660_0337513 3300046810 Bacteria 673
536 Ga0495660_0482265 3300046810 Bacteria 532
537 Ga0495581_0004631 3300047315 Bacteria 7940
538 Ga0495581_0007803 3300047315 Bacteria 6198
539 Ga0495581_0087781 3300047315 Bacteria 1803
540 Ga0495604_0000459 3300047317 Bacteria 36163
541 Ga0495604_0000659 3300047317 Bacteria 29341
542 Ga0495604_0024650 3300047317 Bacteria 4799
543 Ga0495604_0026692 3300047317 Bacteria 4596
544 Ga0495604_0129253 3300047317 Bacteria 1817
545 Ga0495604_0301954 3300047317 Bacteria 1075
546 Ga0495674_0002277 3300047319 Bacteria 18849
547 Ga0495674_0010545 3300047319 Bacteria 8746
548 Ga0495674_0019964 3300047319 Bacteria 6210
549 Ga0495674_0028583 3300047319 Bacteria 5081
550 Ga0495674_0051288 3300047319 Bacteria 3637
551 Ga0495674_0055658 3300047319 Bacteria 3467
552 Ga0495674_0211946 3300047319 Bacteria 1604
553 Ga0495674_0259971 3300047319 Bacteria 1426
554 Ga0495674_0608986 3300047319 Bacteria 865
555 Ga0495672_0016076 3300047320 Bacteria 5059
556 Ga0495672_0061025 3300047320 Bacteria 2175
557 Ga0495672_0132696 3300047320 Bacteria 1308
558 Ga0495676_0018412 3300047321 Bacteria 6156
559 Ga0495676_0064608 3300047321 Bacteria 2844
560 Ga0495676_0151542 3300047321 Bacteria 1649
561 Ga0495676_0154479 3300047321 Bacteria 1629
562 Ga0495676_0769032 3300047321 Bacteria 621
563 Ga0495680_0002493 3300047322 Bacteria 18821
564 Ga0495680_0010379 3300047322 Bacteria 8312
565 Ga0495680_0022672 3300047322 Bacteria 5231
566 Ga0495680_0085118 3300047322 Bacteria 2381
567 Ga0495680_0166950 3300047322 Bacteria 1595
568 Ga0495680_0208770 3300047322 Bacteria 1398
569 Ga0495680_0293328 3300047322 Bacteria 1143
570 Ga0495683_0001684 3300047323 Bacteria 14069
571 Ga0495683_0004869 3300047323 Bacteria 7521
572 Ga0495683_0007851 3300047323 Bacteria 5724
573 Ga0495683_0013159 3300047323 Bacteria 4331
574 Ga0495683_0053106 3300047323 Bacteria 2021
575 Ga0495683_0166912 3300047323 Bacteria 1014
576 Ga0495687_000451 3300047443 Bacteria 50656
577 Ga0495687_007271 3300047443 Bacteria 6568
578 Ga0495687_024020 3300047443 Bacteria 2904
579 Ga0495675_0012590 3300047444 Bacteria 5323
580 Ga0495675_0013276 3300047444 Bacteria 5198
581 Ga0495675_0013977 3300047444 Bacteria 5077
582 Ga0495675_0036809 3300047444 Bacteria 3119
583 Ga0495675_0095557 3300047444 Bacteria 1863
584 Ga0495677_0246711 3300047445 Bacteria 698
585 Ga0495679_000006 3300047446 Bacteria 449956
586 Ga0495679_000338 3300047446 Bacteria 37011
587 Ga0495679_000838 3300047446 Bacteria 19563
588 Ga0495679_001667 3300047446 Bacteria 12355
589 Ga0495679_031441 3300047446 Bacteria 1712
590 Ga0495685_043422 3300047447 Bacteria 1534
591 Ga0495673_0043136 3300047469 Bacteria 2020
592 Ga0495681_0044146 3300047470 Bacteria 2145
593 Ga0495681_0205488 3300047470 Bacteria 797
594 Ga0495684_0015527 3300047471 Bacteria 5862
595 Ga0495684_0069719 3300047471 Bacteria 2673
596 Ga0495684_0439780 3300047471 Bacteria 908
597 Ga0495684_0987764 3300047471 Bacteria 536
598 Ga0495684_1087999 3300047471 Bacteria 502
599 Ga0495686_0073293 3300047472 Bacteria 2104
600 Ga0495593_0004299 3300047673 Bacteria 8471
601 Ga0495593_0005655 3300047673 Bacteria 7380
602 Ga0495593_0008997 3300047673 Bacteria 5796
603 Ga0495593_0018034 3300047673 Bacteria 3970
604 Ga0495593_0046871 3300047673 Bacteria 2302
605 Ga0495593_0093789 3300047673 Bacteria 1544
606 Ga0495593_0206597 3300047673 Bacteria 986
607 Ga0495602_0003266 3300048088 Bacteria 16750
608 Ga0495602_0017336 3300048088 Bacteria 7221
609 Ga0495602_0027508 3300048088 Bacteria 5463
610 Ga0495602_0084546 3300048088 Bacteria 2654
611 Ga0495602_0094811 3300048088 Bacteria 2465
612 Ga0495602_0100078 3300048088 Bacteria 2381
613 Ga0495602_0106576 3300048088 Bacteria 2287
614 Ga0495602_0227729 3300048088 Bacteria 1402
615 Ga0495602_0501861 3300048088 Bacteria 848
616 Ga0495614_0000299 3300048089 Bacteria 19495
617 Ga0495614_0001626 3300048089 Bacteria 9786
618 Ga0495614_0022180 3300048089 Bacteria 2741
619 Ga0495614_0033025 3300048089 Bacteria 2226
620 Ga0495614_0129862 3300048089 Bacteria 1114
621 Ga0495626_0009894 3300048091 Bacteria 5125
622 Ga0495626_0034477 3300048091 Bacteria 2421
623 Ga0495626_0035831 3300048091 Bacteria 2367
624 Ga0495626_0208955 3300048091 Bacteria 797
625 Ga0496100_0003162 3300048903 Bacteria 8538
626 Ga0496100_0011926 3300048903 Bacteria 4965
627 Ga0496100_0378010 3300048903 Bacteria 1075
628 Ga0496101_0003656 3300048904 Bacteria 9596
629 Ga0496101_0356805 3300048904 Bacteria 1149
630 Ga0496101_0562021 3300048904 Bacteria 902
631 Ga0496102_0001964 3300048905 Bacteria 17737
632 Ga0496102_0076172 3300048905 Bacteria 3085
633 Ga0496102_0104471 3300048905 Bacteria 2635
634 Ga0496102_0376237 3300048905 Bacteria 1337
635 Ga0496102_1766851 3300048905 Bacteria 536
636 Ga0496103_0020110 3300048906 Bacteria 4009
637 Ga0496103_0051283 3300048906 Bacteria 2554
638 Ga0496104_0001742 3300048907 Bacteria 18797
639 Ga0496104_0162781 3300048907 Bacteria 2140
640 Ga0496104_0836675 3300048907 Bacteria 826
641 Ga0496104_1587563 3300048907 Bacteria 557
642 Ga0496105_0003945 3300048908 Bacteria 11094
643 Ga0496105_0029894 3300048908 Bacteria 4461
644 Ga0496106_0020878 3300048909 Bacteria 4860
645 Ga0496106_0088814 3300048909 Bacteria 2383
646 Ga0496106_0406866 3300048909 Bacteria 1094
647 Ga0496107_0323662 3300048910 Bacteria 1147
648 Ga0496107_0343679 3300048910 Bacteria 1110
649 Ga0496108_0544949 3300048911 Bacteria 1012
650 Ga0496109_0151837 3300048912 Bacteria 2168
651 Ga0496109_0311929 3300048912 Bacteria 1484
652 Ga0496110_0004542 3300048913 Bacteria 10773
653 Ga0496110_0090303 3300048913 Bacteria 2739
654 Ga0496111_0014397 3300048914 Bacteria 5402
655 Ga0496112_0070885 3300048915 Bacteria 3444
656 Ga0496112_0502483 3300048915 Bacteria 1148
657 Ga0496112_0865549 3300048915 Bacteria 827
658 Ga0496113_0397537 3300048916 Bacteria 1106
659 Ga0496113_0658764 3300048916 Bacteria 837
660 Ga0496113_1353003 3300048916 Bacteria 553
661 Ga0496114_0001872 3300048917 Bacteria 15942
662 Ga0496114_0007387 3300048917 Bacteria 8683
663 Ga0496114_0010148 3300048917 Bacteria 7495
664 Ga0496115_0026101 3300048918 Bacteria 4556
665 Ga0496115_0399332 3300048918 Bacteria 1116
666 Ga0496116_0014245 3300048919 Bacteria 6360
667 Ga0496116_0356427 3300048919 Bacteria 667
668 Ga0496117_0004938 3300048920 Bacteria 14328
669 Ga0496117_0021057 3300048920 Bacteria 5294
670 Ga0496117_0227851 3300048920 Bacteria 1032
671 Ga0496117_0377050 3300048920 Bacteria 723
672 Ga0496118_0000312 3300048921 Bacteria 84205
673 Ga0496118_0000612 3300048921 Bacteria 58811
674 Ga0496118_0004842 3300048921 Bacteria 15693
675 Ga0496118_0403557 3300048921 Bacteria 709
676 Ga0496118_0457051 3300048921 Bacteria 646
677 Ga0496121_0000362 3300048924 Bacteria 93318
678 Ga0496121_0023653 3300048924 Bacteria 5907
679 Ga0496121_0052436 3300048924 Bacteria 3426
680 Ga0496122_0001188 3300048925 Bacteria 44580
681 Ga0496122_0053331 3300048925 Bacteria 3049
682 Ga0496123_0000329 3300048926 Bacteria 90380
683 Ga0496123_0009827 3300048926 Bacteria 8544
684 Ga0496123_0042223 3300048926 Bacteria 3151
685 Ga0496124_0013466 3300048927 Bacteria 7983
686 Ga0496124_0038417 3300048927 Bacteria 4158
687 Ga0496124_0100616 3300048927 Bacteria 2343
688 Ga0496124_0474132 3300048927 Bacteria 847
689 Ga0496126_0000598 3300048929 Bacteria 68057
690 Ga0496126_0058845 3300048929 Bacteria 3463
691 Ga0496126_0079977 3300048929 Bacteria 2893
692 Ga0496126_0190011 3300048929 Bacteria 1740
693 Ga0496126_0201242 3300048929 Bacteria 1682
694 Ga0495678_030343 3300049459 Bacteria 2263
695 Ga0495682_0007635 3300049460 Bacteria 4291
696 Ga0495682_0122472 3300049460 Bacteria 931
697 Ga0495682_0138409 3300049460 Bacteria 870
698 Ga0501036_0359756 3300049572 Bacteria 1215
699 Ga0501047_0742927 3300049581 Bacteria 797
700 Ga0501047_1446360 3300049581 Bacteria 503
701 Ga0501067_0055762 3300049583 Bacteria 2189
702 Ga0501073_0913408 3300049589 Bacteria 604
703 Ga0501080_0161198 3300049742 Bacteria 2071
704 Ga0501083_0080365 3300049744 Bacteria 2162
705 Ga0501035_0514845 3300049822 Bacteria 983
706 nmdc:mga03683_175303_c1 3300050489 Bacteria 976
707 nmdc:mga03683_244617_c1 3300050489 Bacteria 832
708 nmdc:mga03683_432659_c1 3300050489 Bacteria 631
709 nmdc:mga03n38_247512_c1 3300050490 Bacteria 940
710 nmdc:mga03n38_337696_c1 3300050490 Bacteria 817
711 nmdc:mga00v17_626_c2 3300050491 Bacteria 11095
712 nmdc:mga0k408_50590_c1 3300050493 Bacteria 2406
713 nmdc:mga07m45_1071_c1 3300050496 Bacteria 10955
714 nmdc:mga07m45_19786_c1 3300050496 Bacteria 3650
715 nmdc:mga07m45_41316_c1 3300050496 Bacteria 2582
716 nmdc:mga07m45_41336_c2 3300050496 Bacteria 2253
717 nmdc:mga0sz30_1353_c1 3300050516 Bacteria 7009
718 Ga0495601_0032697 3300053077 Bacteria 3239
719 Ga0495601_0116824 3300053077 Bacteria 1730
720 Ga0500635_0000061 3300053080 Bacteria 71946
721 Ga0495595_0194091 3300053084 Bacteria 1009
722 Ga0495619_0277458 3300053085 Bacteria 1161
723 Ga0495619_0278793 3300053085 Bacteria 1158
724 Ga0495619_0512505 3300053085 Bacteria 824
725 Ga0500578_0775690 3300053086 Bacteria 509
726 Ga0500643_003405 3300053087 Bacteria 7675
727 Ga0500644_0038611 3300053088 Bacteria 1569
728 Ga0500583_0011423 3300053092 Bacteria 3346
729 Ga0500583_0017545 3300053092 Bacteria 2887
730 Ga0500651_0292542 3300053093 Bacteria 936
731 Ga0500566_0093625 3300053094 Bacteria 1657
732 Ga0500555_001444 3300053103 Bacteria 7280
733 Ga0500556_0409504 3300053104 Bacteria 519
734 Ga0500562_029024 3300053108 Bacteria 1455
735 Ga0500562_221640 3300053108 Bacteria 511
736 Ga0500569_000497 3300053109 Bacteria 6526
737 Ga0500595_003665 3300053119 Bacteria 7109
738 Ga0500595_019465 3300053119 Bacteria 2462
739 Ga0500607_000036 3300053121 Bacteria 87178
740 Ga0500607_004589 3300053121 Bacteria 9439
741 Ga0500607_192582 3300053121 Bacteria 888
742 Ga0500608_003578 3300053122 Bacteria 5856
743 Ga0500614_001255 3300053123 Bacteria 6139
744 Ga0500618_004945 3300053125 Bacteria 4137
745 Ga0500618_030383 3300053125 Bacteria 1271
746 Ga0500618_055888 3300053125 Unclassified 890
747 Ga0500642_0373269 3300053130 Bacteria 628
748 Ga0500559_0000751 3300053136 Bacteria 21285
749 Ga0500559_0001033 3300053136 Bacteria 17027
750 Ga0500559_0004177 3300053136 Bacteria 6929
751 Ga0500559_0089018 3300053136 Bacteria 1411
752 Ga0500568_0252059 3300053139 Bacteria 643
753 Ga0500573_0047281 3300053140 Bacteria 2479
754 Ga0500573_0215577 3300053140 Unclassified 1010
755 Ga0500590_008524 3300053148 Bacteria 5121
756 Ga0500590_234580 3300053148 Bacteria 744
757 Ga0500619_126369 3300053154 Bacteria 871
758 Ga0500622_0004339 3300053156 Bacteria 8961
759 Ga0500622_0263047 3300053156 Bacteria 751
760 Ga0500624_000181 3300053157 Bacteria 24974
761 Ga0500638_011769 3300053162 Bacteria 3896
762 Ga0500639_160383 3300053163 Bacteria 1024
763 Ga0500636_0003079 3300053177 Bacteria 9348
764 Ga0500636_0111681 3300053177 Bacteria 1543
765 Ga0500637_0001378 3300053178 Bacteria 10321
766 Ga0500637_0012166 3300053178 Bacteria 4477
767 Ga0500576_091725 3300053725 Bacteria 1260
768 Ga0500625_033160 3300053729 Bacteria 2453
769 Ga0500645_016851 3300053730 Bacteria 2297
770 Ga0500645_021064 3300053730 Bacteria 2014
771 Ga0500596_037713 3300053735 Bacteria 764
772 Ga0500587_090154 3300053739 Bacteria 504
773 Ga0501084_0454132 3300054114 Bacteria 1083
774 2509126908 2508501125 Bacteria 7208311
775 2510246863 2510065045 Bacteria 7761063
776 2512350085 2512047030 Bacteria 9031815
777 2513963291 2513237151 Bacteria 6309801
778 2515682057 2515154122 Bacteria 8609520
779 2527076801 2526164713 Bacteria 6780608
780 2599329871 2599185155 Bacteria 5827168
781 2719643826 2718217991 Bacteria 7829542
782 2738822217 2738541296 Bacteria 7285013
783 2738834699 2738541298 Bacteria 7286732
784 2738875903 2738541306 Bacteria 7284992
785 2739187855 2738543002 Bacteria 7284546
786 2739222501 2738543008 Bacteria 7282815
787 2746091322 2744054900 Bacteria 8399525
788 2746097755 2744054901 Bacteria 8397047
789 2753570034 2751185846 Bacteria 7242164
790 2819625020 2818991450 Bacteria 6962147
791 2826583817 2826581358 Bacteria 5963467
792 2842325268 2842324504 Bacteria 9364110
793 2842349547 2842348783 Bacteria 9002918
794 2842455215 2842454564 Bacteria 8730687
795 2842738267 2842733646 Bacteria 5716726
796 2842750736 2842747753 Bacteria 5578255
797 2842816069 2842815866 Bacteria 5947510
798 2842851124 2842849001 Bacteria 5924277
799 2885276077 2885270888 Bacteria 9831543
800 2900640253 2900634093 Bacteria 10263517
801 2902685469 2902682994 Bacteria 8951596
802 2904435016 2904434214 Bacteria 6230908
803 2904489164 2904483920 Bacteria 7545285
804 2904543318 2904541872 Bacteria 8915136
805 2919455659 2919450847 Bacteria 5631160
806 2919529776 2919527303 Bacteria 7718827
807 2928109037 2928108538 Bacteria 7360024
808 2928118878 2928115317 Bacteria 6477646
809 2928136260 2928135762 Bacteria 7259641
810 2928503958 2928503688 Bacteria 7268108
811 2929160550 2929160207 Bacteria 9075316
812 2945938331 2945934425 Bacteria 7444609
813 2990708332 2990703756 Bacteria 7715990
814 642423462 641736151 Bacteria 7477263
815 642617100 642555113 Bacteria 8214658
816 8055268592 8055266321 Bacteria 7999742
817 8055303802 8055301274 Bacteria 8587385
818 Ga0495618_0009001
819 SwRhRL2b_contig_723786
820 MRS1b_contig_3039797
821 JGI24740J21852_10015992
822 JGI24739J22299_10026643
823 JGI24739J22299_10030987
824 JGI24735J21928_10020829
825 JGI24738J21930_10004613
826 JGI25156J39149_1000745
827 JGI25156J39149_1002132
828 JGI25156J39149_1002348
829 JGI25151J46595_10001565
830 JGI25151J46595_10002188
831 JGI25151J46595_10005632
832 JGI25165J46597_1000617
833 rootL2_10043431
834 rootH1_10061248
835 Ga0055533_1000256
836 Ga0055532_1000007
837 Ga0055527_1000007
838 Ga0055535_1000005
839 Ga0055542_1000008
840 Ga0055529_1000005
841 Ga0055526_1001856
842 Ga0055526_1021726
843 Ga0055524_1000168
844 Ga0055524_1006684
845 Ga0055536_1000034
846 Ga0055530_10000534
847 Ga0065704_10073347
848 Ga0065712_10067891
849 Ga0065707_10095279
850 Ga0065707_10527801
851 Ga0070683_101182514
852 Ga0070670_100000014
853 Ga0070670_100040346
854 Ga0070682_101298586
855 Ga0070660_100115816
856 Ga0070660_100595868
857 Ga0070689_100024768
858 Ga0070661_101341672
859 Ga0070669_100021049
860 Ga0070669_100621296
861 Ga0070669_101291542
862 Ga0070671_100191823
863 Ga0070671_101046869
864 Ga0070674_100535352
865 Ga0070673_100028695
866 Ga0070673_100510640
867 Ga0070688_100040773
868 Ga0070667_100000370
869 Ga0070667_100012862
870 Ga0070714_101279647
871 Ga0070713_100696694
872 Ga0070710_10976448
873 Ga0070711_100958035
874 Ga0070678_100105826
875 Ga0070678_101055151
876 Ga0070662_100074405
877 Ga0070662_100846508
878 Ga0070681_10219222
879 Ga0068867_101206351
880 Ga0070706_100637950
881 Ga0068853_100694827
882 Ga0070672_100222629
883 Ga0070665_100536408
884 Ga0070665_100608766
885 Ga0068855_100738617
886 Ga0070664_100426704
887 Ga0068856_101469050
888 Ga0068852_100437171
889 Ga0068864_100000021
890 Ga0068866_10232138
891 Ga0068861_101359165
892 Ga0068863_100000009
893 Ga0068858_100222328
894 Ga0068858_100928747
895 Ga0068862_100000017
896 Ga0068862_101779994
897 Ga0070717_10430379
898 Ga0075363_100300465
899 Ga0075363_100390025
900 Ga0075364_10000807
901 Ga0075364_10003334
902 Ga0075362_10110203
903 Ga0075362_10207504
904 Ga0075367_10119500
905 Ga0075369_10003090
906 Ga0097621_100548637
907 Ga0075370_10090068
908 Ga0075370_10414993
909 Ga0068871_101280319
910 Ga0079104_1000012
911 Ga0079104_1070129
912 Ga0099826_10000004
913 Ga0105251_10002594
914 Ga0105251_10132699
915 Ga0105244_10000519
916 Ga0105244_10028791
917 Ga0105240_10060061
918 Ga0105240_10811019
919 Ga0105240_11086689
920 Ga0105247_10009801
921 Ga0105247_10224905
922 Ga0105243_10133074
923 Ga0105243_10269270
924 Ga0105241_10823560
925 Ga0105241_11291878
926 Ga0105248_10000030
927 Ga0105237_11324187
928 Ga0105238_10537619
929 Ga0105238_11077645
930 Ga0105249_10000164
931 Ga0105239_11309727
932 Ga0105246_10138849
933 Ga0157369_10045565
934 Ga0157369_10281069
935 Ga0157378_11142800
936 Ga0163162_10036388
937 Ga0163162_10043008
938 Ga0163162_10458609
939 Ga0157375_10457591
940 Ga0163163_10122471
941 Ga0163163_10702995
942 Ga0163163_11092159
943 Ga0182008_10028054
944 Ga0182008_10048948
945 Ga0157377_10468753
946 Ga0157379_10048150
947 Ga0157376_10437471
948 Ga0182007_10000258
949 Ga0163161_10028414
950 Ga0213875_10234508
951 Ga0213871_10152771
952 Ga0224712_10224554
953 Ga0209674_100020
954 Ga0209672_100013
955 Ga0209147_100013
956 Ga0209563_100244
957 Ga0207427_100702
958 Ga0209258_100016
959 Ga0207425_1074709
960 Ga0209148_1000020
961 Ga0209759_1000010
962 Ga0209759_1000086
963 Ga0209759_1000203
964 Ga0209759_1025664
965 Ga0209129_1040790
966 Ga0209233_1000055
967 Ga0209233_1045482
968 Ga0209565_1000066
969 Ga0209455_1000017
970 Ga0209673_1019818
971 Ga0209675_1034186
972 Ga0209676_1000014
973 Ga0209025_1000323
974 Ga0209025_1000409
975 Ga0209025_1001111
976 Ga0209025_1038721
977 Ga0209564_1000182
978 Ga0209564_1000679
979 Ga0209758_1011370
980 Ga0209050_1006532
981 Ga0209256_1013023
982 Ga0207713_1000561
983 Ga0207713_1003828
984 Ga0207642_10103590
985 Ga0207710_10004885
986 Ga0207710_10444121
987 Ga0207680_10037559
988 Ga0207647_10001546
989 Ga0207647_10032193
990 Ga0207647_10035783
991 Ga0207645_10039810
992 Ga0207663_10292317
993 Ga0207657_10167937
994 Ga0207694_10655159
995 Ga0207650_10000189
996 Ga0207650_10019169
997 Ga0207659_10174305
998 Ga0207700_10656258
999 Ga0207664_10286642
1000 Ga0207644_10019704
1001 Ga0207644_10053819
1002 Ga0207706_10078679
1003 Ga0207706_10127865
1004 Ga0207709_10079116
1005 Ga0207709_10266210
1006 Ga0207670_10005817
1007 Ga0207704_10536575
1008 Ga0207691_10423151
1009 Ga0207711_10000029
1010 Ga0207689_10245875
1011 Ga0207679_10173131
1012 Ga0207667_11747164
1013 Ga0207651_10053237
1014 Ga0207712_10000342
1015 Ga0207640_11452700
1016 Ga0207658_10000484
1017 Ga0207658_10025374
1018 Ga0207703_10838799
1019 Ga0207639_10224767
1020 Ga0207639_11612044
1021 Ga0207678_10023796
1022 Ga0207641_10000017
1023 Ga0207648_10010276
1024 Ga0207676_10000088
1025 Ga0207676_11654515
1026 Ga0207675_100240794
1027 Ga0207683_10107300
1028 Ga0207683_10132293
1029 Ga0209281_1000039
1030 Ga0209281_1046303
1031 Ga0209371_1021959
1032 Ga0209282_1000099
1033 Ga0209813_10221273
1034 Ga0268266_10462629
1035 Ga0268266_11183236
1036 Ga0268265_10000025
1037 Ga0307517_10000131
1038 Ga0307517_10197422
1039 Ga0307515_10002916
1040 Ga0307515_10786234
1041 Ga0268256_1003434
1042 Ga0307512_10012765
1043 Ga0307512_10108358
1044 Ga0265762_1017580
1045 Ga0265760_10127573
1046 Ga0265320_10061746
1047 Ga0265340_10073370
1048 Ga0307513_10034705
1049 Ga0307513_10042207
1050 Ga0307513_10493639
1051 Ga0307509_10007605
1052 Ga0307408_100006014
1053 Ga0307508_10138304
1054 Ga0307508_10276744
1055 Ga0307514_10001966
1056 Ga0307514_10007054
1057 Ga0265314_10266353
1058 Ga0307516_10163698
1059 Ga0307516_10179039
1060 Ga0307405_10086114
1061 Ga0307405_10113229
1062 Ga0307405_10327483
1063 Ga0307518_10303312
1064 Ga0307410_10016050
1065 Ga0307406_10759715
1066 Ga0307412_10000002
1067 Ga0307412_10135416
1068 Ga0307416_101256584
1069 Ga0307414_10367418
1070 Ga0307411_10481199
1071 Ga0307415_100217922
1072 Ga0307507_10174167
1073 Ga0307510_10287439
1074 Ga0373945_0287914
1075 Ga0373957_0010069
1076 Ga0373943_0358088
1077 Ga0373935_0464140
1078 Ga0373927_0086209
1079 Ga0373933_0157908
1080 Ga0373937_0402056
1081 Ga0395899_0012316
1082 Ga0395900_0095682
1083 Ga0395898_0265933
1084 Ga0436364_0740204
1085 Ga0395901_0002262
1086 Ga0436360_0353742
1087 Ga0436360_0653308
1088 Ga0436360_0867937
1089 Ga0436361_0163419
1090 Ga0436361_1210709
1091 Ga0436363_1232577
1092 Ga0439436_0002141
1093 Ga0439439_0000724
1094 Ga0439466_0004795
1095 Ga0439465_0000306
1096 Ga0451795_0163026
1097 Ga0439431_0000537
1098 Ga0439433_0001012
1099 Ga0439442_018106
1100 Ga0439445_0000841
1101 Ga0439432_000424
1102 Ga0439449_0000280
1103 Ga0439452_000869
1104 Ga0450909_003580
1105 Ga0451577_0424792
1106 Ga0466966_0087676
1107 Ga0453684_1285557
1108 Ga0466957_0026441
1109 Ga0466960_0162152
1110 Ga0451576_0884034
1111 Ga0466967_0396005
1112 Ga0495592_0018260
1113 Ga0495592_0034263
1114 Ga0495592_0099706
1115 Ga0495592_0198480
1116 Ga0495592_0199826
1117 Ga0495603_0000683
1118 Ga0495603_0003765
1119 Ga0495603_0051296
1120 Ga0495603_0093001
1121 Ga0495590_0009087
1122 Ga0495590_0034047
1123 Ga0495591_009205
1124 Ga0495591_056058
1125 Ga0495629_0000100
1126 Ga0495629_0000408
1127 Ga0495629_0020048
1128 Ga0495629_0028861
1129 Ga0495629_0034520
1130 Ga0495629_0062282
1131 Ga0495629_0202157
1132 Ga0495638_0012863
1133 Ga0495638_0018898
1134 Ga0495641_0039958
1135 Ga0495641_0043901
1136 Ga0495651_0017175
1137 Ga0495651_0029980
1138 Ga0495651_0039394
1139 Ga0495651_0185830
1140 Ga0495653_0000169
1141 Ga0495653_0001524
1142 Ga0495653_0006960
1143 Ga0495653_0035749
1144 Ga0495653_0057069
1145 Ga0495653_0068576
1146 Ga0495650_0000668
1147 Ga0495650_0003498
1148 Ga0495650_0008948
1149 Ga0495650_0023319
1150 Ga0495580_0000791
1151 Ga0495580_0000905
1152 Ga0495580_0001796
1153 Ga0495580_0001965
1154 Ga0495580_0007370
1155 Ga0495580_0009937
1156 Ga0495580_0023508
1157 Ga0495580_0027817
1158 Ga0495582_0010937
1159 Ga0495582_0040306
1160 Ga0495582_0047027
1161 Ga0495582_0063145
1162 Ga0495582_0186043
1163 Ga0495605_0001926
1164 Ga0495605_0002725
1165 Ga0495605_0005584
1166 Ga0495662_0012152
1167 Ga0495662_0023751
1168 Ga0495662_0132886
1169 Ga0495662_0148750
1170 Ga0495664_0012888
1171 Ga0495664_0015445
1172 Ga0495664_0076139
1173 Ga0495664_0079223
1174 Ga0495664_0632759
1175 Ga0495584_0367890
1176 Ga0495585_0559636
1177 Ga0495594_0043464
1178 Ga0495594_0243725
1179 Ga0495596_0002164
1180 Ga0495596_0002614
1181 Ga0495596_0023418
1182 Ga0495607_0017647
1183 Ga0495583_0025973
1184 Ga0495583_0358655
1185 Ga0495606_0109964
1186 Ga0495606_0114535
1187 Ga0495606_0122444
1188 Ga0495606_0131195
1189 Ga0495608_0034219
1190 Ga0495608_0120297
1191 Ga0495608_0231294
1192 Ga0495608_0263484
1193 Ga0495608_0368728
1194 Ga0495610_0002352
1195 Ga0495610_0201490
1196 Ga0495616_0042141
1197 Ga0495618_0037267
1198 Ga0495618_0123686
1199 Ga0495618_0589515
1200 Ga0495620_0028858
1201 Ga0495628_0001923
1202 Ga0495628_0029993
1203 Ga0495628_0076396
1204 Ga0495628_0345511
1205 Ga0495628_0926845
1206 Ga0495628_0994056
1207 Ga0495630_0006257
1208 Ga0495630_0007202
1209 Ga0495630_0010991
1210 Ga0495630_0027298
1211 Ga0495630_0070621
1212 Ga0495630_0097336
1213 Ga0495631_0203254
1214 Ga0495632_0383623
1215 Ga0495637_0097748
1216 Ga0495643_0037702
1217 Ga0495643_0257015
1218 Ga0495648_0000623
1219 Ga0495648_0002083
1220 Ga0495648_0023865
1221 Ga0495648_0029125
1222 Ga0495648_0053803
1223 Ga0495648_0063962
1224 Ga0495648_0183021
1225 Ga0495666_0000410
1226 Ga0495666_0001323
1227 Ga0495666_0001765
1228 Ga0495666_0005178
1229 Ga0495666_0012763
1230 Ga0495642_0002523
1231 Ga0495642_0091913
1232 Ga0495642_0215719
1233 Ga0495652_0002341
1234 Ga0495652_0032805
1235 Ga0495652_0253606
1236 Ga0495652_0311018
1237 Ga0495652_0554837
1238 Ga0495652_0724262
1239 Ga0495654_0003171
1240 Ga0495654_0019899
1241 Ga0495665_0000564
1242 Ga0495665_0084778
1243 Ga0495665_0089084
1244 Ga0495640_0019998
1245 Ga0495640_0098614
1246 Ga0495640_0160228
1247 Ga0495640_0168120
1248 Ga0495586_0000751
1249 Ga0495586_0018540
1250 Ga0495586_0161736
1251 Ga0495587_0001812
1252 Ga0495587_0002913
1253 Ga0495609_0008282
1254 Ga0495597_0005066
1255 Ga0495597_0022809
1256 Ga0495597_0037022
1257 Ga0495645_0000457
1258 Ga0495645_0161416
1259 Ga0495645_0175983
1260 Ga0495645_0373013
1261 Ga0495633_0118746
1262 Ga0495667_0055562
1263 Ga0495667_0056939
1264 Ga0495667_0065514
1265 Ga0495667_0153183
1266 Ga0495667_0277743
1267 Ga0495667_0441927
1268 Ga0495656_0151949
1269 Ga0495668_0073363
1270 Ga0495668_0142236
1271 Ga0495668_0158002
1272 Ga0495668_0278321
1273 Ga0495634_0004396
1274 Ga0495634_0011235
1275 Ga0495634_0037266
1276 Ga0495634_0133122
1277 Ga0495611_0013221
1278 Ga0495611_0446204
1279 Ga0495625_0029271
1280 Ga0495625_0068668
1281 Ga0495625_0130324
1282 Ga0495625_0342847
1283 Ga0495635_0001145
1284 Ga0495635_0019494
1285 Ga0495635_0088145
1286 Ga0495635_0297523
1287 Ga0495635_0603801
1288 Ga0495661_0004538
1289 Ga0495661_0019524
1290 Ga0495661_0026221
1291 Ga0495661_0029388
1292 Ga0495661_0081872
1293 Ga0495588_0005612
1294 Ga0495588_0069897
1295 Ga0495588_0286551
1296 Ga0495657_0387358
1297 Ga0495599_0007994
1298 Ga0495599_0015972
1299 Ga0495599_0120911
1300 Ga0495599_0122504
1301 Ga0495623_0006202
1302 Ga0495623_0059911
1303 Ga0495623_0076578
1304 Ga0495623_0085793
1305 Ga0495623_0094575
1306 Ga0495623_0290055
1307 Ga0495646_0000933
1308 Ga0495646_0008494
1309 Ga0495646_0011843
1310 Ga0495646_0026772
1311 Ga0495646_0123029
1312 Ga0495646_0123396
1313 Ga0495646_0143135
1314 Ga0495646_0239967
1315 Ga0495647_0046001
1316 Ga0495647_0130432
1317 Ga0495669_0021541
1318 Ga0495669_0330961
1319 Ga0495669_0518181
1320 Ga0495613_0001968
1321 Ga0495613_0006003
1322 Ga0495613_0011571
1323 Ga0495613_0012272
1324 Ga0495613_0020500
1325 Ga0495624_0000692
1326 Ga0495624_0001696
1327 Ga0495624_0004058
1328 Ga0495624_0018963
1329 Ga0495624_0045986
1330 Ga0495624_0160519
1331 Ga0495624_0454194
1332 Ga0495670_0207740
1333 Ga0495671_0025935
1334 Ga0495671_0028260
1335 Ga0495671_0159555
1336 Ga0495671_0268871
1337 Ga0495671_0346739
1338 Ga0495671_0527615
1339 Ga0495649_0017414
1340 Ga0495649_0062328
1341 Ga0495649_0068371
1342 Ga0495649_0086806
1343 Ga0495649_0176689
1344 Ga0495649_0583950
1345 Ga0495589_0004858
1346 Ga0495589_0028251
1347 Ga0495589_0066847
1348 Ga0495589_0425112
1349 Ga0495600_0025286
1350 Ga0495600_0113897
1351 Ga0495600_0233907
1352 Ga0495660_0337513
1353 Ga0495660_0482265
1354 Ga0495581_0004631
1355 Ga0495581_0007803
1356 Ga0495581_0087781
1357 Ga0495604_0000459
1358 Ga0495604_0000659
1359 Ga0495604_0024650
1360 Ga0495604_0026692
1361 Ga0495604_0129253
1362 Ga0495604_0301954
1363 Ga0495674_0002277
1364 Ga0495674_0010545
1365 Ga0495674_0019964
1366 Ga0495674_0028583
1367 Ga0495674_0051288
1368 Ga0495674_0055658
1369 Ga0495674_0211946
1370 Ga0495674_0259971
1371 Ga0495674_0608986
1372 Ga0495672_0016076
1373 Ga0495672_0061025
1374 Ga0495672_0132696
1375 Ga0495676_0018412
1376 Ga0495676_0064608
1377 Ga0495676_0151542
1378 Ga0495676_0154479
1379 Ga0495676_0769032
1380 Ga0495680_0002493
1381 Ga0495680_0010379
1382 Ga0495680_0022672
1383 Ga0495680_0085118
1384 Ga0495680_0166950
1385 Ga0495680_0208770
1386 Ga0495680_0293328
1387 Ga0495683_0001684
1388 Ga0495683_0004869
1389 Ga0495683_0007851
1390 Ga0495683_0013159
1391 Ga0495683_0053106
1392 Ga0495683_0166912
1393 Ga0495687_000451
1394 Ga0495687_007271
1395 Ga0495687_024020
1396 Ga0495675_0012590
1397 Ga0495675_0013276
1398 Ga0495675_0013977
1399 Ga0495675_0036809
1400 Ga0495675_0095557
1401 Ga0495677_0246711
1402 Ga0495679_000006
1403 Ga0495679_000338
1404 Ga0495679_000838
1405 Ga0495679_001667
1406 Ga0495679_031441
1407 Ga0495685_043422
1408 Ga0495673_0043136
1409 Ga0495681_0044146
1410 Ga0495681_0205488
1411 Ga0495684_0015527
1412 Ga0495684_0069719
1413 Ga0495684_0439780
1414 Ga0495684_0987764
1415 Ga0495684_1087999
1416 Ga0495686_0073293
1417 Ga0495593_0004299
1418 Ga0495593_0005655
1419 Ga0495593_0008997
1420 Ga0495593_0018034
1421 Ga0495593_0046871
1422 Ga0495593_0093789
1423 Ga0495593_0206597
1424 Ga0495602_0003266
1425 Ga0495602_0017336
1426 Ga0495602_0027508
1427 Ga0495602_0084546
1428 Ga0495602_0094811
1429 Ga0495602_0100078
1430 Ga0495602_0106576
1431 Ga0495602_0227729
1432 Ga0495602_0501861
1433 Ga0495614_0000299
1434 Ga0495614_0001626
1435 Ga0495614_0022180
1436 Ga0495614_0033025
1437 Ga0495614_0129862
1438 Ga0495626_0009894
1439 Ga0495626_0034477
1440 Ga0495626_0035831
1441 Ga0495626_0208955
1442 Ga0496100_0003162
1443 Ga0496100_0011926
1444 Ga0496100_0378010
1445 Ga0496101_0003656
1446 Ga0496101_0356805
1447 Ga0496101_0562021
1448 Ga0496102_0001964
1449 Ga0496102_0076172
1450 Ga0496102_0104471
1451 Ga0496102_0376237
1452 Ga0496102_1766851
1453 Ga0496103_0020110
1454 Ga0496103_0051283
1455 Ga0496104_0001742
1456 Ga0496104_0162781
1457 Ga0496104_0836675
1458 Ga0496104_1587563
1459 Ga0496105_0003945
1460 Ga0496105_0029894
1461 Ga0496106_0020878
1462 Ga0496106_0088814
1463 Ga0496106_0406866
1464 Ga0496107_0323662
1465 Ga0496107_0343679
1466 Ga0496108_0544949
1467 Ga0496109_0151837
1468 Ga0496109_0311929
1469 Ga0496110_0004542
1470 Ga0496110_0090303
1471 Ga0496111_0014397
1472 Ga0496112_0070885
1473 Ga0496112_0502483
1474 Ga0496112_0865549
1475 Ga0496113_0397537
1476 Ga0496113_0658764
1477 Ga0496113_1353003
1478 Ga0496114_0001872
1479 Ga0496114_0007387
1480 Ga0496114_0010148
1481 Ga0496115_0026101
1482 Ga0496115_0399332
1483 Ga0496116_0014245
1484 Ga0496116_0356427
1485 Ga0496117_0004938
1486 Ga0496117_0021057
1487 Ga0496117_0227851
1488 Ga0496117_0377050
1489 Ga0496118_0000312
1490 Ga0496118_0000612
1491 Ga0496118_0004842
1492 Ga0496118_0403557
1493 Ga0496118_0457051
1494 Ga0496121_0000362
1495 Ga0496121_0023653
1496 Ga0496121_0052436
1497 Ga0496122_0001188
1498 Ga0496122_0053331
1499 Ga0496123_0000329
1500 Ga0496123_0009827
1501 Ga0496123_0042223
1502 Ga0496124_0013466
1503 Ga0496124_0038417
1504 Ga0496124_0100616
1505 Ga0496124_0474132
1506 Ga0496126_0000598
1507 Ga0496126_0058845
1508 Ga0496126_0079977
1509 Ga0496126_0190011
1510 Ga0496126_0201242
1511 Ga0495678_030343
1512 Ga0495682_0007635
1513 Ga0495682_0122472
1514 Ga0495682_0138409
1515 Ga0501036_0359756
1516 Ga0501047_0742927
1517 Ga0501047_1446360
1518 Ga0501067_0055762
1519 Ga0501073_0913408
1520 Ga0501080_0161198
1521 Ga0501083_0080365
1522 Ga0501035_0514845
1523 nmdc:mga03683_175303_c1
1524 nmdc:mga03683_244617_c1
1525 nmdc:mga03683_432659_c1
1526 nmdc:mga03n38_247512_c1
1527 nmdc:mga03n38_337696_c1
1528 nmdc:mga00v17_626_c2
1529 nmdc:mga0k408_50590_c1
1530 nmdc:mga07m45_1071_c1
1531 nmdc:mga07m45_19786_c1
1532 nmdc:mga07m45_41316_c1
1533 nmdc:mga07m45_41336_c2
1534 nmdc:mga0sz30_1353_c1
1535 Ga0495601_0032697
1536 Ga0495601_0116824
1537 Ga0500635_0000061
1538 Ga0495595_0194091
1539 Ga0495619_0277458
1540 Ga0495619_0278793
1541 Ga0495619_0512505
1542 Ga0500578_0775690
1543 Ga0500643_003405
1544 Ga0500644_0038611
1545 Ga0500583_0011423
1546 Ga0500583_0017545
1547 Ga0500651_0292542
1548 Ga0500566_0093625
1549 Ga0500555_001444
1550 Ga0500556_0409504
1551 Ga0500562_029024
1552 Ga0500562_221640
1553 Ga0500569_000497
1554 Ga0500595_003665
1555 Ga0500595_019465
1556 Ga0500607_000036
1557 Ga0500607_004589
1558 Ga0500607_192582
1559 Ga0500608_003578
1560 Ga0500614_001255
1561 Ga0500618_004945
1562 Ga0500618_030383
1563 Ga0500618_055888
1564 Ga0500642_0373269
1565 Ga0500559_0000751
1566 Ga0500559_0001033
1567 Ga0500559_0004177
1568 Ga0500559_0089018
1569 Ga0500568_0252059
1570 Ga0500573_0047281
1571 Ga0500573_0215577
1572 Ga0500590_008524
1573 Ga0500590_234580
1574 Ga0500619_126369
1575 Ga0500622_0004339
1576 Ga0500622_0263047
1577 Ga0500624_000181
1578 Ga0500638_011769
1579 Ga0500639_160383
1580 Ga0500636_0003079
1581 Ga0500636_0111681
1582 Ga0500637_0001378
1583 Ga0500637_0012166
1584 Ga0500576_091725
1585 Ga0500625_033160
1586 Ga0500645_016851
1587 Ga0500645_021064
1588 Ga0500596_037713
1589 Ga0500587_090154
1590 Ga0501084_0454132
1591 2509126908
1592 2510246863
1593 2512350085
1594 2513963291
1595 2515682057
1596 2527076801
1597 2599329871
1598 2719643826
1599 2738822217
1600 2738834699
1601 2738875903
1602 2739187855
1603 2739222501
1604 2746091322
1605 2746097755
1606 2753570034
1607 2819625020
1608 2826583817
1609 2842325268
1610 2842349547
1611 2842455215
1612 2842738267
1613 2842750736
1614 2842816069
1615 2842851124
1616 2885276077
1617 2900640253
1618 2902685469
1619 2904435016
1620 2904489164
1621 2904543318
1622 2919455659
1623 2919529776
1624 2928109037
1625 2928118878
1626 2928136260
1627 2928503958
1628 2929160550
1629 2945938331
1630 2990708332
1631 642423462
1632 642617100
1633 8055268592
1634 8055303802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12903

DUF3830

Protein of unknown function (DUF3830)

30

165

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kop-assembly1.cif.gz_F crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8964 1 139
3kop-assembly1.cif.gz_F crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8846 1 139
3kop-assembly1.cif.gz_A crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8657 1 139
3kop-assembly1.cif.gz_B crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8574 1 139
3kop-assembly1.cif.gz_D crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8565 1 138
ID Description Score Start End Superfamily
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.8816 3 139 2.40.100.20
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.8584 3 139 2.40.100.20
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.7406 4 140 2.40.100.20
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.7304 4 140 2.40.100.20
af_P9WHW1_129_308_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7163 2 138 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A7Z7BA93-F1-model_v4 Cyclophilin-like superfamily protein 0.9804 2 140
AF-A0A2M6VRG0-F1-model_v4 Cyclophilin-like superfamily protein 0.9795 3 139
AF-A0A1R3RW20-F1-model_v4 DUF3830 domain-containing protein 0.9789 3 139
AF-A0A395GVL8-F1-model_v4 DUF3830 family protein 0.9783 4 136
AF-A0A1V6REA4-F1-model_v4 Cyclophilin-like superfamily protein 0.9776 3 139

Map