F482109

General Info

Members Datasets Scaffolds Average Seq Length
817 363 1634 599

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0001187|Ga0496122_0001187_16293_18197
Length 634
Sequence MTITISRFALAAALAFGTAGGGIAHAEVAQASGAPTAAQAQAFVDAAEKESYDFSLDSSRVQWINATNITDDTDAVAAKFGAQYTEMSVRFAKEAAKYATVPGLSAELRRKLDMFRSGIVLPAPTTPGAAAELNQIATKLQSDYGKGMGKLDGKPINGSDIEAEMGALGHTPAQYQEMWTSWHDQVGKPMKADYARLVEIANQGAKELGFADTGAMWRSGYDMPPEQFAALTEKIWQEVKPLYDALHCYTRTKLNEKYGDAVQAKTGPIRADLLGNMWAQEWGNIYPLVAPKGAGDLGYDIGDLLVAKGFKQTTPAMFDTSDTPETQRRGYWEKQMFKIGEGFYSSLGFEPLPASFWERTQFIKPRDREVVCHASAWDLDNKNDIRVKMCTKVNSDDFITIHHELGHNYYQRAYQKQDPIYLNGANDGFHEAIGDFIALSITPQYLVDIKLLDPAKVPSADKDIGLLLRQAMDKVAFLPFGLLIDRWRWGVFDGSIKPADYNKAWTDMRLQYQGIVPPVDRPADAFDAGAKYHVPGNTPYTRYFLARVLQFQFYEAACKQAGWKGPLHRCSFYGNKDVGAKLNQMLEMGASKPWPDALQTFTGSREMSGKALIAYFAPLKKWLDQQNKGKACGW

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
261 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
262 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
270 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
271 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
272 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
275 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
279 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
280 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
281 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
282 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
297 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
300 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
313 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
314 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
318 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
319 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
320 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
321 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
322 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
323 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
324 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
325 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
326 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
327 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
328 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
329 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
330 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
331 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
332 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
333 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
334 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
335 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
336 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
337 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
338 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
339 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
340 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
341 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
342 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
343 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
344 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
345 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
346 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
347 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
348 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
349 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
350 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
351 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
352 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
353 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
354 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
355 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
356 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
357 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
358 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
359 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
360 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
361 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
362 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
363 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.25
Metatranscriptomes 0
Isolates 5.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 15.91
Nodule 0
Rhizoplane 3.06
Rhizosphere 71.85
Stem 0
Stem Tuber 0.12
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0001187 3300048925 Bacteria 44594
2 SwRhRL2b_contig_3540226 2162886007 Bacteria 4193
3 SwRhRL2b_contig_3705000 2162886007 Bacteria 37959
4 JGI24736J21556_1000121 3300001904 Bacteria 13331
5 JGI24752J21851_1000155 3300001976 Bacteria 9311
6 JGI24752J21851_1000461 3300001976 Bacteria 5495
7 JGI24737J22298_10003404 3300001990 Bacteria 5622
8 JGI24735J21928_10000918 3300002067 Bacteria 10528
9 JGI24750J21931_1000359 3300002070 Bacteria 7796
10 JGI24748J21848_1000044 3300002074 Bacteria 59119
11 JGI24749J21850_1000330 3300002076 Bacteria 7176
12 JGI24749J21850_1000531 3300002076 Bacteria 5590
13 JGI24034J26672_10000020 3300002239 Bacteria 122643
14 JGI24742J22300_10001043 3300002244 Bacteria 4265
15 JGI24751J29686_10000052 3300002459 Bacteria 65492
16 JGI25150J39212_1000046 3300002774 Bacteria 78180
17 JGI25159J45721_1007784 3300002987 Bacteria 3024
18 JGI25151J46595_10001638 3300003187 Bacteria 14729
19 JGI25165J46597_1000073 3300003214 Bacteria 192140
20 JGI25153J46596_10000006 3300003215 Bacteria 447760
21 JGI25153J46596_10000124 3300003215 Bacteria 86430
22 Ga0055525_1000090 3300003759 Bacteria 141071
23 Ga0055542_1000046 3300003762 Bacteria 201922
24 Ga0055529_1000007 3300003763 Bacteria 403604
25 Ga0055529_1000109 3300003763 Bacteria 121019
26 Ga0055526_1007061 3300003771 Bacteria 5938
27 Ga0055524_1001907 3300003775 Bacteria 11300
28 Ga0055536_1003381 3300003781 Bacteria 8607
29 Ga0055536_1006713 3300003781 Bacteria 5289
30 Ga0055536_1008867 3300003781 Bacteria 4251
31 Ga0055530_10001655 3300003791 Bacteria 15864
32 Ga0055530_10002492 3300003791 Bacteria 11790
33 Ga0055530_10013862 3300003791 Bacteria 2724
34 Ga0055540_1003937 3300003792 Bacteria 6941
35 Ga0055531_10000008 3300003794 Bacteria 222269
36 Ga0055531_10001714 3300003794 Bacteria 15705
37 Ga0055531_10001722 3300003794 Bacteria 15672
38 Ga0055531_10009693 3300003794 Bacteria 4895
39 Ga0065165_1001443 3300005262 Bacteria 25758
40 Ga0065165_1002698 3300005262 Bacteria 14260
41 Ga0065704_10000191 3300005289 Bacteria 318191
42 Ga0065704_10070744 3300005289 Bacteria 16791
43 Ga0065704_10081289 3300005289 Bacteria 3786
44 Ga0065704_10100052 3300005289 Bacteria 2288
45 Ga0065715_10000978 3300005293 Bacteria 7475
46 Ga0065707_10081865 3300005295 Bacteria 32547
47 Ga0065707_10086251 3300005295 Bacteria 5572
48 Ga0070658_10000227 3300005327 Bacteria 50101
49 Ga0070658_10024952 3300005327 Bacteria 4793
50 Ga0070676_10007834 3300005328 Bacteria 5743
51 Ga0070690_100000180 3300005330 Bacteria 32463
52 Ga0070670_100000024 3300005331 Bacteria 189811
53 Ga0070670_100000792 3300005331 Bacteria 24611
54 Ga0070670_100003165 3300005331 Bacteria 13607
55 Ga0070670_100005522 3300005331 Bacteria 10672
56 Ga0070670_100032156 3300005331 Bacteria 4519
57 Ga0070670_100052533 3300005331 Bacteria 3499
58 Ga0070670_100087376 3300005331 Bacteria 2679
59 Ga0070677_10001757 3300005333 Bacteria 6845
60 Ga0070666_10000027 3300005335 Bacteria 151010
61 Ga0070666_10000352 3300005335 Bacteria 28924
62 Ga0070666_10010284 3300005335 Bacteria 5848
63 Ga0070666_10029018 3300005335 Bacteria 3635
64 Ga0070660_100004165 3300005339 Bacteria 9989
65 Ga0070689_100008132 3300005340 Bacteria 7372
66 Ga0070661_100000010 3300005344 Bacteria 175777
67 Ga0070661_100002364 3300005344 Bacteria 12951
68 Ga0070661_100015823 3300005344 Bacteria 5325
69 Ga0070661_100026844 3300005344 Bacteria 4144
70 Ga0070668_100000027 3300005347 Bacteria 89913
71 Ga0070668_100000068 3300005347 Bacteria 64209
72 Ga0070668_100000646 3300005347 Bacteria 23522
73 Ga0070668_100004087 3300005347 Bacteria 10803
74 Ga0070668_100019269 3300005347 Bacteria 5135
75 Ga0070668_100019894 3300005347 Bacteria 5058
76 Ga0070668_100066155 3300005347 Bacteria 2804
77 Ga0070669_100000018 3300005353 Bacteria 195789
78 Ga0070669_100000047 3300005353 Bacteria 118892
79 Ga0070669_100000099 3300005353 Bacteria 85328
80 Ga0070669_100001232 3300005353 Bacteria 18563
81 Ga0070669_100016595 3300005353 Bacteria 5257
82 Ga0070669_100021839 3300005353 Bacteria 4577
83 Ga0070675_100004161 3300005354 Bacteria 10987
84 Ga0070675_100012526 3300005354 Bacteria 6648
85 Ga0070675_100023281 3300005354 Bacteria 4951
86 Ga0070671_100000011 3300005355 Bacteria 202057
87 Ga0070671_100000353 3300005355 Bacteria 31530
88 Ga0070671_100001241 3300005355 Bacteria 19109
89 Ga0070671_100004632 3300005355 Bacteria 10905
90 Ga0070671_100008988 3300005355 Bacteria 8018
91 Ga0070673_100029291 3300005364 Bacteria 4105
92 Ga0070673_100032493 3300005364 Bacteria 3930
93 Ga0070688_100000293 3300005365 Bacteria 25617
94 Ga0070659_100013031 3300005366 Bacteria 6182
95 Ga0070667_100000017 3300005367 Bacteria 230531
96 Ga0070667_100000066 3300005367 Bacteria 134529
97 Ga0070667_100000067 3300005367 Bacteria 133023
98 Ga0070667_100000290 3300005367 Bacteria 56841
99 Ga0070667_100000459 3300005367 Bacteria 41954
100 Ga0070667_100000480 3300005367 Bacteria 40910
101 Ga0070667_100001292 3300005367 Bacteria 22636
102 Ga0070667_100011712 3300005367 Bacteria 7247
103 Ga0070667_100012620 3300005367 Bacteria 6988
104 Ga0070667_100019588 3300005367 Bacteria 5613
105 Ga0070678_100000076 3300005456 Bacteria 37213
106 Ga0070662_100005311 3300005457 Bacteria 8227
107 Ga0070662_100058572 3300005457 Bacteria 2804
108 Ga0070681_10089493 3300005458 Bacteria 3030
109 Ga0070685_10000238 3300005466 Bacteria 36209
110 Ga0070679_100000168 3300005530 Bacteria 52996
111 Ga0070679_100165301 3300005530 Bacteria 2186
112 Ga0068853_100002669 3300005539 Bacteria 13447
113 Ga0068853_100020182 3300005539 Bacteria 5539
114 Ga0070672_100003237 3300005543 Bacteria 10542
115 Ga0070686_100000010 3300005544 Bacteria 192116
116 Ga0070695_100075744 3300005545 Bacteria 2215
117 Ga0070665_100000086 3300005548 Bacteria 178229
118 Ga0070665_100000254 3300005548 Bacteria 88587
119 Ga0070665_100002933 3300005548 Bacteria 18422
120 Ga0070665_100013328 3300005548 Bacteria 8274
121 Ga0070665_100015010 3300005548 Bacteria 7774
122 Ga0070664_100009278 3300005564 Bacteria 7986
123 Ga0070664_100090692 3300005564 Bacteria 2645
124 Ga0068854_100013256 3300005578 Bacteria 5404
125 Ga0068852_100034615 3300005616 Bacteria 4205
126 Ga0068852_100156023 3300005616 Bacteria 2126
127 Ga0068859_100002363 3300005617 Bacteria 19203
128 Ga0068859_100004889 3300005617 Bacteria 13646
129 Ga0068859_100006146 3300005617 Bacteria 12204
130 Ga0068859_100013485 3300005617 Bacteria 8195
131 Ga0068859_100020790 3300005617 Bacteria 6588
132 Ga0068859_100027164 3300005617 Bacteria 5743
133 Ga0068859_100109660 3300005617 Bacteria 2821
134 Ga0068859_100169626 3300005617 Bacteria 2263
135 Ga0068864_100000036 3300005618 Bacteria 189811
136 Ga0068864_100000063 3300005618 Bacteria 119845
137 Ga0068864_100001646 3300005618 Bacteria 18401
138 Ga0068864_100003044 3300005618 Bacteria 13839
139 Ga0068861_100000005 3300005719 Bacteria 101677
140 Ga0068861_100002905 3300005719 Bacteria 11293
141 Ga0068861_100007125 3300005719 Bacteria 7655
142 Ga0068861_100013995 3300005719 Bacteria 5624
143 Ga0068863_100000001 3300005841 Bacteria 581116
144 Ga0068863_100000038 3300005841 Bacteria 161477
145 Ga0068863_100000062 3300005841 Bacteria 119845
146 Ga0068863_100000603 3300005841 Bacteria 36544
147 Ga0068863_100000775 3300005841 Bacteria 32088
148 Ga0068863_100003283 3300005841 Bacteria 15970
149 Ga0068863_100006015 3300005841 Bacteria 11900
150 Ga0068863_100006939 3300005841 Bacteria 11104
151 Ga0068863_100008950 3300005841 Bacteria 9776
152 Ga0068863_100010531 3300005841 Bacteria 8979
153 Ga0068863_100011823 3300005841 Bacteria 8440
154 Ga0068858_100000103 3300005842 Bacteria 88754
155 Ga0068858_100000530 3300005842 Bacteria 39968
156 Ga0068858_100000777 3300005842 Bacteria 33348
157 Ga0068858_100003512 3300005842 Bacteria 15537
158 Ga0068860_100000013 3300005843 Bacteria 323055
159 Ga0068860_100000056 3300005843 Bacteria 202751
160 Ga0068860_100000080 3300005843 Bacteria 170152
161 Ga0068860_100024655 3300005843 Bacteria 5808
162 Ga0068862_100000033 3300005844 Bacteria 176515
163 Ga0068862_100000069 3300005844 Bacteria 122535
164 Ga0068862_100000115 3300005844 Bacteria 94951
165 Ga0068862_100000485 3300005844 Bacteria 42458
166 Ga0068862_100004188 3300005844 Bacteria 12217
167 Ga0068862_100005376 3300005844 Bacteria 10718
168 Ga0068862_100005633 3300005844 Bacteria 10458
169 Ga0068862_100012106 3300005844 Bacteria 7128
170 Ga0068862_100018068 3300005844 Bacteria 5873
171 Ga0068862_100030185 3300005844 Bacteria 4568
172 Ga0068862_100032674 3300005844 Bacteria 4397
173 Ga0068862_100059599 3300005844 Bacteria 3278
174 Ga0081455_10002228 3300005937 Bacteria 23082
175 Ga0081539_10018190 3300005985 Bacteria 4891
176 Ga0081539_10019805 3300005985 Bacteria 4584
177 Ga0075368_10000704 3300006042 Bacteria 10189
178 Ga0075367_10000042 3300006178 Bacteria 28460
179 Ga0075366_10004887 3300006195 Bacteria 7230
180 Ga0075366_10012022 3300006195 Bacteria 4903
181 Ga0075370_10024116 3300006353 Bacteria 3357
182 Ga0075430_100018966 3300006846 Bacteria 5853
183 Ga0075431_100007563 3300006847 Bacteria 10816
184 Ga0097620_100002363 3300006931 Bacteria 19203
185 Ga0097620_100004889 3300006931 Bacteria 13646
186 Ga0097620_100006146 3300006931 Bacteria 12204
187 Ga0097620_100013486 3300006931 Bacteria 8195
188 Ga0097620_100020789 3300006931 Bacteria 6588
189 Ga0097620_100027165 3300006931 Bacteria 5743
190 Ga0097620_100109659 3300006931 Bacteria 2821
191 Ga0097620_100169630 3300006931 Bacteria 2263
192 Ga0105251_10001006 3300009011 Bacteria 24692
193 Ga0111539_10000017 3300009094 Bacteria 275456
194 Ga0111539_10029495 3300009094 Bacteria 6681
195 Ga0105245_10002260 3300009098 Bacteria 17440
196 Ga0105247_10004862 3300009101 Bacteria 8547
197 Ga0105247_10016928 3300009101 Bacteria 4372
198 Ga0105243_10000224 3300009148 Bacteria 65196
199 Ga0105241_10097937 3300009174 Bacteria 2326
200 Ga0105248_10000091 3300009177 Bacteria 101191
201 Ga0105248_10000536 3300009177 Bacteria 43208
202 Ga0105248_10003098 3300009177 Bacteria 18437
203 Ga0105248_10008150 3300009177 Bacteria 11507
204 Ga0105248_10009842 3300009177 Bacteria 10530
205 Ga0105248_10025435 3300009177 Bacteria 6582
206 Ga0105248_10036917 3300009177 Bacteria 5465
207 Ga0105237_10050794 3300009545 Bacteria 4166
208 Ga0105238_10047095 3300009551 Bacteria 4349
209 Ga0105238_10062799 3300009551 Bacteria 3715
210 Ga0105249_10000064 3300009553 Bacteria 151646
211 Ga0105249_10000160 3300009553 Bacteria 81883
212 Ga0105249_10000567 3300009553 Bacteria 33975
213 Ga0105249_10017175 3300009553 Bacteria 6423
214 Ga0105249_10025445 3300009553 Bacteria 5328
215 Ga0105249_10040062 3300009553 Bacteria 4255
216 Ga0105249_10064607 3300009553 Bacteria 3365
217 Ga0105239_10113654 3300010375 Bacteria 3002
218 Ga0157326_1000059 3300012513 Bacteria 10517
219 Ga0157373_10009216 3300013100 Bacteria 7299
220 Ga0157371_10000097 3300013102 Bacteria 134150
221 Ga0157369_10025937 3300013105 Bacteria 6504
222 Ga0157378_10003298 3300013297 Bacteria 14370
223 Ga0157378_10094681 3300013297 Bacteria 2720
224 Ga0163162_10035914 3300013306 Bacteria 4937
225 Ga0163162_10048106 3300013306 Bacteria 4273
226 Ga0163162_10085262 3300013306 Bacteria 3235
227 Ga0157372_10214297 3300013307 Bacteria 2232
228 Ga0163163_10000107 3300014325 Bacteria 87926
229 Ga0157380_10000086 3300014326 Bacteria 51604
230 Ga0157380_10000217 3300014326 Bacteria 34251
231 Ga0157380_10003002 3300014326 Bacteria 11489
232 Ga0157380_10003455 3300014326 Bacteria 10849
233 Ga0157380_10013463 3300014326 Bacteria 5963
234 Ga0157380_10051349 3300014326 Bacteria 3261
235 Ga0157379_10009125 3300014968 Bacteria 8637
236 Ga0157379_10065983 3300014968 Bacteria 3235
237 Ga0183363_1001 3300015690 Bacteria 611534
238 Ga0163161_10000110 3300017792 Bacteria 78102
239 Ga0163161_10103664 3300017792 Bacteria 2120
240 Ga0213873_10000015 3300021358 Bacteria 131343
241 Ga0213876_10000005 3300021384 Bacteria 727326
242 Ga0209147_100321 3300025229 Bacteria 36587
243 Ga0209563_100111 3300025230 Bacteria 141123
244 Ga0207425_1000020 3300025245 Bacteria 372623
245 Ga0209646_1004636 3300025246 Bacteria 2482
246 Ga0209148_1000026 3300025254 Bacteria 629213
247 Ga0209129_1000586 3300025258 Bacteria 25017
248 Ga0209233_1000142 3300025261 Bacteria 192193
249 Ga0209565_1000008 3300025263 Bacteria 774179
250 Ga0209565_1000210 3300025263 Bacteria 67800
251 Ga0209455_1000005 3300025272 Bacteria 1416756
252 Ga0209673_1000984 3300025273 Bacteria 34864
253 Ga0209130_1000512 3300025284 Bacteria 39134
254 Ga0209675_1000838 3300025291 Bacteria 20134
255 Ga0209676_1000518 3300025292 Bacteria 60512
256 Ga0209676_1000554 3300025292 Bacteria 56925
257 Ga0209676_1000929 3300025292 Bacteria 36184
258 Ga0209676_1008339 3300025292 Bacteria 4637
259 Ga0209025_1000114 3300025294 Bacteria 218921
260 Ga0209025_1000326 3300025294 Bacteria 106087
261 Ga0209564_1001114 3300025295 Bacteria 31654
262 Ga0209758_1000001 3300025297 Bacteria 1981790
263 Ga0209758_1000004 3300025297 Bacteria 1375322
264 Ga0209758_1001428 3300025297 Bacteria 28251
265 Ga0209758_1017781 3300025297 Bacteria 3517
266 Ga0209050_1000001 3300025298 Bacteria 3563507
267 Ga0209050_1000017 3300025298 Bacteria 728928
268 Ga0209050_1000026 3300025298 Bacteria 499134
269 Ga0209050_1002610 3300025298 Bacteria 14895
270 Ga0209050_1008085 3300025298 Bacteria 5710
271 Ga0209050_1014081 3300025298 Bacteria 3480
272 Ga0209256_1000009 3300025299 Bacteria 922071
273 Ga0209256_1000010 3300025299 Bacteria 912110
274 Ga0207426_1000181 3300025302 Bacteria 158308
275 Ga0209051_1000476 3300025303 Bacteria 51944
276 Ga0209257_1000009 3300025304 Bacteria 1205047
277 Ga0209257_1001405 3300025304 Bacteria 28723
278 Ga0209257_1002894 3300025304 Bacteria 15934
279 Ga0209257_1003790 3300025304 Bacteria 12457
280 Ga0209257_1005509 3300025304 Bacteria 8841
281 Ga0207697_10000211 3300025315 Bacteria 31108
282 Ga0207697_10003297 3300025315 Bacteria 8029
283 Ga0207713_1001151 3300025735 Bacteria 22391
284 Ga0207713_1002611 3300025735 Bacteria 12984
285 Ga0207682_10002080 3300025893 Bacteria 9063
286 Ga0207710_10002208 3300025900 Bacteria 9150
287 Ga0207710_10008695 3300025900 Bacteria 4281
288 Ga0207710_10034094 3300025900 Bacteria 2235
289 Ga0207680_10000009 3300025903 Bacteria 464571
290 Ga0207680_10023993 3300025903 Bacteria 3340
291 Ga0207680_10049495 3300025903 Bacteria 2501
292 Ga0207647_10031699 3300025904 Bacteria 3399
293 Ga0207645_10004405 3300025907 Bacteria 10428
294 Ga0207645_10012931 3300025907 Bacteria 5647
295 Ga0207705_10000450 3300025909 Bacteria 35404
296 Ga0207705_10051400 3300025909 Bacteria 2966
297 Ga0207654_10004079 3300025911 Bacteria 7359
298 Ga0207707_10075179 3300025912 Bacteria 2947
299 Ga0207707_10090256 3300025912 Bacteria 2678
300 Ga0207671_10006655 3300025914 Bacteria 10244
301 Ga0207671_10014738 3300025914 Bacteria 6164
302 Ga0207657_10009966 3300025919 Bacteria 9511
303 Ga0207657_10011805 3300025919 Bacteria 8648
304 Ga0207657_10022107 3300025919 Bacteria 5969
305 Ga0207649_10000178 3300025920 Bacteria 52146
306 Ga0207649_10002255 3300025920 Bacteria 10883
307 Ga0207652_10000282 3300025921 Bacteria 52954
308 Ga0207681_10000008 3300025923 Bacteria 414329
309 Ga0207681_10000014 3300025923 Bacteria 353422
310 Ga0207681_10000106 3300025923 Bacteria 71721
311 Ga0207681_10000259 3300025923 Bacteria 40452
312 Ga0207681_10027414 3300025923 Bacteria 3683
313 Ga0207681_10053593 3300025923 Bacteria 2739
314 Ga0207694_10020172 3300025924 Bacteria 5041
315 Ga0207694_10023064 3300025924 Bacteria 4724
316 Ga0207694_10025520 3300025924 Bacteria 4492
317 Ga0207650_10000015 3300025925 Bacteria 369173
318 Ga0207650_10015218 3300025925 Bacteria 5354
319 Ga0207650_10018925 3300025925 Bacteria 4839
320 Ga0207650_10020051 3300025925 Bacteria 4709
321 Ga0207650_10032859 3300025925 Bacteria 3755
322 Ga0207650_10035934 3300025925 Bacteria 3601
323 Ga0207659_10045306 3300025926 Bacteria 3100
324 Ga0207659_10054702 3300025926 Bacteria 2851
325 Ga0207644_10000006 3300025931 Bacteria 408793
326 Ga0207644_10000544 3300025931 Bacteria 24497
327 Ga0207644_10000574 3300025931 Bacteria 23595
328 Ga0207644_10003236 3300025931 Bacteria 10496
329 Ga0207644_10003746 3300025931 Bacteria 9848
330 Ga0207644_10008789 3300025931 Bacteria 6613
331 Ga0207644_10033072 3300025931 Bacteria 3611
332 Ga0207690_10004587 3300025932 Bacteria 8166
333 Ga0207706_10004467 3300025933 Bacteria 13136
334 Ga0207706_10006993 3300025933 Bacteria 10426
335 Ga0207706_10014593 3300025933 Bacteria 7116
336 Ga0207706_10031363 3300025933 Bacteria 4735
337 Ga0207706_10092745 3300025933 Bacteria 2655
338 Ga0207706_10120023 3300025933 Bacteria 2311
339 Ga0207709_10000519 3300025935 Bacteria 33581
340 Ga0207709_10011498 3300025935 Bacteria 4884
341 Ga0207670_10010660 3300025936 Bacteria 5303
342 Ga0207669_10000161 3300025937 Bacteria 32114
343 Ga0207669_10006712 3300025937 Bacteria 5278
344 Ga0207669_10083879 3300025937 Bacteria 2051
345 Ga0207691_10004823 3300025940 Bacteria 13043
346 Ga0207691_10005772 3300025940 Bacteria 11974
347 Ga0207711_10000017 3300025941 Bacteria 441730
348 Ga0207711_10000252 3300025941 Bacteria 57840
349 Ga0207711_10003251 3300025941 Bacteria 14161
350 Ga0207711_10003634 3300025941 Bacteria 13336
351 Ga0207711_10018314 3300025941 Bacteria 5820
352 Ga0207711_10023381 3300025941 Bacteria 5174
353 Ga0207711_10041275 3300025941 Bacteria 3929
354 Ga0207711_10074113 3300025941 Bacteria 2960
355 Ga0207711_10075264 3300025941 Bacteria 2938
356 Ga0207689_10093863 3300025942 Bacteria 2465
357 Ga0207661_10114574 3300025944 Bacteria 2286
358 Ga0207679_10004610 3300025945 Bacteria 8581
359 Ga0207667_10000010 3300025949 Bacteria 477432
360 Ga0207667_10014565 3300025949 Bacteria 8957
361 Ga0207667_10105697 3300025949 Bacteria 2904
362 Ga0207712_10000008 3300025961 Bacteria 527957
363 Ga0207712_10000044 3300025961 Bacteria 171240
364 Ga0207712_10000222 3300025961 Bacteria 56073
365 Ga0207712_10006379 3300025961 Bacteria 7441
366 Ga0207712_10009432 3300025961 Bacteria 6175
367 Ga0207712_10015834 3300025961 Bacteria 4872
368 Ga0207712_10038733 3300025961 Bacteria 3261
369 Ga0207668_10000012 3300025972 Bacteria 182541
370 Ga0207668_10000629 3300025972 Bacteria 21816
371 Ga0207668_10000860 3300025972 Bacteria 18295
372 Ga0207668_10001683 3300025972 Bacteria 12933
373 Ga0207668_10002528 3300025972 Bacteria 10677
374 Ga0207668_10003159 3300025972 Bacteria 9645
375 Ga0207668_10009770 3300025972 Bacteria 5763
376 Ga0207668_10041715 3300025972 Bacteria 3104
377 Ga0207668_10052374 3300025972 Bacteria 2823
378 Ga0207668_10055215 3300025972 Bacteria 2760
379 Ga0207668_10068228 3300025972 Bacteria 2527
380 Ga0207668_10074452 3300025972 Bacteria 2438
381 Ga0207668_10085580 3300025972 Bacteria 2301
382 Ga0207640_10009509 3300025981 Bacteria 5445
383 Ga0207640_10009819 3300025981 Bacteria 5369
384 Ga0207658_10000011 3300025986 Bacteria 239620
385 Ga0207658_10000089 3300025986 Bacteria 100308
386 Ga0207658_10000132 3300025986 Bacteria 80078
387 Ga0207658_10000133 3300025986 Bacteria 78402
388 Ga0207658_10000291 3300025986 Bacteria 52585
389 Ga0207658_10002473 3300025986 Bacteria 13492
390 Ga0207658_10002564 3300025986 Bacteria 13198
391 Ga0207658_10009504 3300025986 Bacteria 6600
392 Ga0207658_10012206 3300025986 Bacteria 5863
393 Ga0207658_10025815 3300025986 Bacteria 4114
394 Ga0207658_10026771 3300025986 Bacteria 4046
395 Ga0207658_10033271 3300025986 Bacteria 3676
396 Ga0207703_10000691 3300026035 Bacteria 33391
397 Ga0207703_10001013 3300026035 Bacteria 27010
398 Ga0207703_10003167 3300026035 Bacteria 13874
399 Ga0207639_10026227 3300026041 Bacteria 4234
400 Ga0207639_10026739 3300026041 Bacteria 4194
401 Ga0207678_10020460 3300026067 Bacteria 5803
402 Ga0207702_10007378 3300026078 Bacteria 9388
403 Ga0207702_10032064 3300026078 Bacteria 4383
404 Ga0207641_10000001 3300026088 Bacteria 1180841
405 Ga0207641_10000022 3300026088 Bacteria 279334
406 Ga0207641_10000047 3300026088 Bacteria 179977
407 Ga0207641_10000060 3300026088 Bacteria 161514
408 Ga0207641_10001074 3300026088 Bacteria 27484
409 Ga0207641_10002092 3300026088 Bacteria 18889
410 Ga0207641_10004584 3300026088 Bacteria 11938
411 Ga0207641_10006843 3300026088 Bacteria 9546
412 Ga0207641_10016494 3300026088 Bacteria 6049
413 Ga0207641_10018011 3300026088 Bacteria 5788
414 Ga0207676_10000021 3300026095 Bacteria 296572
415 Ga0207676_10000056 3300026095 Bacteria 124484
416 Ga0207676_10000827 3300026095 Bacteria 24173
417 Ga0207676_10000894 3300026095 Bacteria 23124
418 Ga0207676_10001517 3300026095 Bacteria 17145
419 Ga0207676_10002294 3300026095 Bacteria 13722
420 Ga0207674_10007137 3300026116 Bacteria 13050
421 Ga0207674_10069644 3300026116 Bacteria 3538
422 Ga0207674_10084252 3300026116 Bacteria 3177
423 Ga0207675_100000020 3300026118 Bacteria 117374
424 Ga0207675_100000207 3300026118 Bacteria 54791
425 Ga0207675_100002282 3300026118 Bacteria 19053
426 Ga0207675_100004785 3300026118 Bacteria 13038
427 Ga0207675_100084771 3300026118 Bacteria 2973
428 Ga0207675_100150282 3300026118 Bacteria 2216
429 Ga0207683_10000655 3300026121 Bacteria 31727
430 Ga0207683_10033010 3300026121 Bacteria 4496
431 Ga0207698_10051391 3300026142 Bacteria 3151
432 Ga0209813_10000042 3300027866 Bacteria 53213
433 Ga0209813_10000126 3300027866 Bacteria 27944
434 Ga0209974_10003218 3300027876 Bacteria 5903
435 Ga0209974_10003430 3300027876 Bacteria 5723
436 Ga0268266_10000002 3300028379 Bacteria 3059047
437 Ga0268266_10000069 3300028379 Bacteria 239714
438 Ga0268266_10004036 3300028379 Bacteria 14190
439 Ga0268266_10011818 3300028379 Bacteria 7568
440 Ga0268266_10016904 3300028379 Bacteria 6233
441 Ga0268265_10000013 3300028380 Bacteria 341536
442 Ga0268265_10000044 3300028380 Bacteria 182545
443 Ga0268265_10000082 3300028380 Bacteria 120835
444 Ga0268265_10000100 3300028380 Bacteria 108659
445 Ga0268265_10000958 3300028380 Bacteria 26520
446 Ga0268265_10006174 3300028380 Bacteria 8115
447 Ga0268265_10006969 3300028380 Bacteria 7645
448 Ga0268264_10000010 3300028381 Bacteria 596543
449 Ga0268264_10000039 3300028381 Bacteria 376641
450 Ga0268264_10000089 3300028381 Bacteria 234760
451 Ga0268264_10000131 3300028381 Bacteria 181459
452 Ga0268264_10000933 3300028381 Bacteria 30321
453 Ga0268264_10000935 3300028381 Bacteria 30301
454 Ga0268264_10021281 3300028381 Bacteria 5297
455 Ga0268264_10053953 3300028381 Bacteria 3355
456 Ga0307513_10075874 3300031456 Bacteria 3489
457 Ga0307509_10000115 3300031507 Bacteria 116444
458 Ga0307408_100015727 3300031548 Bacteria 5041
459 Ga0307408_100017748 3300031548 Bacteria 4768
460 Ga0307408_100019173 3300031548 Bacteria 4603
461 Ga0307408_100087906 3300031548 Bacteria 2340
462 Ga0307508_10025163 3300031616 Bacteria 5398
463 Ga0307405_10000391 3300031731 Bacteria 16410
464 Ga0307405_10010450 3300031731 Bacteria 4811
465 Ga0307405_10041028 3300031731 Bacteria 2807
466 Ga0307405_10054567 3300031731 Bacteria 2495
467 Ga0307413_10001504 3300031824 Bacteria 8914
468 Ga0307413_10007329 3300031824 Bacteria 5114
469 Ga0307413_10007679 3300031824 Bacteria 5031
470 Ga0307413_10012702 3300031824 Bacteria 4201
471 Ga0307413_10028311 3300031824 Bacteria 3118
472 Ga0307413_10029103 3300031824 Bacteria 3086
473 Ga0307413_10051241 3300031824 Bacteria 2486
474 Ga0307410_10000684 3300031852 Bacteria 14130
475 Ga0307410_10002446 3300031852 Bacteria 8971
476 Ga0307410_10003698 3300031852 Bacteria 7736
477 Ga0307410_10004043 3300031852 Bacteria 7498
478 Ga0307410_10014143 3300031852 Bacteria 4683
479 Ga0307410_10019814 3300031852 Bacteria 4100
480 Ga0307410_10021645 3300031852 Bacteria 3958
481 Ga0307410_10033329 3300031852 Bacteria 3324
482 Ga0307410_10037184 3300031852 Bacteria 3177
483 Ga0307410_10074721 3300031852 Bacteria 2361
484 Ga0307406_10019894 3300031901 Bacteria 3945
485 Ga0307406_10021789 3300031901 Bacteria 3795
486 Ga0307406_10036423 3300031901 Bacteria 3031
487 Ga0307407_10004107 3300031903 Bacteria 6125
488 Ga0307407_10019115 3300031903 Bacteria 3482
489 Ga0307407_10040428 3300031903 Bacteria 2600
490 Ga0307407_10051333 3300031903 Bacteria 2363
491 Ga0307412_10007668 3300031911 Bacteria 6130
492 Ga0307412_10008746 3300031911 Bacteria 5794
493 Ga0307412_10010587 3300031911 Bacteria 5314
494 Ga0307412_10045050 3300031911 Bacteria 2881
495 Ga0307412_10078260 3300031911 Bacteria 2277
496 Ga0307412_10090273 3300031911 Bacteria 2141
497 Ga0307409_100023016 3300031995 Bacteria 4307
498 Ga0307409_100036824 3300031995 Bacteria 3600
499 Ga0307409_100064704 3300031995 Bacteria 2874
500 Ga0307416_100037671 3300032002 Bacteria 3723
501 Ga0307416_100043746 3300032002 Bacteria 3510
502 Ga0307416_100080138 3300032002 Bacteria 2754
503 Ga0307416_100103237 3300032002 Bacteria 2488
504 Ga0307416_100139612 3300032002 Bacteria 2200
505 Ga0307414_10000346 3300032004 Bacteria 26022
506 Ga0307414_10002088 3300032004 Bacteria 10396
507 Ga0307414_10002337 3300032004 Bacteria 9908
508 Ga0307414_10009428 3300032004 Bacteria 5608
509 Ga0307414_10014644 3300032004 Bacteria 4710
510 Ga0307414_10016059 3300032004 Bacteria 4539
511 Ga0307414_10019577 3300032004 Bacteria 4197
512 Ga0307414_10022219 3300032004 Bacteria 3997
513 Ga0307414_10028125 3300032004 Bacteria 3642
514 Ga0307414_10046312 3300032004 Bacteria 2984
515 Ga0307414_10050216 3300032004 Bacteria 2888
516 Ga0307414_10114411 3300032004 Bacteria 2061
517 Ga0307411_10004783 3300032005 Bacteria 6558
518 Ga0307411_10005751 3300032005 Bacteria 6131
519 Ga0307411_10024249 3300032005 Bacteria 3612
520 Ga0307411_10034144 3300032005 Bacteria 3162
521 Ga0307411_10062055 3300032005 Bacteria 2491
522 Ga0307411_10104906 3300032005 Bacteria 2008
523 Ga0307415_100009023 3300032126 Bacteria 5563
524 Ga0307415_100012323 3300032126 Bacteria 4939
525 Ga0307415_100035245 3300032126 Bacteria 3267
526 Ga0307415_100055878 3300032126 Bacteria 2703
527 Ga0307510_10016486 3300033180 Bacteria 8721
528 Ga0307510_10092283 3300033180 Bacteria 2865
529 Ga0373943_0033198 3300035170 Bacteria 2457
530 Ga0373946_0020771 3300035171 Bacteria 2541
531 Ga0373935_0028704 3300035692 Bacteria 3439
532 Ga0395900_0000503 3300037418 Bacteria 54976
533 Ga0395905_0007001 3300037471 Bacteria 11273
534 Ga0395905_0094244 3300037471 Bacteria 2809
535 Ga0395901_0000520 3300038443 Bacteria 44464
536 Ga0395901_0023161 3300038443 Bacteria 6367
537 Ga0436365_1132330 3300039437 Bacteria 76795
538 Ga0436365_1277439 3300039437 Bacteria 2584
539 Ga0436365_1921522 3300039437 Bacteria 4700
540 Ga0436362_0875621 3300039453 Bacteria 35060
541 Ga0439461_0000190 3300041410 Bacteria 8487
542 Ga0439465_0000420 3300041413 Bacteria 12395
543 Ga0439431_0000645 3300041997 Bacteria 7421
544 Ga0439432_018266 3300042006 Bacteria 2344
545 Ga0439449_0014110 3300042007 Bacteria 3006
546 Ga0439462_0000249 3300042015 Bacteria 9622
547 Ga0439462_0001856 3300042015 Bacteria 4796
548 Ga0439434_0000823 3300042435 Bacteria 8928
549 Ga0451576_0000023 3300045051 Bacteria 477965
550 Ga0495627_000158 3300046453 Bacteria 77210
551 Ga0495627_000636 3300046453 Bacteria 27717
552 Ga0495627_001522 3300046453 Bacteria 13320
553 Ga0495629_0033426 3300046459 Bacteria 3638
554 Ga0495638_0002237 3300046460 Bacteria 16075
555 Ga0495650_0000492 3300046471 Bacteria 59983
556 Ga0495650_0008181 3300046471 Bacteria 6147
557 Ga0495650_0012961 3300046471 Bacteria 4445
558 Ga0495662_0027591 3300046476 Bacteria 2743
559 Ga0495596_0000141 3300046500 Bacteria 49474
560 Ga0495596_0007033 3300046500 Bacteria 5112
561 Ga0495583_0002564 3300046506 Bacteria 15303
562 Ga0495583_0010721 3300046506 Bacteria 5318
563 Ga0495583_0016240 3300046506 Bacteria 4013
564 Ga0495606_0000359 3300046507 Bacteria 77863
565 Ga0495610_0000020 3300046512 Bacteria 344007
566 Ga0495610_0000071 3300046512 Bacteria 121210
567 Ga0495610_0002395 3300046512 Bacteria 15792
568 Ga0495610_0005363 3300046512 Bacteria 9148
569 Ga0495610_0021839 3300046512 Bacteria 3512
570 Ga0495610_0031373 3300046512 Bacteria 2773
571 Ga0495620_0031636 3300046515 Bacteria 2422
572 Ga0495632_0000211 3300046519 Bacteria 59066
573 Ga0495637_0014469 3300046520 Bacteria 3723
574 Ga0495643_0000053 3300046522 Bacteria 202031
575 Ga0495643_0000132 3300046522 Bacteria 121567
576 Ga0495643_0004044 3300046522 Bacteria 10460
577 Ga0495643_0004426 3300046522 Bacteria 9829
578 Ga0495643_0019902 3300046522 Bacteria 3879
579 Ga0495648_0000256 3300046524 Bacteria 60519
580 Ga0495663_0000020 3300046525 Bacteria 124560
581 Ga0495663_0001269 3300046525 Bacteria 8015
582 Ga0495654_0001382 3300046530 Bacteria 16825
583 Ga0495640_0027903 3300046533 Bacteria 4067
584 Ga0495609_0005528 3300046538 Bacteria 6604
585 Ga0495621_0005314 3300046539 Bacteria 3691
586 Ga0495633_0000983 3300046558 Bacteria 23405
587 Ga0495633_0001072 3300046558 Bacteria 22116
588 Ga0495633_0002904 3300046558 Bacteria 11752
589 Ga0495633_0020069 3300046558 Bacteria 3367
590 Ga0495668_0000004 3300046616 Bacteria 574236
591 Ga0495668_0000163 3300046616 Bacteria 99607
592 Ga0495668_0002911 3300046616 Bacteria 13507
593 Ga0495668_0015770 3300046616 Bacteria 4405
594 Ga0495668_0061841 3300046616 Bacteria 2064
595 Ga0495668_0067068 3300046616 Bacteria 1974
596 Ga0495634_0031949 3300046642 Bacteria 3623
597 Ga0495625_0000332 3300046660 Bacteria 71947
598 Ga0495625_0000553 3300046660 Bacteria 54796
599 Ga0495625_0000568 3300046660 Bacteria 54059
600 Ga0495625_0043887 3300046660 Bacteria 3239
601 Ga0495625_0055633 3300046660 Bacteria 2821
602 Ga0495669_0000629 3300046684 Bacteria 15335
603 Ga0495670_0000007 3300046691 Bacteria 247088
604 Ga0495671_0000031 3300046692 Bacteria 202030
605 Ga0495589_0008334 3300046794 Bacteria 5416
606 Ga0495600_0000914 3300046809 Bacteria 15826
607 Ga0495674_0068220 3300047319 Bacteria 3078
608 Ga0495687_000511 3300047443 Bacteria 46733
609 Ga0495687_001938 3300047443 Bacteria 17742
610 Ga0495677_0000956 3300047445 Bacteria 11629
611 Ga0495681_0000008 3300047470 Bacteria 215295
612 Ga0495681_0000094 3300047470 Bacteria 77400
613 Ga0495681_0003826 3300047470 Bacteria 10415
614 Ga0495681_0025529 3300047470 Bacteria 3089
615 Ga0495686_0000013 3300047472 Bacteria 489656
616 Ga0495686_0005293 3300047472 Bacteria 10228
617 Ga0495686_0006390 3300047472 Bacteria 9035
618 Ga0495615_0000239 3300048090 Bacteria 11254
619 Ga0495615_0002333 3300048090 Bacteria 3029
620 Ga0496101_0001612 3300048904 Bacteria 13571
621 Ga0496102_0000106 3300048905 Bacteria 118841
622 Ga0496102_0000120 3300048905 Bacteria 112432
623 Ga0496102_0002374 3300048905 Bacteria 16067
624 Ga0496102_0008515 3300048905 Bacteria 8793
625 Ga0496103_0000095 3300048906 Bacteria 98260
626 Ga0496103_0000154 3300048906 Bacteria 72239
627 Ga0496103_0000984 3300048906 Bacteria 20114
628 Ga0496103_0001305 3300048906 Bacteria 16975
629 Ga0496103_0024978 3300048906 Bacteria 3608
630 Ga0496104_0000060 3300048907 Bacteria 117966
631 Ga0496104_0083563 3300048907 Bacteria 3045
632 Ga0496105_0000274 3300048908 Bacteria 34048
633 Ga0496107_0004473 3300048910 Bacteria 9480
634 Ga0496108_0019377 3300048911 Bacteria 5586
635 Ga0496110_0002630 3300048913 Bacteria 13523
636 Ga0496110_0008273 3300048913 Bacteria 8364
637 Ga0496111_0023431 3300048914 Bacteria 4334
638 Ga0496112_0074755 3300048915 Bacteria 3351
639 Ga0496112_0121955 3300048915 Bacteria 2577
640 Ga0496113_0003962 3300048916 Bacteria 8994
641 Ga0496115_0000134 3300048918 Bacteria 67910
642 Ga0496115_0000172 3300048918 Bacteria 59971
643 Ga0496116_0000028 3300048919 Bacteria 424086
644 Ga0496116_0004809 3300048919 Bacteria 12742
645 Ga0496116_0014370 3300048919 Bacteria 6328
646 Ga0496117_0000317 3300048920 Bacteria 84472
647 Ga0496117_0000366 3300048920 Bacteria 78816
648 Ga0496117_0000582 3300048920 Bacteria 60157
649 Ga0496117_0003953 3300048920 Bacteria 16753
650 Ga0496118_0000303 3300048921 Bacteria 85332
651 Ga0496118_0000392 3300048921 Bacteria 74074
652 Ga0496118_0003549 3300048921 Bacteria 19478
653 Ga0496118_0033548 3300048921 Bacteria 4209
654 Ga0496119_0001213 3300048922 Bacteria 32201
655 Ga0496119_0047407 3300048922 Bacteria 2674
656 Ga0496120_0001109 3300048923 Bacteria 35064
657 Ga0496121_0004566 3300048924 Bacteria 18476
658 Ga0496121_0005396 3300048924 Bacteria 16416
659 Ga0496121_0013959 3300048924 Bacteria 8580
660 Ga0496122_0002369 3300048925 Bacteria 26990
661 Ga0496122_0004287 3300048925 Bacteria 17866
662 Ga0496122_0009082 3300048925 Bacteria 10542
663 Ga0496122_0017843 3300048925 Bacteria 6599
664 Ga0496123_0000518 3300048926 Bacteria 67308
665 Ga0496123_0001557 3300048926 Bacteria 31501
666 Ga0496123_0007047 3300048926 Bacteria 10696
667 Ga0496124_0000214 3300048927 Bacteria 113007
668 Ga0496124_0000606 3300048927 Bacteria 60251
669 Ga0496124_0001819 3300048927 Bacteria 29505
670 Ga0496124_0007214 3300048927 Bacteria 11876
671 Ga0496124_0009700 3300048927 Bacteria 9855
672 Ga0496124_0037659 3300048927 Bacteria 4204
673 Ga0496125_0000666 3300048928 Bacteria 57200
674 Ga0496125_0091998 3300048928 Bacteria 2269
675 Ga0496126_0000079 3300048929 Bacteria 222463
676 Ga0496126_0000294 3300048929 Bacteria 106327
677 Ga0496126_0004606 3300048929 Bacteria 16354
678 Ga0501292_000172 3300049515 Bacteria 10490
679 Ga0501294_000303 3300049517 Bacteria 6028
680 Ga0501300_000548 3300049523 Bacteria 5631
681 Ga0501032_0001272 3300049569 Bacteria 20206
682 Ga0501037_0005776 3300049573 Bacteria 9035
683 Ga0501047_0003383 3300049581 Bacteria 15102
684 Ga0501047_0051581 3300049581 Bacteria 3976
685 Ga0501047_0156997 3300049581 Bacteria 2148
686 Ga0501047_0181061 3300049581 Bacteria 1974
687 Ga0501067_0000227 3300049583 Bacteria 31300
688 Ga0501073_0000004 3300049589 Bacteria 261794
689 Ga0501077_0000008 3300049593 Bacteria 106496
690 Ga0501223_000495 3300049663 Bacteria 9553
691 Ga0501223_000734 3300049663 Bacteria 7804
692 Ga0501224_000006 3300049664 Bacteria 149611
693 Ga0501233_000165 3300049668 Bacteria 9518
694 Ga0501249_001926 3300049679 Bacteria 4218
695 Ga0501257_000031 3300049686 Bacteria 40822
696 Ga0501259_002260 3300049688 Bacteria 3158
697 Ga0501261_000301 3300049690 Bacteria 6784
698 Ga0501225_0000845 3300049705 Bacteria 9521
699 Ga0501080_0000654 3300049742 Bacteria 27505
700 Ga0501279_000239 3300049775 Bacteria 7546
701 Ga0501280_000005 3300049776 Bacteria 85174
702 Ga0501280_000342 3300049776 Bacteria 11591
703 Ga0501281_00513 3300049777 Bacteria 3598
704 Ga0501282_000535 3300049778 Bacteria 4462
705 Ga0501283_000937 3300049779 Bacteria 3872
706 Ga0501035_0023615 3300049822 Bacteria 5641
707 Ga0501044_0000868 3300049823 Bacteria 36400
708 Ga0501044_0011325 3300049823 Bacteria 9664
709 nmdc:mga00v17_1761_c1 3300050491 Bacteria 11247
710 nmdc:mga00v17_2745_c1 3300050491 Bacteria 4132
711 nmdc:mga0k408_4871_c1 3300050493 Bacteria 7118
712 nmdc:mga06z11_26_c1 3300050494 Bacteria 64283
713 nmdc:mga04h51_118_c1 3300050495 Bacteria 23239
714 nmdc:mga04h51_22_c1 3300050495 Bacteria 64371
715 nmdc:mga07m45_22923_c1 3300050496 Bacteria 3410
716 nmdc:mga07m45_403_c1 3300050496 Bacteria 17870
717 nmdc:mga07m45_43825_c1 3300050496 Bacteria 2509
718 nmdc:mga0qj67_18352_c1 3300050509 Bacteria 5331
719 nmdc:mga0sz30_1259_c1 3300050516 Bacteria 9051
720 Ga0500643_000001 3300053087 Bacteria 1440111
721 Ga0500643_000030 3300053087 Bacteria 206784
722 Ga0500643_001071 3300053087 Bacteria 16543
723 Ga0500643_001104 3300053087 Bacteria 16160
724 Ga0500643_002047 3300053087 Bacteria 10799
725 Ga0500643_002494 3300053087 Bacteria 9443
726 Ga0500643_002878 3300053087 Bacteria 8571
727 Ga0500643_003295 3300053087 Bacteria 7838
728 Ga0500643_006377 3300053087 Bacteria 4935
729 Ga0500643_009984 3300053087 Bacteria 3577
730 Ga0500643_023246 3300053087 Bacteria 1982
731 Ga0500643_023489 3300053087 Bacteria 1969
732 Ga0500566_0003635 3300053094 Bacteria 9199
733 Ga0500641_0019379 3300053096 Bacteria 2572
734 Ga0500556_0000049 3300053104 Bacteria 122572
735 Ga0500592_000270 3300053116 Bacteria 9225
736 Ga0500592_000280 3300053116 Bacteria 9035
737 Ga0500594_0002630 3300053118 Bacteria 3902
738 Ga0500594_0003469 3300053118 Bacteria 3466
739 Ga0500595_001337 3300053119 Bacteria 13334
740 Ga0500595_022036 3300053119 Bacteria 2264
741 Ga0500597_007055 3300053120 Bacteria 3779
742 Ga0500607_001726 3300053121 Bacteria 18994
743 Ga0500607_002875 3300053121 Bacteria 13266
744 Ga0500608_002406 3300053122 Bacteria 6808
745 Ga0500608_004409 3300053122 Bacteria 5446
746 Ga0500642_0000002 3300053130 Bacteria 795093
747 Ga0500658_0000108 3300053134 Bacteria 38564
748 Ga0500658_0002704 3300053134 Bacteria 6820
749 Ga0500559_0002377 3300053136 Bacteria 9801
750 Ga0500559_0006954 3300053136 Bacteria 5059
751 Ga0500568_0001734 3300053139 Bacteria 13523
752 Ga0500573_0000034 3300053140 Bacteria 113547
753 Ga0500616_0003384 3300053153 Bacteria 12243
754 Ga0500622_0006524 3300053156 Bacteria 6747
755 Ga0500624_000001 3300053157 Bacteria 284974
756 Ga0500624_000024 3300053157 Bacteria 114404
757 Ga0500624_000088 3300053157 Bacteria 47211
758 Ga0500627_0000049 3300053158 Bacteria 58947
759 Ga0500627_0000199 3300053158 Bacteria 17319
760 Ga0500627_0000335 3300053158 Bacteria 12748
761 Ga0500636_0006191 3300053177 Bacteria 6874
762 Ga0500636_0008307 3300053177 Bacteria 6022
763 Ga0500637_0000097 3300053178 Bacteria 31449
764 Ga0500637_0007967 3300053178 Bacteria 5321
765 Ga0500567_000103 3300053723 Bacteria 21300
766 Ga0500625_000029 3300053729 Bacteria 54479
767 Ga0500645_000173 3300053730 Bacteria 50903
768 Ga0500645_000300 3300053730 Bacteria 35408
769 Ga0500645_000452 3300053730 Bacteria 28126
770 Ga0501082_0138497 3300060353 Bacteria 2112
771 2511130117 2510917021 Bacteria 5705459
772 2512642122 2512564014 Bacteria 4639632
773 2600202669 2599185354 Bacteria 4398675
774 2600226475 2599185359 Bacteria 4772316
775 2643726851 2643221541 Bacteria 5498788
776 2643820085 2643221560 Bacteria 4801179
777 2643836386 2643221563 Bacteria 4726935
778 2644040865 2643221605 Bacteria 4772303
779 2644046108 2643221606 Bacteria 5588032
780 2644052862 2643221608 Bacteria 4724829
781 2644128894 2643221622 Bacteria 4212502
782 2644393081 2643221671 Bacteria 5496681
783 2738712570 2738541275 Bacteria 4830863
784 2738850994 2738541301 Bacteria 4834102
785 2738866724 2738541304 Bacteria 4833665
786 2739299241 2738543022 Bacteria 4835059
787 2739360920 2738543033 Bacteria 4833336
788 2739650373 2739367664 Bacteria 4114334
789 2740028846 2739367865 Bacteria 4114482
790 2753764454 2751185897 Bacteria 5322941
791 2809063651 2808606401 Bacteria 4586670
792 2809079731 2808606404 Bacteria 4652788
793 2809084096 2808606405 Bacteria 4586632
794 2819553163 2818991438 Bacteria 5793701
795 2819712544 2818991466 Bacteria 4748179
796 2821449023 2821443989 Bacteria 7658172
797 2830077115 2830075706 Bacteria 3855215
798 2844536020 2844533157 Bacteria 7517899
799 2852653986 2852653556 Bacteria 4050083
800 2852683260 2852680915 Bacteria 4100189
801 2879166644 2879163058 Bacteria 4223965
802 2880519420 2880518877 Bacteria 5012590
803 2882808374 2882806704 Bacteria 3007728
804 2885428352 2885427238 Bacteria 2291351
805 2895882645 2895880812 Bacteria 11255272
806 2896430231 2896429255 Bacteria 2557483
807 2919711158 2919709256 Bacteria 4318106
808 2928030895 2928027323 Bacteria 4382488
809 2928103878 2928100450 Bacteria 4837635
810 2928527137 2928526807 Bacteria 4760224
811 2928961807 2928959182 Bacteria 4725774
812 2928969377 2928968154 Bacteria 4633371
813 2946788831 2946787523 Bacteria 4366789
814 2984557867 2984555340 Bacteria 4247089
815 2984567767 2984564862 Bacteria 4339992
816 2993358819 2993356040 Bacteria 4247105
817 8054304792 8054302542 Bacteria 5698134
818 Ga0496122_0001187
819 SwRhRL2b_contig_3540226
820 SwRhRL2b_contig_3705000
821 JGI24736J21556_1000121
822 JGI24752J21851_1000155
823 JGI24752J21851_1000461
824 JGI24737J22298_10003404
825 JGI24735J21928_10000918
826 JGI24750J21931_1000359
827 JGI24748J21848_1000044
828 JGI24749J21850_1000330
829 JGI24749J21850_1000531
830 JGI24034J26672_10000020
831 JGI24742J22300_10001043
832 JGI24751J29686_10000052
833 JGI25150J39212_1000046
834 JGI25159J45721_1007784
835 JGI25151J46595_10001638
836 JGI25165J46597_1000073
837 JGI25153J46596_10000006
838 JGI25153J46596_10000124
839 Ga0055525_1000090
840 Ga0055542_1000046
841 Ga0055529_1000007
842 Ga0055529_1000109
843 Ga0055526_1007061
844 Ga0055524_1001907
845 Ga0055536_1003381
846 Ga0055536_1006713
847 Ga0055536_1008867
848 Ga0055530_10001655
849 Ga0055530_10002492
850 Ga0055530_10013862
851 Ga0055540_1003937
852 Ga0055531_10000008
853 Ga0055531_10001714
854 Ga0055531_10001722
855 Ga0055531_10009693
856 Ga0065165_1001443
857 Ga0065165_1002698
858 Ga0065704_10000191
859 Ga0065704_10070744
860 Ga0065704_10081289
861 Ga0065704_10100052
862 Ga0065715_10000978
863 Ga0065707_10081865
864 Ga0065707_10086251
865 Ga0070658_10000227
866 Ga0070658_10024952
867 Ga0070676_10007834
868 Ga0070690_100000180
869 Ga0070670_100000024
870 Ga0070670_100000792
871 Ga0070670_100003165
872 Ga0070670_100005522
873 Ga0070670_100032156
874 Ga0070670_100052533
875 Ga0070670_100087376
876 Ga0070677_10001757
877 Ga0070666_10000027
878 Ga0070666_10000352
879 Ga0070666_10010284
880 Ga0070666_10029018
881 Ga0070660_100004165
882 Ga0070689_100008132
883 Ga0070661_100000010
884 Ga0070661_100002364
885 Ga0070661_100015823
886 Ga0070661_100026844
887 Ga0070668_100000027
888 Ga0070668_100000068
889 Ga0070668_100000646
890 Ga0070668_100004087
891 Ga0070668_100019269
892 Ga0070668_100019894
893 Ga0070668_100066155
894 Ga0070669_100000018
895 Ga0070669_100000047
896 Ga0070669_100000099
897 Ga0070669_100001232
898 Ga0070669_100016595
899 Ga0070669_100021839
900 Ga0070675_100004161
901 Ga0070675_100012526
902 Ga0070675_100023281
903 Ga0070671_100000011
904 Ga0070671_100000353
905 Ga0070671_100001241
906 Ga0070671_100004632
907 Ga0070671_100008988
908 Ga0070673_100029291
909 Ga0070673_100032493
910 Ga0070688_100000293
911 Ga0070659_100013031
912 Ga0070667_100000017
913 Ga0070667_100000066
914 Ga0070667_100000067
915 Ga0070667_100000290
916 Ga0070667_100000459
917 Ga0070667_100000480
918 Ga0070667_100001292
919 Ga0070667_100011712
920 Ga0070667_100012620
921 Ga0070667_100019588
922 Ga0070678_100000076
923 Ga0070662_100005311
924 Ga0070662_100058572
925 Ga0070681_10089493
926 Ga0070685_10000238
927 Ga0070679_100000168
928 Ga0070679_100165301
929 Ga0068853_100002669
930 Ga0068853_100020182
931 Ga0070672_100003237
932 Ga0070686_100000010
933 Ga0070695_100075744
934 Ga0070665_100000086
935 Ga0070665_100000254
936 Ga0070665_100002933
937 Ga0070665_100013328
938 Ga0070665_100015010
939 Ga0070664_100009278
940 Ga0070664_100090692
941 Ga0068854_100013256
942 Ga0068852_100034615
943 Ga0068852_100156023
944 Ga0068859_100002363
945 Ga0068859_100004889
946 Ga0068859_100006146
947 Ga0068859_100013485
948 Ga0068859_100020790
949 Ga0068859_100027164
950 Ga0068859_100109660
951 Ga0068859_100169626
952 Ga0068864_100000036
953 Ga0068864_100000063
954 Ga0068864_100001646
955 Ga0068864_100003044
956 Ga0068861_100000005
957 Ga0068861_100002905
958 Ga0068861_100007125
959 Ga0068861_100013995
960 Ga0068863_100000001
961 Ga0068863_100000038
962 Ga0068863_100000062
963 Ga0068863_100000603
964 Ga0068863_100000775
965 Ga0068863_100003283
966 Ga0068863_100006015
967 Ga0068863_100006939
968 Ga0068863_100008950
969 Ga0068863_100010531
970 Ga0068863_100011823
971 Ga0068858_100000103
972 Ga0068858_100000530
973 Ga0068858_100000777
974 Ga0068858_100003512
975 Ga0068860_100000013
976 Ga0068860_100000056
977 Ga0068860_100000080
978 Ga0068860_100024655
979 Ga0068862_100000033
980 Ga0068862_100000069
981 Ga0068862_100000115
982 Ga0068862_100000485
983 Ga0068862_100004188
984 Ga0068862_100005376
985 Ga0068862_100005633
986 Ga0068862_100012106
987 Ga0068862_100018068
988 Ga0068862_100030185
989 Ga0068862_100032674
990 Ga0068862_100059599
991 Ga0081455_10002228
992 Ga0081539_10018190
993 Ga0081539_10019805
994 Ga0075368_10000704
995 Ga0075367_10000042
996 Ga0075366_10004887
997 Ga0075366_10012022
998 Ga0075370_10024116
999 Ga0075430_100018966
1000 Ga0075431_100007563
1001 Ga0097620_100002363
1002 Ga0097620_100004889
1003 Ga0097620_100006146
1004 Ga0097620_100013486
1005 Ga0097620_100020789
1006 Ga0097620_100027165
1007 Ga0097620_100109659
1008 Ga0097620_100169630
1009 Ga0105251_10001006
1010 Ga0111539_10000017
1011 Ga0111539_10029495
1012 Ga0105245_10002260
1013 Ga0105247_10004862
1014 Ga0105247_10016928
1015 Ga0105243_10000224
1016 Ga0105241_10097937
1017 Ga0105248_10000091
1018 Ga0105248_10000536
1019 Ga0105248_10003098
1020 Ga0105248_10008150
1021 Ga0105248_10009842
1022 Ga0105248_10025435
1023 Ga0105248_10036917
1024 Ga0105237_10050794
1025 Ga0105238_10047095
1026 Ga0105238_10062799
1027 Ga0105249_10000064
1028 Ga0105249_10000160
1029 Ga0105249_10000567
1030 Ga0105249_10017175
1031 Ga0105249_10025445
1032 Ga0105249_10040062
1033 Ga0105249_10064607
1034 Ga0105239_10113654
1035 Ga0157326_1000059
1036 Ga0157373_10009216
1037 Ga0157371_10000097
1038 Ga0157369_10025937
1039 Ga0157378_10003298
1040 Ga0157378_10094681
1041 Ga0163162_10035914
1042 Ga0163162_10048106
1043 Ga0163162_10085262
1044 Ga0157372_10214297
1045 Ga0163163_10000107
1046 Ga0157380_10000086
1047 Ga0157380_10000217
1048 Ga0157380_10003002
1049 Ga0157380_10003455
1050 Ga0157380_10013463
1051 Ga0157380_10051349
1052 Ga0157379_10009125
1053 Ga0157379_10065983
1054 Ga0183363_1001
1055 Ga0163161_10000110
1056 Ga0163161_10103664
1057 Ga0213873_10000015
1058 Ga0213876_10000005
1059 Ga0209147_100321
1060 Ga0209563_100111
1061 Ga0207425_1000020
1062 Ga0209646_1004636
1063 Ga0209148_1000026
1064 Ga0209129_1000586
1065 Ga0209233_1000142
1066 Ga0209565_1000008
1067 Ga0209565_1000210
1068 Ga0209455_1000005
1069 Ga0209673_1000984
1070 Ga0209130_1000512
1071 Ga0209675_1000838
1072 Ga0209676_1000518
1073 Ga0209676_1000554
1074 Ga0209676_1000929
1075 Ga0209676_1008339
1076 Ga0209025_1000114
1077 Ga0209025_1000326
1078 Ga0209564_1001114
1079 Ga0209758_1000001
1080 Ga0209758_1000004
1081 Ga0209758_1001428
1082 Ga0209758_1017781
1083 Ga0209050_1000001
1084 Ga0209050_1000017
1085 Ga0209050_1000026
1086 Ga0209050_1002610
1087 Ga0209050_1008085
1088 Ga0209050_1014081
1089 Ga0209256_1000009
1090 Ga0209256_1000010
1091 Ga0207426_1000181
1092 Ga0209051_1000476
1093 Ga0209257_1000009
1094 Ga0209257_1001405
1095 Ga0209257_1002894
1096 Ga0209257_1003790
1097 Ga0209257_1005509
1098 Ga0207697_10000211
1099 Ga0207697_10003297
1100 Ga0207713_1001151
1101 Ga0207713_1002611
1102 Ga0207682_10002080
1103 Ga0207710_10002208
1104 Ga0207710_10008695
1105 Ga0207710_10034094
1106 Ga0207680_10000009
1107 Ga0207680_10023993
1108 Ga0207680_10049495
1109 Ga0207647_10031699
1110 Ga0207645_10004405
1111 Ga0207645_10012931
1112 Ga0207705_10000450
1113 Ga0207705_10051400
1114 Ga0207654_10004079
1115 Ga0207707_10075179
1116 Ga0207707_10090256
1117 Ga0207671_10006655
1118 Ga0207671_10014738
1119 Ga0207657_10009966
1120 Ga0207657_10011805
1121 Ga0207657_10022107
1122 Ga0207649_10000178
1123 Ga0207649_10002255
1124 Ga0207652_10000282
1125 Ga0207681_10000008
1126 Ga0207681_10000014
1127 Ga0207681_10000106
1128 Ga0207681_10000259
1129 Ga0207681_10027414
1130 Ga0207681_10053593
1131 Ga0207694_10020172
1132 Ga0207694_10023064
1133 Ga0207694_10025520
1134 Ga0207650_10000015
1135 Ga0207650_10015218
1136 Ga0207650_10018925
1137 Ga0207650_10020051
1138 Ga0207650_10032859
1139 Ga0207650_10035934
1140 Ga0207659_10045306
1141 Ga0207659_10054702
1142 Ga0207644_10000006
1143 Ga0207644_10000544
1144 Ga0207644_10000574
1145 Ga0207644_10003236
1146 Ga0207644_10003746
1147 Ga0207644_10008789
1148 Ga0207644_10033072
1149 Ga0207690_10004587
1150 Ga0207706_10004467
1151 Ga0207706_10006993
1152 Ga0207706_10014593
1153 Ga0207706_10031363
1154 Ga0207706_10092745
1155 Ga0207706_10120023
1156 Ga0207709_10000519
1157 Ga0207709_10011498
1158 Ga0207670_10010660
1159 Ga0207669_10000161
1160 Ga0207669_10006712
1161 Ga0207669_10083879
1162 Ga0207691_10004823
1163 Ga0207691_10005772
1164 Ga0207711_10000017
1165 Ga0207711_10000252
1166 Ga0207711_10003251
1167 Ga0207711_10003634
1168 Ga0207711_10018314
1169 Ga0207711_10023381
1170 Ga0207711_10041275
1171 Ga0207711_10074113
1172 Ga0207711_10075264
1173 Ga0207689_10093863
1174 Ga0207661_10114574
1175 Ga0207679_10004610
1176 Ga0207667_10000010
1177 Ga0207667_10014565
1178 Ga0207667_10105697
1179 Ga0207712_10000008
1180 Ga0207712_10000044
1181 Ga0207712_10000222
1182 Ga0207712_10006379
1183 Ga0207712_10009432
1184 Ga0207712_10015834
1185 Ga0207712_10038733
1186 Ga0207668_10000012
1187 Ga0207668_10000629
1188 Ga0207668_10000860
1189 Ga0207668_10001683
1190 Ga0207668_10002528
1191 Ga0207668_10003159
1192 Ga0207668_10009770
1193 Ga0207668_10041715
1194 Ga0207668_10052374
1195 Ga0207668_10055215
1196 Ga0207668_10068228
1197 Ga0207668_10074452
1198 Ga0207668_10085580
1199 Ga0207640_10009509
1200 Ga0207640_10009819
1201 Ga0207658_10000011
1202 Ga0207658_10000089
1203 Ga0207658_10000132
1204 Ga0207658_10000133
1205 Ga0207658_10000291
1206 Ga0207658_10002473
1207 Ga0207658_10002564
1208 Ga0207658_10009504
1209 Ga0207658_10012206
1210 Ga0207658_10025815
1211 Ga0207658_10026771
1212 Ga0207658_10033271
1213 Ga0207703_10000691
1214 Ga0207703_10001013
1215 Ga0207703_10003167
1216 Ga0207639_10026227
1217 Ga0207639_10026739
1218 Ga0207678_10020460
1219 Ga0207702_10007378
1220 Ga0207702_10032064
1221 Ga0207641_10000001
1222 Ga0207641_10000022
1223 Ga0207641_10000047
1224 Ga0207641_10000060
1225 Ga0207641_10001074
1226 Ga0207641_10002092
1227 Ga0207641_10004584
1228 Ga0207641_10006843
1229 Ga0207641_10016494
1230 Ga0207641_10018011
1231 Ga0207676_10000021
1232 Ga0207676_10000056
1233 Ga0207676_10000827
1234 Ga0207676_10000894
1235 Ga0207676_10001517
1236 Ga0207676_10002294
1237 Ga0207674_10007137
1238 Ga0207674_10069644
1239 Ga0207674_10084252
1240 Ga0207675_100000020
1241 Ga0207675_100000207
1242 Ga0207675_100002282
1243 Ga0207675_100004785
1244 Ga0207675_100084771
1245 Ga0207675_100150282
1246 Ga0207683_10000655
1247 Ga0207683_10033010
1248 Ga0207698_10051391
1249 Ga0209813_10000042
1250 Ga0209813_10000126
1251 Ga0209974_10003218
1252 Ga0209974_10003430
1253 Ga0268266_10000002
1254 Ga0268266_10000069
1255 Ga0268266_10004036
1256 Ga0268266_10011818
1257 Ga0268266_10016904
1258 Ga0268265_10000013
1259 Ga0268265_10000044
1260 Ga0268265_10000082
1261 Ga0268265_10000100
1262 Ga0268265_10000958
1263 Ga0268265_10006174
1264 Ga0268265_10006969
1265 Ga0268264_10000010
1266 Ga0268264_10000039
1267 Ga0268264_10000089
1268 Ga0268264_10000131
1269 Ga0268264_10000933
1270 Ga0268264_10000935
1271 Ga0268264_10021281
1272 Ga0268264_10053953
1273 Ga0307513_10075874
1274 Ga0307509_10000115
1275 Ga0307408_100015727
1276 Ga0307408_100017748
1277 Ga0307408_100019173
1278 Ga0307408_100087906
1279 Ga0307508_10025163
1280 Ga0307405_10000391
1281 Ga0307405_10010450
1282 Ga0307405_10041028
1283 Ga0307405_10054567
1284 Ga0307413_10001504
1285 Ga0307413_10007329
1286 Ga0307413_10007679
1287 Ga0307413_10012702
1288 Ga0307413_10028311
1289 Ga0307413_10029103
1290 Ga0307413_10051241
1291 Ga0307410_10000684
1292 Ga0307410_10002446
1293 Ga0307410_10003698
1294 Ga0307410_10004043
1295 Ga0307410_10014143
1296 Ga0307410_10019814
1297 Ga0307410_10021645
1298 Ga0307410_10033329
1299 Ga0307410_10037184
1300 Ga0307410_10074721
1301 Ga0307406_10019894
1302 Ga0307406_10021789
1303 Ga0307406_10036423
1304 Ga0307407_10004107
1305 Ga0307407_10019115
1306 Ga0307407_10040428
1307 Ga0307407_10051333
1308 Ga0307412_10007668
1309 Ga0307412_10008746
1310 Ga0307412_10010587
1311 Ga0307412_10045050
1312 Ga0307412_10078260
1313 Ga0307412_10090273
1314 Ga0307409_100023016
1315 Ga0307409_100036824
1316 Ga0307409_100064704
1317 Ga0307416_100037671
1318 Ga0307416_100043746
1319 Ga0307416_100080138
1320 Ga0307416_100103237
1321 Ga0307416_100139612
1322 Ga0307414_10000346
1323 Ga0307414_10002088
1324 Ga0307414_10002337
1325 Ga0307414_10009428
1326 Ga0307414_10014644
1327 Ga0307414_10016059
1328 Ga0307414_10019577
1329 Ga0307414_10022219
1330 Ga0307414_10028125
1331 Ga0307414_10046312
1332 Ga0307414_10050216
1333 Ga0307414_10114411
1334 Ga0307411_10004783
1335 Ga0307411_10005751
1336 Ga0307411_10024249
1337 Ga0307411_10034144
1338 Ga0307411_10062055
1339 Ga0307411_10104906
1340 Ga0307415_100009023
1341 Ga0307415_100012323
1342 Ga0307415_100035245
1343 Ga0307415_100055878
1344 Ga0307510_10016486
1345 Ga0307510_10092283
1346 Ga0373943_0033198
1347 Ga0373946_0020771
1348 Ga0373935_0028704
1349 Ga0395900_0000503
1350 Ga0395905_0007001
1351 Ga0395905_0094244
1352 Ga0395901_0000520
1353 Ga0395901_0023161
1354 Ga0436365_1132330
1355 Ga0436365_1277439
1356 Ga0436365_1921522
1357 Ga0436362_0875621
1358 Ga0439461_0000190
1359 Ga0439465_0000420
1360 Ga0439431_0000645
1361 Ga0439432_018266
1362 Ga0439449_0014110
1363 Ga0439462_0000249
1364 Ga0439462_0001856
1365 Ga0439434_0000823
1366 Ga0451576_0000023
1367 Ga0495627_000158
1368 Ga0495627_000636
1369 Ga0495627_001522
1370 Ga0495629_0033426
1371 Ga0495638_0002237
1372 Ga0495650_0000492
1373 Ga0495650_0008181
1374 Ga0495650_0012961
1375 Ga0495662_0027591
1376 Ga0495596_0000141
1377 Ga0495596_0007033
1378 Ga0495583_0002564
1379 Ga0495583_0010721
1380 Ga0495583_0016240
1381 Ga0495606_0000359
1382 Ga0495610_0000020
1383 Ga0495610_0000071
1384 Ga0495610_0002395
1385 Ga0495610_0005363
1386 Ga0495610_0021839
1387 Ga0495610_0031373
1388 Ga0495620_0031636
1389 Ga0495632_0000211
1390 Ga0495637_0014469
1391 Ga0495643_0000053
1392 Ga0495643_0000132
1393 Ga0495643_0004044
1394 Ga0495643_0004426
1395 Ga0495643_0019902
1396 Ga0495648_0000256
1397 Ga0495663_0000020
1398 Ga0495663_0001269
1399 Ga0495654_0001382
1400 Ga0495640_0027903
1401 Ga0495609_0005528
1402 Ga0495621_0005314
1403 Ga0495633_0000983
1404 Ga0495633_0001072
1405 Ga0495633_0002904
1406 Ga0495633_0020069
1407 Ga0495668_0000004
1408 Ga0495668_0000163
1409 Ga0495668_0002911
1410 Ga0495668_0015770
1411 Ga0495668_0061841
1412 Ga0495668_0067068
1413 Ga0495634_0031949
1414 Ga0495625_0000332
1415 Ga0495625_0000553
1416 Ga0495625_0000568
1417 Ga0495625_0043887
1418 Ga0495625_0055633
1419 Ga0495669_0000629
1420 Ga0495670_0000007
1421 Ga0495671_0000031
1422 Ga0495589_0008334
1423 Ga0495600_0000914
1424 Ga0495674_0068220
1425 Ga0495687_000511
1426 Ga0495687_001938
1427 Ga0495677_0000956
1428 Ga0495681_0000008
1429 Ga0495681_0000094
1430 Ga0495681_0003826
1431 Ga0495681_0025529
1432 Ga0495686_0000013
1433 Ga0495686_0005293
1434 Ga0495686_0006390
1435 Ga0495615_0000239
1436 Ga0495615_0002333
1437 Ga0496101_0001612
1438 Ga0496102_0000106
1439 Ga0496102_0000120
1440 Ga0496102_0002374
1441 Ga0496102_0008515
1442 Ga0496103_0000095
1443 Ga0496103_0000154
1444 Ga0496103_0000984
1445 Ga0496103_0001305
1446 Ga0496103_0024978
1447 Ga0496104_0000060
1448 Ga0496104_0083563
1449 Ga0496105_0000274
1450 Ga0496107_0004473
1451 Ga0496108_0019377
1452 Ga0496110_0002630
1453 Ga0496110_0008273
1454 Ga0496111_0023431
1455 Ga0496112_0074755
1456 Ga0496112_0121955
1457 Ga0496113_0003962
1458 Ga0496115_0000134
1459 Ga0496115_0000172
1460 Ga0496116_0000028
1461 Ga0496116_0004809
1462 Ga0496116_0014370
1463 Ga0496117_0000317
1464 Ga0496117_0000366
1465 Ga0496117_0000582
1466 Ga0496117_0003953
1467 Ga0496118_0000303
1468 Ga0496118_0000392
1469 Ga0496118_0003549
1470 Ga0496118_0033548
1471 Ga0496119_0001213
1472 Ga0496119_0047407
1473 Ga0496120_0001109
1474 Ga0496121_0004566
1475 Ga0496121_0005396
1476 Ga0496121_0013959
1477 Ga0496122_0002369
1478 Ga0496122_0004287
1479 Ga0496122_0009082
1480 Ga0496122_0017843
1481 Ga0496123_0000518
1482 Ga0496123_0001557
1483 Ga0496123_0007047
1484 Ga0496124_0000214
1485 Ga0496124_0000606
1486 Ga0496124_0001819
1487 Ga0496124_0007214
1488 Ga0496124_0009700
1489 Ga0496124_0037659
1490 Ga0496125_0000666
1491 Ga0496125_0091998
1492 Ga0496126_0000079
1493 Ga0496126_0000294
1494 Ga0496126_0004606
1495 Ga0501292_000172
1496 Ga0501294_000303
1497 Ga0501300_000548
1498 Ga0501032_0001272
1499 Ga0501037_0005776
1500 Ga0501047_0003383
1501 Ga0501047_0051581
1502 Ga0501047_0156997
1503 Ga0501047_0181061
1504 Ga0501067_0000227
1505 Ga0501073_0000004
1506 Ga0501077_0000008
1507 Ga0501223_000495
1508 Ga0501223_000734
1509 Ga0501224_000006
1510 Ga0501233_000165
1511 Ga0501249_001926
1512 Ga0501257_000031
1513 Ga0501259_002260
1514 Ga0501261_000301
1515 Ga0501225_0000845
1516 Ga0501080_0000654
1517 Ga0501279_000239
1518 Ga0501280_000005
1519 Ga0501280_000342
1520 Ga0501281_00513
1521 Ga0501282_000535
1522 Ga0501283_000937
1523 Ga0501035_0023615
1524 Ga0501044_0000868
1525 Ga0501044_0011325
1526 nmdc:mga00v17_1761_c1
1527 nmdc:mga00v17_2745_c1
1528 nmdc:mga0k408_4871_c1
1529 nmdc:mga06z11_26_c1
1530 nmdc:mga04h51_118_c1
1531 nmdc:mga04h51_22_c1
1532 nmdc:mga07m45_22923_c1
1533 nmdc:mga07m45_403_c1
1534 nmdc:mga07m45_43825_c1
1535 nmdc:mga0qj67_18352_c1
1536 nmdc:mga0sz30_1259_c1
1537 Ga0500643_000001
1538 Ga0500643_000030
1539 Ga0500643_001071
1540 Ga0500643_001104
1541 Ga0500643_002047
1542 Ga0500643_002494
1543 Ga0500643_002878
1544 Ga0500643_003295
1545 Ga0500643_006377
1546 Ga0500643_009984
1547 Ga0500643_023246
1548 Ga0500643_023489
1549 Ga0500566_0003635
1550 Ga0500641_0019379
1551 Ga0500556_0000049
1552 Ga0500592_000270
1553 Ga0500592_000280
1554 Ga0500594_0002630
1555 Ga0500594_0003469
1556 Ga0500595_001337
1557 Ga0500595_022036
1558 Ga0500597_007055
1559 Ga0500607_001726
1560 Ga0500607_002875
1561 Ga0500608_002406
1562 Ga0500608_004409
1563 Ga0500642_0000002
1564 Ga0500658_0000108
1565 Ga0500658_0002704
1566 Ga0500559_0002377
1567 Ga0500559_0006954
1568 Ga0500568_0001734
1569 Ga0500573_0000034
1570 Ga0500616_0003384
1571 Ga0500622_0006524
1572 Ga0500624_000001
1573 Ga0500624_000024
1574 Ga0500624_000088
1575 Ga0500627_0000049
1576 Ga0500627_0000199
1577 Ga0500627_0000335
1578 Ga0500636_0006191
1579 Ga0500636_0008307
1580 Ga0500637_0000097
1581 Ga0500637_0007967
1582 Ga0500567_000103
1583 Ga0500625_000029
1584 Ga0500645_000173
1585 Ga0500645_000300
1586 Ga0500645_000452
1587 Ga0501082_0138497
1588 2511130117
1589 2512642122
1590 2600202669
1591 2600226475
1592 2643726851
1593 2643820085
1594 2643836386
1595 2644040865
1596 2644046108
1597 2644052862
1598 2644128894
1599 2644393081
1600 2738712570
1601 2738850994
1602 2738866724
1603 2739299241
1604 2739360920
1605 2739650373
1606 2740028846
1607 2753764454
1608 2809063651
1609 2809079731
1610 2809084096
1611 2819553163
1612 2819712544
1613 2821449023
1614 2830077115
1615 2844536020
1616 2852653986
1617 2852683260
1618 2879166644
1619 2880519420
1620 2882808374
1621 2885428352
1622 2895882645
1623 2896430231
1624 2919711158
1625 2928030895
1626 2928103878
1627 2928527137
1628 2928961807
1629 2928969377
1630 2946788831
1631 2984557867
1632 2984567767
1633 2993358819
1634 8054304792

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01401

Peptidase_M2

Angiotensin-converting enzyme

34

634

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ydm-assembly1.cif.gz_A structural characterization of angiotensin-i converting enzyme in complex with a selenium analogue of captopril 0.9533 11 588
3bkl-assembly1.cif.gz_A testis ace co-crystal structure with ketone ace inhibitor kaw 0.9531 11 588
2iux-assembly1.cif.gz_A human tace mutant g1234 0.953 11 588
2oc2-assembly1.cif.gz_A structure of testis ace with rxpa380 0.9526 13 588
4bzr-assembly1.cif.gz_A human testis angiotensin converting enzyme in complex with k-26 0.9521 11 588
ID Description Score Start End Superfamily
af_P09470_45_628_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9489 11 588 1.10.1370.30
af_Q10714_28_605_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9481 19 587 1.10.1370.30
af_P09470_45_628_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9377 11 588 1.10.1370.30
af_Q10714_28_605_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9321 19 587 1.10.1370.30
af_Q8SXX2_207_793_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.8694 13 588 1.10.1370.30
ID Description Score Start End GO Terms
AF-A0A4Q2XDG7-F1-model_v4 deleted 0.9973 118 547
AF-A0A2R7PLK0-F1-model_v4 deleted 0.9965 195 546
AF-A0A3D2LH96-F1-model_v4 deleted 0.9943 176 495
AF-A0A4Q2YYI3-F1-model_v4 Peptidase M2 family protein 0.9941 11 588 GO:0006508
GO:0008237
GO:0008241
GO:0016020
AF-A0A520JBP9-F1-model_v4 Peptidase M2 family protein 0.9937 252 588 GO:0006508
GO:0008237
GO:0008241
GO:0016020

Map