F482109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 817 | 363 | 1634 | 599 |
Family's Representative Sequence
| Representative Sequence | 3300048925|Ga0496122_0001187|Ga0496122_0001187_16293_18197 |
| Length | 634 |
| Sequence | MTITISRFALAAALAFGTAGGGIAHAEVAQASGAPTAAQAQAFVDAAEKESYDFSLDSSRVQWINATNITDDTDAVAAKFGAQYTEMSVRFAKEAAKYATVPGLSAELRRKLDMFRSGIVLPAPTTPGAAAELNQIATKLQSDYGKGMGKLDGKPINGSDIEAEMGALGHTPAQYQEMWTSWHDQVGKPMKADYARLVEIANQGAKELGFADTGAMWRSGYDMPPEQFAALTEKIWQEVKPLYDALHCYTRTKLNEKYGDAVQAKTGPIRADLLGNMWAQEWGNIYPLVAPKGAGDLGYDIGDLLVAKGFKQTTPAMFDTSDTPETQRRGYWEKQMFKIGEGFYSSLGFEPLPASFWERTQFIKPRDREVVCHASAWDLDNKNDIRVKMCTKVNSDDFITIHHELGHNYYQRAYQKQDPIYLNGANDGFHEAIGDFIALSITPQYLVDIKLLDPAKVPSADKDIGLLLRQAMDKVAFLPFGLLIDRWRWGVFDGSIKPADYNKAWTDMRLQYQGIVPPVDRPADAFDAGAKYHVPGNTPYTRYFLARVLQFQFYEAACKQAGWKGPLHRCSFYGNKDVGAKLNQMLEMGASKPWPDALQTFTGSREMSGKALIAYFAPLKKWLDQQNKGKACGW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 199 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 200 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 201 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 254 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 261 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 262 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 274 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 279 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 280 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 281 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 282 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 287 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 297 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 298 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 299 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 300 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 301 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 313 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 314 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 315 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 318 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 319 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 320 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 321 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 322 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 323 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 324 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 325 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 326 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 327 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 328 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 329 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 330 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 331 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 332 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 333 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 334 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 335 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 336 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 337 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 338 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 339 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 340 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 341 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 342 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 343 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 344 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 345 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 346 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 347 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 348 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 349 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 350 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 351 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 352 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 353 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 354 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 355 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 356 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 357 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 358 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 359 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 360 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 361 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 362 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 363 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.25 |
| Metatranscriptomes | 0 |
| Isolates | 5.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 15.91 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 71.85 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496122_0001187 | 3300048925 | Bacteria | 44594 |
| 2 | SwRhRL2b_contig_3540226 | 2162886007 | Bacteria | 4193 |
| 3 | SwRhRL2b_contig_3705000 | 2162886007 | Bacteria | 37959 |
| 4 | JGI24736J21556_1000121 | 3300001904 | Bacteria | 13331 |
| 5 | JGI24752J21851_1000155 | 3300001976 | Bacteria | 9311 |
| 6 | JGI24752J21851_1000461 | 3300001976 | Bacteria | 5495 |
| 7 | JGI24737J22298_10003404 | 3300001990 | Bacteria | 5622 |
| 8 | JGI24735J21928_10000918 | 3300002067 | Bacteria | 10528 |
| 9 | JGI24750J21931_1000359 | 3300002070 | Bacteria | 7796 |
| 10 | JGI24748J21848_1000044 | 3300002074 | Bacteria | 59119 |
| 11 | JGI24749J21850_1000330 | 3300002076 | Bacteria | 7176 |
| 12 | JGI24749J21850_1000531 | 3300002076 | Bacteria | 5590 |
| 13 | JGI24034J26672_10000020 | 3300002239 | Bacteria | 122643 |
| 14 | JGI24742J22300_10001043 | 3300002244 | Bacteria | 4265 |
| 15 | JGI24751J29686_10000052 | 3300002459 | Bacteria | 65492 |
| 16 | JGI25150J39212_1000046 | 3300002774 | Bacteria | 78180 |
| 17 | JGI25159J45721_1007784 | 3300002987 | Bacteria | 3024 |
| 18 | JGI25151J46595_10001638 | 3300003187 | Bacteria | 14729 |
| 19 | JGI25165J46597_1000073 | 3300003214 | Bacteria | 192140 |
| 20 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 21 | JGI25153J46596_10000124 | 3300003215 | Bacteria | 86430 |
| 22 | Ga0055525_1000090 | 3300003759 | Bacteria | 141071 |
| 23 | Ga0055542_1000046 | 3300003762 | Bacteria | 201922 |
| 24 | Ga0055529_1000007 | 3300003763 | Bacteria | 403604 |
| 25 | Ga0055529_1000109 | 3300003763 | Bacteria | 121019 |
| 26 | Ga0055526_1007061 | 3300003771 | Bacteria | 5938 |
| 27 | Ga0055524_1001907 | 3300003775 | Bacteria | 11300 |
| 28 | Ga0055536_1003381 | 3300003781 | Bacteria | 8607 |
| 29 | Ga0055536_1006713 | 3300003781 | Bacteria | 5289 |
| 30 | Ga0055536_1008867 | 3300003781 | Bacteria | 4251 |
| 31 | Ga0055530_10001655 | 3300003791 | Bacteria | 15864 |
| 32 | Ga0055530_10002492 | 3300003791 | Bacteria | 11790 |
| 33 | Ga0055530_10013862 | 3300003791 | Bacteria | 2724 |
| 34 | Ga0055540_1003937 | 3300003792 | Bacteria | 6941 |
| 35 | Ga0055531_10000008 | 3300003794 | Bacteria | 222269 |
| 36 | Ga0055531_10001714 | 3300003794 | Bacteria | 15705 |
| 37 | Ga0055531_10001722 | 3300003794 | Bacteria | 15672 |
| 38 | Ga0055531_10009693 | 3300003794 | Bacteria | 4895 |
| 39 | Ga0065165_1001443 | 3300005262 | Bacteria | 25758 |
| 40 | Ga0065165_1002698 | 3300005262 | Bacteria | 14260 |
| 41 | Ga0065704_10000191 | 3300005289 | Bacteria | 318191 |
| 42 | Ga0065704_10070744 | 3300005289 | Bacteria | 16791 |
| 43 | Ga0065704_10081289 | 3300005289 | Bacteria | 3786 |
| 44 | Ga0065704_10100052 | 3300005289 | Bacteria | 2288 |
| 45 | Ga0065715_10000978 | 3300005293 | Bacteria | 7475 |
| 46 | Ga0065707_10081865 | 3300005295 | Bacteria | 32547 |
| 47 | Ga0065707_10086251 | 3300005295 | Bacteria | 5572 |
| 48 | Ga0070658_10000227 | 3300005327 | Bacteria | 50101 |
| 49 | Ga0070658_10024952 | 3300005327 | Bacteria | 4793 |
| 50 | Ga0070676_10007834 | 3300005328 | Bacteria | 5743 |
| 51 | Ga0070690_100000180 | 3300005330 | Bacteria | 32463 |
| 52 | Ga0070670_100000024 | 3300005331 | Bacteria | 189811 |
| 53 | Ga0070670_100000792 | 3300005331 | Bacteria | 24611 |
| 54 | Ga0070670_100003165 | 3300005331 | Bacteria | 13607 |
| 55 | Ga0070670_100005522 | 3300005331 | Bacteria | 10672 |
| 56 | Ga0070670_100032156 | 3300005331 | Bacteria | 4519 |
| 57 | Ga0070670_100052533 | 3300005331 | Bacteria | 3499 |
| 58 | Ga0070670_100087376 | 3300005331 | Bacteria | 2679 |
| 59 | Ga0070677_10001757 | 3300005333 | Bacteria | 6845 |
| 60 | Ga0070666_10000027 | 3300005335 | Bacteria | 151010 |
| 61 | Ga0070666_10000352 | 3300005335 | Bacteria | 28924 |
| 62 | Ga0070666_10010284 | 3300005335 | Bacteria | 5848 |
| 63 | Ga0070666_10029018 | 3300005335 | Bacteria | 3635 |
| 64 | Ga0070660_100004165 | 3300005339 | Bacteria | 9989 |
| 65 | Ga0070689_100008132 | 3300005340 | Bacteria | 7372 |
| 66 | Ga0070661_100000010 | 3300005344 | Bacteria | 175777 |
| 67 | Ga0070661_100002364 | 3300005344 | Bacteria | 12951 |
| 68 | Ga0070661_100015823 | 3300005344 | Bacteria | 5325 |
| 69 | Ga0070661_100026844 | 3300005344 | Bacteria | 4144 |
| 70 | Ga0070668_100000027 | 3300005347 | Bacteria | 89913 |
| 71 | Ga0070668_100000068 | 3300005347 | Bacteria | 64209 |
| 72 | Ga0070668_100000646 | 3300005347 | Bacteria | 23522 |
| 73 | Ga0070668_100004087 | 3300005347 | Bacteria | 10803 |
| 74 | Ga0070668_100019269 | 3300005347 | Bacteria | 5135 |
| 75 | Ga0070668_100019894 | 3300005347 | Bacteria | 5058 |
| 76 | Ga0070668_100066155 | 3300005347 | Bacteria | 2804 |
| 77 | Ga0070669_100000018 | 3300005353 | Bacteria | 195789 |
| 78 | Ga0070669_100000047 | 3300005353 | Bacteria | 118892 |
| 79 | Ga0070669_100000099 | 3300005353 | Bacteria | 85328 |
| 80 | Ga0070669_100001232 | 3300005353 | Bacteria | 18563 |
| 81 | Ga0070669_100016595 | 3300005353 | Bacteria | 5257 |
| 82 | Ga0070669_100021839 | 3300005353 | Bacteria | 4577 |
| 83 | Ga0070675_100004161 | 3300005354 | Bacteria | 10987 |
| 84 | Ga0070675_100012526 | 3300005354 | Bacteria | 6648 |
| 85 | Ga0070675_100023281 | 3300005354 | Bacteria | 4951 |
| 86 | Ga0070671_100000011 | 3300005355 | Bacteria | 202057 |
| 87 | Ga0070671_100000353 | 3300005355 | Bacteria | 31530 |
| 88 | Ga0070671_100001241 | 3300005355 | Bacteria | 19109 |
| 89 | Ga0070671_100004632 | 3300005355 | Bacteria | 10905 |
| 90 | Ga0070671_100008988 | 3300005355 | Bacteria | 8018 |
| 91 | Ga0070673_100029291 | 3300005364 | Bacteria | 4105 |
| 92 | Ga0070673_100032493 | 3300005364 | Bacteria | 3930 |
| 93 | Ga0070688_100000293 | 3300005365 | Bacteria | 25617 |
| 94 | Ga0070659_100013031 | 3300005366 | Bacteria | 6182 |
| 95 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 96 | Ga0070667_100000066 | 3300005367 | Bacteria | 134529 |
| 97 | Ga0070667_100000067 | 3300005367 | Bacteria | 133023 |
| 98 | Ga0070667_100000290 | 3300005367 | Bacteria | 56841 |
| 99 | Ga0070667_100000459 | 3300005367 | Bacteria | 41954 |
| 100 | Ga0070667_100000480 | 3300005367 | Bacteria | 40910 |
| 101 | Ga0070667_100001292 | 3300005367 | Bacteria | 22636 |
| 102 | Ga0070667_100011712 | 3300005367 | Bacteria | 7247 |
| 103 | Ga0070667_100012620 | 3300005367 | Bacteria | 6988 |
| 104 | Ga0070667_100019588 | 3300005367 | Bacteria | 5613 |
| 105 | Ga0070678_100000076 | 3300005456 | Bacteria | 37213 |
| 106 | Ga0070662_100005311 | 3300005457 | Bacteria | 8227 |
| 107 | Ga0070662_100058572 | 3300005457 | Bacteria | 2804 |
| 108 | Ga0070681_10089493 | 3300005458 | Bacteria | 3030 |
| 109 | Ga0070685_10000238 | 3300005466 | Bacteria | 36209 |
| 110 | Ga0070679_100000168 | 3300005530 | Bacteria | 52996 |
| 111 | Ga0070679_100165301 | 3300005530 | Bacteria | 2186 |
| 112 | Ga0068853_100002669 | 3300005539 | Bacteria | 13447 |
| 113 | Ga0068853_100020182 | 3300005539 | Bacteria | 5539 |
| 114 | Ga0070672_100003237 | 3300005543 | Bacteria | 10542 |
| 115 | Ga0070686_100000010 | 3300005544 | Bacteria | 192116 |
| 116 | Ga0070695_100075744 | 3300005545 | Bacteria | 2215 |
| 117 | Ga0070665_100000086 | 3300005548 | Bacteria | 178229 |
| 118 | Ga0070665_100000254 | 3300005548 | Bacteria | 88587 |
| 119 | Ga0070665_100002933 | 3300005548 | Bacteria | 18422 |
| 120 | Ga0070665_100013328 | 3300005548 | Bacteria | 8274 |
| 121 | Ga0070665_100015010 | 3300005548 | Bacteria | 7774 |
| 122 | Ga0070664_100009278 | 3300005564 | Bacteria | 7986 |
| 123 | Ga0070664_100090692 | 3300005564 | Bacteria | 2645 |
| 124 | Ga0068854_100013256 | 3300005578 | Bacteria | 5404 |
| 125 | Ga0068852_100034615 | 3300005616 | Bacteria | 4205 |
| 126 | Ga0068852_100156023 | 3300005616 | Bacteria | 2126 |
| 127 | Ga0068859_100002363 | 3300005617 | Bacteria | 19203 |
| 128 | Ga0068859_100004889 | 3300005617 | Bacteria | 13646 |
| 129 | Ga0068859_100006146 | 3300005617 | Bacteria | 12204 |
| 130 | Ga0068859_100013485 | 3300005617 | Bacteria | 8195 |
| 131 | Ga0068859_100020790 | 3300005617 | Bacteria | 6588 |
| 132 | Ga0068859_100027164 | 3300005617 | Bacteria | 5743 |
| 133 | Ga0068859_100109660 | 3300005617 | Bacteria | 2821 |
| 134 | Ga0068859_100169626 | 3300005617 | Bacteria | 2263 |
| 135 | Ga0068864_100000036 | 3300005618 | Bacteria | 189811 |
| 136 | Ga0068864_100000063 | 3300005618 | Bacteria | 119845 |
| 137 | Ga0068864_100001646 | 3300005618 | Bacteria | 18401 |
| 138 | Ga0068864_100003044 | 3300005618 | Bacteria | 13839 |
| 139 | Ga0068861_100000005 | 3300005719 | Bacteria | 101677 |
| 140 | Ga0068861_100002905 | 3300005719 | Bacteria | 11293 |
| 141 | Ga0068861_100007125 | 3300005719 | Bacteria | 7655 |
| 142 | Ga0068861_100013995 | 3300005719 | Bacteria | 5624 |
| 143 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 144 | Ga0068863_100000038 | 3300005841 | Bacteria | 161477 |
| 145 | Ga0068863_100000062 | 3300005841 | Bacteria | 119845 |
| 146 | Ga0068863_100000603 | 3300005841 | Bacteria | 36544 |
| 147 | Ga0068863_100000775 | 3300005841 | Bacteria | 32088 |
| 148 | Ga0068863_100003283 | 3300005841 | Bacteria | 15970 |
| 149 | Ga0068863_100006015 | 3300005841 | Bacteria | 11900 |
| 150 | Ga0068863_100006939 | 3300005841 | Bacteria | 11104 |
| 151 | Ga0068863_100008950 | 3300005841 | Bacteria | 9776 |
| 152 | Ga0068863_100010531 | 3300005841 | Bacteria | 8979 |
| 153 | Ga0068863_100011823 | 3300005841 | Bacteria | 8440 |
| 154 | Ga0068858_100000103 | 3300005842 | Bacteria | 88754 |
| 155 | Ga0068858_100000530 | 3300005842 | Bacteria | 39968 |
| 156 | Ga0068858_100000777 | 3300005842 | Bacteria | 33348 |
| 157 | Ga0068858_100003512 | 3300005842 | Bacteria | 15537 |
| 158 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 159 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 160 | Ga0068860_100000080 | 3300005843 | Bacteria | 170152 |
| 161 | Ga0068860_100024655 | 3300005843 | Bacteria | 5808 |
| 162 | Ga0068862_100000033 | 3300005844 | Bacteria | 176515 |
| 163 | Ga0068862_100000069 | 3300005844 | Bacteria | 122535 |
| 164 | Ga0068862_100000115 | 3300005844 | Bacteria | 94951 |
| 165 | Ga0068862_100000485 | 3300005844 | Bacteria | 42458 |
| 166 | Ga0068862_100004188 | 3300005844 | Bacteria | 12217 |
| 167 | Ga0068862_100005376 | 3300005844 | Bacteria | 10718 |
| 168 | Ga0068862_100005633 | 3300005844 | Bacteria | 10458 |
| 169 | Ga0068862_100012106 | 3300005844 | Bacteria | 7128 |
| 170 | Ga0068862_100018068 | 3300005844 | Bacteria | 5873 |
| 171 | Ga0068862_100030185 | 3300005844 | Bacteria | 4568 |
| 172 | Ga0068862_100032674 | 3300005844 | Bacteria | 4397 |
| 173 | Ga0068862_100059599 | 3300005844 | Bacteria | 3278 |
| 174 | Ga0081455_10002228 | 3300005937 | Bacteria | 23082 |
| 175 | Ga0081539_10018190 | 3300005985 | Bacteria | 4891 |
| 176 | Ga0081539_10019805 | 3300005985 | Bacteria | 4584 |
| 177 | Ga0075368_10000704 | 3300006042 | Bacteria | 10189 |
| 178 | Ga0075367_10000042 | 3300006178 | Bacteria | 28460 |
| 179 | Ga0075366_10004887 | 3300006195 | Bacteria | 7230 |
| 180 | Ga0075366_10012022 | 3300006195 | Bacteria | 4903 |
| 181 | Ga0075370_10024116 | 3300006353 | Bacteria | 3357 |
| 182 | Ga0075430_100018966 | 3300006846 | Bacteria | 5853 |
| 183 | Ga0075431_100007563 | 3300006847 | Bacteria | 10816 |
| 184 | Ga0097620_100002363 | 3300006931 | Bacteria | 19203 |
| 185 | Ga0097620_100004889 | 3300006931 | Bacteria | 13646 |
| 186 | Ga0097620_100006146 | 3300006931 | Bacteria | 12204 |
| 187 | Ga0097620_100013486 | 3300006931 | Bacteria | 8195 |
| 188 | Ga0097620_100020789 | 3300006931 | Bacteria | 6588 |
| 189 | Ga0097620_100027165 | 3300006931 | Bacteria | 5743 |
| 190 | Ga0097620_100109659 | 3300006931 | Bacteria | 2821 |
| 191 | Ga0097620_100169630 | 3300006931 | Bacteria | 2263 |
| 192 | Ga0105251_10001006 | 3300009011 | Bacteria | 24692 |
| 193 | Ga0111539_10000017 | 3300009094 | Bacteria | 275456 |
| 194 | Ga0111539_10029495 | 3300009094 | Bacteria | 6681 |
| 195 | Ga0105245_10002260 | 3300009098 | Bacteria | 17440 |
| 196 | Ga0105247_10004862 | 3300009101 | Bacteria | 8547 |
| 197 | Ga0105247_10016928 | 3300009101 | Bacteria | 4372 |
| 198 | Ga0105243_10000224 | 3300009148 | Bacteria | 65196 |
| 199 | Ga0105241_10097937 | 3300009174 | Bacteria | 2326 |
| 200 | Ga0105248_10000091 | 3300009177 | Bacteria | 101191 |
| 201 | Ga0105248_10000536 | 3300009177 | Bacteria | 43208 |
| 202 | Ga0105248_10003098 | 3300009177 | Bacteria | 18437 |
| 203 | Ga0105248_10008150 | 3300009177 | Bacteria | 11507 |
| 204 | Ga0105248_10009842 | 3300009177 | Bacteria | 10530 |
| 205 | Ga0105248_10025435 | 3300009177 | Bacteria | 6582 |
| 206 | Ga0105248_10036917 | 3300009177 | Bacteria | 5465 |
| 207 | Ga0105237_10050794 | 3300009545 | Bacteria | 4166 |
| 208 | Ga0105238_10047095 | 3300009551 | Bacteria | 4349 |
| 209 | Ga0105238_10062799 | 3300009551 | Bacteria | 3715 |
| 210 | Ga0105249_10000064 | 3300009553 | Bacteria | 151646 |
| 211 | Ga0105249_10000160 | 3300009553 | Bacteria | 81883 |
| 212 | Ga0105249_10000567 | 3300009553 | Bacteria | 33975 |
| 213 | Ga0105249_10017175 | 3300009553 | Bacteria | 6423 |
| 214 | Ga0105249_10025445 | 3300009553 | Bacteria | 5328 |
| 215 | Ga0105249_10040062 | 3300009553 | Bacteria | 4255 |
| 216 | Ga0105249_10064607 | 3300009553 | Bacteria | 3365 |
| 217 | Ga0105239_10113654 | 3300010375 | Bacteria | 3002 |
| 218 | Ga0157326_1000059 | 3300012513 | Bacteria | 10517 |
| 219 | Ga0157373_10009216 | 3300013100 | Bacteria | 7299 |
| 220 | Ga0157371_10000097 | 3300013102 | Bacteria | 134150 |
| 221 | Ga0157369_10025937 | 3300013105 | Bacteria | 6504 |
| 222 | Ga0157378_10003298 | 3300013297 | Bacteria | 14370 |
| 223 | Ga0157378_10094681 | 3300013297 | Bacteria | 2720 |
| 224 | Ga0163162_10035914 | 3300013306 | Bacteria | 4937 |
| 225 | Ga0163162_10048106 | 3300013306 | Bacteria | 4273 |
| 226 | Ga0163162_10085262 | 3300013306 | Bacteria | 3235 |
| 227 | Ga0157372_10214297 | 3300013307 | Bacteria | 2232 |
| 228 | Ga0163163_10000107 | 3300014325 | Bacteria | 87926 |
| 229 | Ga0157380_10000086 | 3300014326 | Bacteria | 51604 |
| 230 | Ga0157380_10000217 | 3300014326 | Bacteria | 34251 |
| 231 | Ga0157380_10003002 | 3300014326 | Bacteria | 11489 |
| 232 | Ga0157380_10003455 | 3300014326 | Bacteria | 10849 |
| 233 | Ga0157380_10013463 | 3300014326 | Bacteria | 5963 |
| 234 | Ga0157380_10051349 | 3300014326 | Bacteria | 3261 |
| 235 | Ga0157379_10009125 | 3300014968 | Bacteria | 8637 |
| 236 | Ga0157379_10065983 | 3300014968 | Bacteria | 3235 |
| 237 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 238 | Ga0163161_10000110 | 3300017792 | Bacteria | 78102 |
| 239 | Ga0163161_10103664 | 3300017792 | Bacteria | 2120 |
| 240 | Ga0213873_10000015 | 3300021358 | Bacteria | 131343 |
| 241 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 242 | Ga0209147_100321 | 3300025229 | Bacteria | 36587 |
| 243 | Ga0209563_100111 | 3300025230 | Bacteria | 141123 |
| 244 | Ga0207425_1000020 | 3300025245 | Bacteria | 372623 |
| 245 | Ga0209646_1004636 | 3300025246 | Bacteria | 2482 |
| 246 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 247 | Ga0209129_1000586 | 3300025258 | Bacteria | 25017 |
| 248 | Ga0209233_1000142 | 3300025261 | Bacteria | 192193 |
| 249 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 250 | Ga0209565_1000210 | 3300025263 | Bacteria | 67800 |
| 251 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 252 | Ga0209673_1000984 | 3300025273 | Bacteria | 34864 |
| 253 | Ga0209130_1000512 | 3300025284 | Bacteria | 39134 |
| 254 | Ga0209675_1000838 | 3300025291 | Bacteria | 20134 |
| 255 | Ga0209676_1000518 | 3300025292 | Bacteria | 60512 |
| 256 | Ga0209676_1000554 | 3300025292 | Bacteria | 56925 |
| 257 | Ga0209676_1000929 | 3300025292 | Bacteria | 36184 |
| 258 | Ga0209676_1008339 | 3300025292 | Bacteria | 4637 |
| 259 | Ga0209025_1000114 | 3300025294 | Bacteria | 218921 |
| 260 | Ga0209025_1000326 | 3300025294 | Bacteria | 106087 |
| 261 | Ga0209564_1001114 | 3300025295 | Bacteria | 31654 |
| 262 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 263 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 264 | Ga0209758_1001428 | 3300025297 | Bacteria | 28251 |
| 265 | Ga0209758_1017781 | 3300025297 | Bacteria | 3517 |
| 266 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 267 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 268 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 269 | Ga0209050_1002610 | 3300025298 | Bacteria | 14895 |
| 270 | Ga0209050_1008085 | 3300025298 | Bacteria | 5710 |
| 271 | Ga0209050_1014081 | 3300025298 | Bacteria | 3480 |
| 272 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 273 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 274 | Ga0207426_1000181 | 3300025302 | Bacteria | 158308 |
| 275 | Ga0209051_1000476 | 3300025303 | Bacteria | 51944 |
| 276 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 277 | Ga0209257_1001405 | 3300025304 | Bacteria | 28723 |
| 278 | Ga0209257_1002894 | 3300025304 | Bacteria | 15934 |
| 279 | Ga0209257_1003790 | 3300025304 | Bacteria | 12457 |
| 280 | Ga0209257_1005509 | 3300025304 | Bacteria | 8841 |
| 281 | Ga0207697_10000211 | 3300025315 | Bacteria | 31108 |
| 282 | Ga0207697_10003297 | 3300025315 | Bacteria | 8029 |
| 283 | Ga0207713_1001151 | 3300025735 | Bacteria | 22391 |
| 284 | Ga0207713_1002611 | 3300025735 | Bacteria | 12984 |
| 285 | Ga0207682_10002080 | 3300025893 | Bacteria | 9063 |
| 286 | Ga0207710_10002208 | 3300025900 | Bacteria | 9150 |
| 287 | Ga0207710_10008695 | 3300025900 | Bacteria | 4281 |
| 288 | Ga0207710_10034094 | 3300025900 | Bacteria | 2235 |
| 289 | Ga0207680_10000009 | 3300025903 | Bacteria | 464571 |
| 290 | Ga0207680_10023993 | 3300025903 | Bacteria | 3340 |
| 291 | Ga0207680_10049495 | 3300025903 | Bacteria | 2501 |
| 292 | Ga0207647_10031699 | 3300025904 | Bacteria | 3399 |
| 293 | Ga0207645_10004405 | 3300025907 | Bacteria | 10428 |
| 294 | Ga0207645_10012931 | 3300025907 | Bacteria | 5647 |
| 295 | Ga0207705_10000450 | 3300025909 | Bacteria | 35404 |
| 296 | Ga0207705_10051400 | 3300025909 | Bacteria | 2966 |
| 297 | Ga0207654_10004079 | 3300025911 | Bacteria | 7359 |
| 298 | Ga0207707_10075179 | 3300025912 | Bacteria | 2947 |
| 299 | Ga0207707_10090256 | 3300025912 | Bacteria | 2678 |
| 300 | Ga0207671_10006655 | 3300025914 | Bacteria | 10244 |
| 301 | Ga0207671_10014738 | 3300025914 | Bacteria | 6164 |
| 302 | Ga0207657_10009966 | 3300025919 | Bacteria | 9511 |
| 303 | Ga0207657_10011805 | 3300025919 | Bacteria | 8648 |
| 304 | Ga0207657_10022107 | 3300025919 | Bacteria | 5969 |
| 305 | Ga0207649_10000178 | 3300025920 | Bacteria | 52146 |
| 306 | Ga0207649_10002255 | 3300025920 | Bacteria | 10883 |
| 307 | Ga0207652_10000282 | 3300025921 | Bacteria | 52954 |
| 308 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 309 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 310 | Ga0207681_10000106 | 3300025923 | Bacteria | 71721 |
| 311 | Ga0207681_10000259 | 3300025923 | Bacteria | 40452 |
| 312 | Ga0207681_10027414 | 3300025923 | Bacteria | 3683 |
| 313 | Ga0207681_10053593 | 3300025923 | Bacteria | 2739 |
| 314 | Ga0207694_10020172 | 3300025924 | Bacteria | 5041 |
| 315 | Ga0207694_10023064 | 3300025924 | Bacteria | 4724 |
| 316 | Ga0207694_10025520 | 3300025924 | Bacteria | 4492 |
| 317 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 318 | Ga0207650_10015218 | 3300025925 | Bacteria | 5354 |
| 319 | Ga0207650_10018925 | 3300025925 | Bacteria | 4839 |
| 320 | Ga0207650_10020051 | 3300025925 | Bacteria | 4709 |
| 321 | Ga0207650_10032859 | 3300025925 | Bacteria | 3755 |
| 322 | Ga0207650_10035934 | 3300025925 | Bacteria | 3601 |
| 323 | Ga0207659_10045306 | 3300025926 | Bacteria | 3100 |
| 324 | Ga0207659_10054702 | 3300025926 | Bacteria | 2851 |
| 325 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 326 | Ga0207644_10000544 | 3300025931 | Bacteria | 24497 |
| 327 | Ga0207644_10000574 | 3300025931 | Bacteria | 23595 |
| 328 | Ga0207644_10003236 | 3300025931 | Bacteria | 10496 |
| 329 | Ga0207644_10003746 | 3300025931 | Bacteria | 9848 |
| 330 | Ga0207644_10008789 | 3300025931 | Bacteria | 6613 |
| 331 | Ga0207644_10033072 | 3300025931 | Bacteria | 3611 |
| 332 | Ga0207690_10004587 | 3300025932 | Bacteria | 8166 |
| 333 | Ga0207706_10004467 | 3300025933 | Bacteria | 13136 |
| 334 | Ga0207706_10006993 | 3300025933 | Bacteria | 10426 |
| 335 | Ga0207706_10014593 | 3300025933 | Bacteria | 7116 |
| 336 | Ga0207706_10031363 | 3300025933 | Bacteria | 4735 |
| 337 | Ga0207706_10092745 | 3300025933 | Bacteria | 2655 |
| 338 | Ga0207706_10120023 | 3300025933 | Bacteria | 2311 |
| 339 | Ga0207709_10000519 | 3300025935 | Bacteria | 33581 |
| 340 | Ga0207709_10011498 | 3300025935 | Bacteria | 4884 |
| 341 | Ga0207670_10010660 | 3300025936 | Bacteria | 5303 |
| 342 | Ga0207669_10000161 | 3300025937 | Bacteria | 32114 |
| 343 | Ga0207669_10006712 | 3300025937 | Bacteria | 5278 |
| 344 | Ga0207669_10083879 | 3300025937 | Bacteria | 2051 |
| 345 | Ga0207691_10004823 | 3300025940 | Bacteria | 13043 |
| 346 | Ga0207691_10005772 | 3300025940 | Bacteria | 11974 |
| 347 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 348 | Ga0207711_10000252 | 3300025941 | Bacteria | 57840 |
| 349 | Ga0207711_10003251 | 3300025941 | Bacteria | 14161 |
| 350 | Ga0207711_10003634 | 3300025941 | Bacteria | 13336 |
| 351 | Ga0207711_10018314 | 3300025941 | Bacteria | 5820 |
| 352 | Ga0207711_10023381 | 3300025941 | Bacteria | 5174 |
| 353 | Ga0207711_10041275 | 3300025941 | Bacteria | 3929 |
| 354 | Ga0207711_10074113 | 3300025941 | Bacteria | 2960 |
| 355 | Ga0207711_10075264 | 3300025941 | Bacteria | 2938 |
| 356 | Ga0207689_10093863 | 3300025942 | Bacteria | 2465 |
| 357 | Ga0207661_10114574 | 3300025944 | Bacteria | 2286 |
| 358 | Ga0207679_10004610 | 3300025945 | Bacteria | 8581 |
| 359 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 360 | Ga0207667_10014565 | 3300025949 | Bacteria | 8957 |
| 361 | Ga0207667_10105697 | 3300025949 | Bacteria | 2904 |
| 362 | Ga0207712_10000008 | 3300025961 | Bacteria | 527957 |
| 363 | Ga0207712_10000044 | 3300025961 | Bacteria | 171240 |
| 364 | Ga0207712_10000222 | 3300025961 | Bacteria | 56073 |
| 365 | Ga0207712_10006379 | 3300025961 | Bacteria | 7441 |
| 366 | Ga0207712_10009432 | 3300025961 | Bacteria | 6175 |
| 367 | Ga0207712_10015834 | 3300025961 | Bacteria | 4872 |
| 368 | Ga0207712_10038733 | 3300025961 | Bacteria | 3261 |
| 369 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 370 | Ga0207668_10000629 | 3300025972 | Bacteria | 21816 |
| 371 | Ga0207668_10000860 | 3300025972 | Bacteria | 18295 |
| 372 | Ga0207668_10001683 | 3300025972 | Bacteria | 12933 |
| 373 | Ga0207668_10002528 | 3300025972 | Bacteria | 10677 |
| 374 | Ga0207668_10003159 | 3300025972 | Bacteria | 9645 |
| 375 | Ga0207668_10009770 | 3300025972 | Bacteria | 5763 |
| 376 | Ga0207668_10041715 | 3300025972 | Bacteria | 3104 |
| 377 | Ga0207668_10052374 | 3300025972 | Bacteria | 2823 |
| 378 | Ga0207668_10055215 | 3300025972 | Bacteria | 2760 |
| 379 | Ga0207668_10068228 | 3300025972 | Bacteria | 2527 |
| 380 | Ga0207668_10074452 | 3300025972 | Bacteria | 2438 |
| 381 | Ga0207668_10085580 | 3300025972 | Bacteria | 2301 |
| 382 | Ga0207640_10009509 | 3300025981 | Bacteria | 5445 |
| 383 | Ga0207640_10009819 | 3300025981 | Bacteria | 5369 |
| 384 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 385 | Ga0207658_10000089 | 3300025986 | Bacteria | 100308 |
| 386 | Ga0207658_10000132 | 3300025986 | Bacteria | 80078 |
| 387 | Ga0207658_10000133 | 3300025986 | Bacteria | 78402 |
| 388 | Ga0207658_10000291 | 3300025986 | Bacteria | 52585 |
| 389 | Ga0207658_10002473 | 3300025986 | Bacteria | 13492 |
| 390 | Ga0207658_10002564 | 3300025986 | Bacteria | 13198 |
| 391 | Ga0207658_10009504 | 3300025986 | Bacteria | 6600 |
| 392 | Ga0207658_10012206 | 3300025986 | Bacteria | 5863 |
| 393 | Ga0207658_10025815 | 3300025986 | Bacteria | 4114 |
| 394 | Ga0207658_10026771 | 3300025986 | Bacteria | 4046 |
| 395 | Ga0207658_10033271 | 3300025986 | Bacteria | 3676 |
| 396 | Ga0207703_10000691 | 3300026035 | Bacteria | 33391 |
| 397 | Ga0207703_10001013 | 3300026035 | Bacteria | 27010 |
| 398 | Ga0207703_10003167 | 3300026035 | Bacteria | 13874 |
| 399 | Ga0207639_10026227 | 3300026041 | Bacteria | 4234 |
| 400 | Ga0207639_10026739 | 3300026041 | Bacteria | 4194 |
| 401 | Ga0207678_10020460 | 3300026067 | Bacteria | 5803 |
| 402 | Ga0207702_10007378 | 3300026078 | Bacteria | 9388 |
| 403 | Ga0207702_10032064 | 3300026078 | Bacteria | 4383 |
| 404 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 405 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 406 | Ga0207641_10000047 | 3300026088 | Bacteria | 179977 |
| 407 | Ga0207641_10000060 | 3300026088 | Bacteria | 161514 |
| 408 | Ga0207641_10001074 | 3300026088 | Bacteria | 27484 |
| 409 | Ga0207641_10002092 | 3300026088 | Bacteria | 18889 |
| 410 | Ga0207641_10004584 | 3300026088 | Bacteria | 11938 |
| 411 | Ga0207641_10006843 | 3300026088 | Bacteria | 9546 |
| 412 | Ga0207641_10016494 | 3300026088 | Bacteria | 6049 |
| 413 | Ga0207641_10018011 | 3300026088 | Bacteria | 5788 |
| 414 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 415 | Ga0207676_10000056 | 3300026095 | Bacteria | 124484 |
| 416 | Ga0207676_10000827 | 3300026095 | Bacteria | 24173 |
| 417 | Ga0207676_10000894 | 3300026095 | Bacteria | 23124 |
| 418 | Ga0207676_10001517 | 3300026095 | Bacteria | 17145 |
| 419 | Ga0207676_10002294 | 3300026095 | Bacteria | 13722 |
| 420 | Ga0207674_10007137 | 3300026116 | Bacteria | 13050 |
| 421 | Ga0207674_10069644 | 3300026116 | Bacteria | 3538 |
| 422 | Ga0207674_10084252 | 3300026116 | Bacteria | 3177 |
| 423 | Ga0207675_100000020 | 3300026118 | Bacteria | 117374 |
| 424 | Ga0207675_100000207 | 3300026118 | Bacteria | 54791 |
| 425 | Ga0207675_100002282 | 3300026118 | Bacteria | 19053 |
| 426 | Ga0207675_100004785 | 3300026118 | Bacteria | 13038 |
| 427 | Ga0207675_100084771 | 3300026118 | Bacteria | 2973 |
| 428 | Ga0207675_100150282 | 3300026118 | Bacteria | 2216 |
| 429 | Ga0207683_10000655 | 3300026121 | Bacteria | 31727 |
| 430 | Ga0207683_10033010 | 3300026121 | Bacteria | 4496 |
| 431 | Ga0207698_10051391 | 3300026142 | Bacteria | 3151 |
| 432 | Ga0209813_10000042 | 3300027866 | Bacteria | 53213 |
| 433 | Ga0209813_10000126 | 3300027866 | Bacteria | 27944 |
| 434 | Ga0209974_10003218 | 3300027876 | Bacteria | 5903 |
| 435 | Ga0209974_10003430 | 3300027876 | Bacteria | 5723 |
| 436 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 437 | Ga0268266_10000069 | 3300028379 | Bacteria | 239714 |
| 438 | Ga0268266_10004036 | 3300028379 | Bacteria | 14190 |
| 439 | Ga0268266_10011818 | 3300028379 | Bacteria | 7568 |
| 440 | Ga0268266_10016904 | 3300028379 | Bacteria | 6233 |
| 441 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 442 | Ga0268265_10000044 | 3300028380 | Bacteria | 182545 |
| 443 | Ga0268265_10000082 | 3300028380 | Bacteria | 120835 |
| 444 | Ga0268265_10000100 | 3300028380 | Bacteria | 108659 |
| 445 | Ga0268265_10000958 | 3300028380 | Bacteria | 26520 |
| 446 | Ga0268265_10006174 | 3300028380 | Bacteria | 8115 |
| 447 | Ga0268265_10006969 | 3300028380 | Bacteria | 7645 |
| 448 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 449 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 450 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 451 | Ga0268264_10000131 | 3300028381 | Bacteria | 181459 |
| 452 | Ga0268264_10000933 | 3300028381 | Bacteria | 30321 |
| 453 | Ga0268264_10000935 | 3300028381 | Bacteria | 30301 |
| 454 | Ga0268264_10021281 | 3300028381 | Bacteria | 5297 |
| 455 | Ga0268264_10053953 | 3300028381 | Bacteria | 3355 |
| 456 | Ga0307513_10075874 | 3300031456 | Bacteria | 3489 |
| 457 | Ga0307509_10000115 | 3300031507 | Bacteria | 116444 |
| 458 | Ga0307408_100015727 | 3300031548 | Bacteria | 5041 |
| 459 | Ga0307408_100017748 | 3300031548 | Bacteria | 4768 |
| 460 | Ga0307408_100019173 | 3300031548 | Bacteria | 4603 |
| 461 | Ga0307408_100087906 | 3300031548 | Bacteria | 2340 |
| 462 | Ga0307508_10025163 | 3300031616 | Bacteria | 5398 |
| 463 | Ga0307405_10000391 | 3300031731 | Bacteria | 16410 |
| 464 | Ga0307405_10010450 | 3300031731 | Bacteria | 4811 |
| 465 | Ga0307405_10041028 | 3300031731 | Bacteria | 2807 |
| 466 | Ga0307405_10054567 | 3300031731 | Bacteria | 2495 |
| 467 | Ga0307413_10001504 | 3300031824 | Bacteria | 8914 |
| 468 | Ga0307413_10007329 | 3300031824 | Bacteria | 5114 |
| 469 | Ga0307413_10007679 | 3300031824 | Bacteria | 5031 |
| 470 | Ga0307413_10012702 | 3300031824 | Bacteria | 4201 |
| 471 | Ga0307413_10028311 | 3300031824 | Bacteria | 3118 |
| 472 | Ga0307413_10029103 | 3300031824 | Bacteria | 3086 |
| 473 | Ga0307413_10051241 | 3300031824 | Bacteria | 2486 |
| 474 | Ga0307410_10000684 | 3300031852 | Bacteria | 14130 |
| 475 | Ga0307410_10002446 | 3300031852 | Bacteria | 8971 |
| 476 | Ga0307410_10003698 | 3300031852 | Bacteria | 7736 |
| 477 | Ga0307410_10004043 | 3300031852 | Bacteria | 7498 |
| 478 | Ga0307410_10014143 | 3300031852 | Bacteria | 4683 |
| 479 | Ga0307410_10019814 | 3300031852 | Bacteria | 4100 |
| 480 | Ga0307410_10021645 | 3300031852 | Bacteria | 3958 |
| 481 | Ga0307410_10033329 | 3300031852 | Bacteria | 3324 |
| 482 | Ga0307410_10037184 | 3300031852 | Bacteria | 3177 |
| 483 | Ga0307410_10074721 | 3300031852 | Bacteria | 2361 |
| 484 | Ga0307406_10019894 | 3300031901 | Bacteria | 3945 |
| 485 | Ga0307406_10021789 | 3300031901 | Bacteria | 3795 |
| 486 | Ga0307406_10036423 | 3300031901 | Bacteria | 3031 |
| 487 | Ga0307407_10004107 | 3300031903 | Bacteria | 6125 |
| 488 | Ga0307407_10019115 | 3300031903 | Bacteria | 3482 |
| 489 | Ga0307407_10040428 | 3300031903 | Bacteria | 2600 |
| 490 | Ga0307407_10051333 | 3300031903 | Bacteria | 2363 |
| 491 | Ga0307412_10007668 | 3300031911 | Bacteria | 6130 |
| 492 | Ga0307412_10008746 | 3300031911 | Bacteria | 5794 |
| 493 | Ga0307412_10010587 | 3300031911 | Bacteria | 5314 |
| 494 | Ga0307412_10045050 | 3300031911 | Bacteria | 2881 |
| 495 | Ga0307412_10078260 | 3300031911 | Bacteria | 2277 |
| 496 | Ga0307412_10090273 | 3300031911 | Bacteria | 2141 |
| 497 | Ga0307409_100023016 | 3300031995 | Bacteria | 4307 |
| 498 | Ga0307409_100036824 | 3300031995 | Bacteria | 3600 |
| 499 | Ga0307409_100064704 | 3300031995 | Bacteria | 2874 |
| 500 | Ga0307416_100037671 | 3300032002 | Bacteria | 3723 |
| 501 | Ga0307416_100043746 | 3300032002 | Bacteria | 3510 |
| 502 | Ga0307416_100080138 | 3300032002 | Bacteria | 2754 |
| 503 | Ga0307416_100103237 | 3300032002 | Bacteria | 2488 |
| 504 | Ga0307416_100139612 | 3300032002 | Bacteria | 2200 |
| 505 | Ga0307414_10000346 | 3300032004 | Bacteria | 26022 |
| 506 | Ga0307414_10002088 | 3300032004 | Bacteria | 10396 |
| 507 | Ga0307414_10002337 | 3300032004 | Bacteria | 9908 |
| 508 | Ga0307414_10009428 | 3300032004 | Bacteria | 5608 |
| 509 | Ga0307414_10014644 | 3300032004 | Bacteria | 4710 |
| 510 | Ga0307414_10016059 | 3300032004 | Bacteria | 4539 |
| 511 | Ga0307414_10019577 | 3300032004 | Bacteria | 4197 |
| 512 | Ga0307414_10022219 | 3300032004 | Bacteria | 3997 |
| 513 | Ga0307414_10028125 | 3300032004 | Bacteria | 3642 |
| 514 | Ga0307414_10046312 | 3300032004 | Bacteria | 2984 |
| 515 | Ga0307414_10050216 | 3300032004 | Bacteria | 2888 |
| 516 | Ga0307414_10114411 | 3300032004 | Bacteria | 2061 |
| 517 | Ga0307411_10004783 | 3300032005 | Bacteria | 6558 |
| 518 | Ga0307411_10005751 | 3300032005 | Bacteria | 6131 |
| 519 | Ga0307411_10024249 | 3300032005 | Bacteria | 3612 |
| 520 | Ga0307411_10034144 | 3300032005 | Bacteria | 3162 |
| 521 | Ga0307411_10062055 | 3300032005 | Bacteria | 2491 |
| 522 | Ga0307411_10104906 | 3300032005 | Bacteria | 2008 |
| 523 | Ga0307415_100009023 | 3300032126 | Bacteria | 5563 |
| 524 | Ga0307415_100012323 | 3300032126 | Bacteria | 4939 |
| 525 | Ga0307415_100035245 | 3300032126 | Bacteria | 3267 |
| 526 | Ga0307415_100055878 | 3300032126 | Bacteria | 2703 |
| 527 | Ga0307510_10016486 | 3300033180 | Bacteria | 8721 |
| 528 | Ga0307510_10092283 | 3300033180 | Bacteria | 2865 |
| 529 | Ga0373943_0033198 | 3300035170 | Bacteria | 2457 |
| 530 | Ga0373946_0020771 | 3300035171 | Bacteria | 2541 |
| 531 | Ga0373935_0028704 | 3300035692 | Bacteria | 3439 |
| 532 | Ga0395900_0000503 | 3300037418 | Bacteria | 54976 |
| 533 | Ga0395905_0007001 | 3300037471 | Bacteria | 11273 |
| 534 | Ga0395905_0094244 | 3300037471 | Bacteria | 2809 |
| 535 | Ga0395901_0000520 | 3300038443 | Bacteria | 44464 |
| 536 | Ga0395901_0023161 | 3300038443 | Bacteria | 6367 |
| 537 | Ga0436365_1132330 | 3300039437 | Bacteria | 76795 |
| 538 | Ga0436365_1277439 | 3300039437 | Bacteria | 2584 |
| 539 | Ga0436365_1921522 | 3300039437 | Bacteria | 4700 |
| 540 | Ga0436362_0875621 | 3300039453 | Bacteria | 35060 |
| 541 | Ga0439461_0000190 | 3300041410 | Bacteria | 8487 |
| 542 | Ga0439465_0000420 | 3300041413 | Bacteria | 12395 |
| 543 | Ga0439431_0000645 | 3300041997 | Bacteria | 7421 |
| 544 | Ga0439432_018266 | 3300042006 | Bacteria | 2344 |
| 545 | Ga0439449_0014110 | 3300042007 | Bacteria | 3006 |
| 546 | Ga0439462_0000249 | 3300042015 | Bacteria | 9622 |
| 547 | Ga0439462_0001856 | 3300042015 | Bacteria | 4796 |
| 548 | Ga0439434_0000823 | 3300042435 | Bacteria | 8928 |
| 549 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 550 | Ga0495627_000158 | 3300046453 | Bacteria | 77210 |
| 551 | Ga0495627_000636 | 3300046453 | Bacteria | 27717 |
| 552 | Ga0495627_001522 | 3300046453 | Bacteria | 13320 |
| 553 | Ga0495629_0033426 | 3300046459 | Bacteria | 3638 |
| 554 | Ga0495638_0002237 | 3300046460 | Bacteria | 16075 |
| 555 | Ga0495650_0000492 | 3300046471 | Bacteria | 59983 |
| 556 | Ga0495650_0008181 | 3300046471 | Bacteria | 6147 |
| 557 | Ga0495650_0012961 | 3300046471 | Bacteria | 4445 |
| 558 | Ga0495662_0027591 | 3300046476 | Bacteria | 2743 |
| 559 | Ga0495596_0000141 | 3300046500 | Bacteria | 49474 |
| 560 | Ga0495596_0007033 | 3300046500 | Bacteria | 5112 |
| 561 | Ga0495583_0002564 | 3300046506 | Bacteria | 15303 |
| 562 | Ga0495583_0010721 | 3300046506 | Bacteria | 5318 |
| 563 | Ga0495583_0016240 | 3300046506 | Bacteria | 4013 |
| 564 | Ga0495606_0000359 | 3300046507 | Bacteria | 77863 |
| 565 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 566 | Ga0495610_0000071 | 3300046512 | Bacteria | 121210 |
| 567 | Ga0495610_0002395 | 3300046512 | Bacteria | 15792 |
| 568 | Ga0495610_0005363 | 3300046512 | Bacteria | 9148 |
| 569 | Ga0495610_0021839 | 3300046512 | Bacteria | 3512 |
| 570 | Ga0495610_0031373 | 3300046512 | Bacteria | 2773 |
| 571 | Ga0495620_0031636 | 3300046515 | Bacteria | 2422 |
| 572 | Ga0495632_0000211 | 3300046519 | Bacteria | 59066 |
| 573 | Ga0495637_0014469 | 3300046520 | Bacteria | 3723 |
| 574 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 575 | Ga0495643_0000132 | 3300046522 | Bacteria | 121567 |
| 576 | Ga0495643_0004044 | 3300046522 | Bacteria | 10460 |
| 577 | Ga0495643_0004426 | 3300046522 | Bacteria | 9829 |
| 578 | Ga0495643_0019902 | 3300046522 | Bacteria | 3879 |
| 579 | Ga0495648_0000256 | 3300046524 | Bacteria | 60519 |
| 580 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 581 | Ga0495663_0001269 | 3300046525 | Bacteria | 8015 |
| 582 | Ga0495654_0001382 | 3300046530 | Bacteria | 16825 |
| 583 | Ga0495640_0027903 | 3300046533 | Bacteria | 4067 |
| 584 | Ga0495609_0005528 | 3300046538 | Bacteria | 6604 |
| 585 | Ga0495621_0005314 | 3300046539 | Bacteria | 3691 |
| 586 | Ga0495633_0000983 | 3300046558 | Bacteria | 23405 |
| 587 | Ga0495633_0001072 | 3300046558 | Bacteria | 22116 |
| 588 | Ga0495633_0002904 | 3300046558 | Bacteria | 11752 |
| 589 | Ga0495633_0020069 | 3300046558 | Bacteria | 3367 |
| 590 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 591 | Ga0495668_0000163 | 3300046616 | Bacteria | 99607 |
| 592 | Ga0495668_0002911 | 3300046616 | Bacteria | 13507 |
| 593 | Ga0495668_0015770 | 3300046616 | Bacteria | 4405 |
| 594 | Ga0495668_0061841 | 3300046616 | Bacteria | 2064 |
| 595 | Ga0495668_0067068 | 3300046616 | Bacteria | 1974 |
| 596 | Ga0495634_0031949 | 3300046642 | Bacteria | 3623 |
| 597 | Ga0495625_0000332 | 3300046660 | Bacteria | 71947 |
| 598 | Ga0495625_0000553 | 3300046660 | Bacteria | 54796 |
| 599 | Ga0495625_0000568 | 3300046660 | Bacteria | 54059 |
| 600 | Ga0495625_0043887 | 3300046660 | Bacteria | 3239 |
| 601 | Ga0495625_0055633 | 3300046660 | Bacteria | 2821 |
| 602 | Ga0495669_0000629 | 3300046684 | Bacteria | 15335 |
| 603 | Ga0495670_0000007 | 3300046691 | Bacteria | 247088 |
| 604 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 605 | Ga0495589_0008334 | 3300046794 | Bacteria | 5416 |
| 606 | Ga0495600_0000914 | 3300046809 | Bacteria | 15826 |
| 607 | Ga0495674_0068220 | 3300047319 | Bacteria | 3078 |
| 608 | Ga0495687_000511 | 3300047443 | Bacteria | 46733 |
| 609 | Ga0495687_001938 | 3300047443 | Bacteria | 17742 |
| 610 | Ga0495677_0000956 | 3300047445 | Bacteria | 11629 |
| 611 | Ga0495681_0000008 | 3300047470 | Bacteria | 215295 |
| 612 | Ga0495681_0000094 | 3300047470 | Bacteria | 77400 |
| 613 | Ga0495681_0003826 | 3300047470 | Bacteria | 10415 |
| 614 | Ga0495681_0025529 | 3300047470 | Bacteria | 3089 |
| 615 | Ga0495686_0000013 | 3300047472 | Bacteria | 489656 |
| 616 | Ga0495686_0005293 | 3300047472 | Bacteria | 10228 |
| 617 | Ga0495686_0006390 | 3300047472 | Bacteria | 9035 |
| 618 | Ga0495615_0000239 | 3300048090 | Bacteria | 11254 |
| 619 | Ga0495615_0002333 | 3300048090 | Bacteria | 3029 |
| 620 | Ga0496101_0001612 | 3300048904 | Bacteria | 13571 |
| 621 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 622 | Ga0496102_0000120 | 3300048905 | Bacteria | 112432 |
| 623 | Ga0496102_0002374 | 3300048905 | Bacteria | 16067 |
| 624 | Ga0496102_0008515 | 3300048905 | Bacteria | 8793 |
| 625 | Ga0496103_0000095 | 3300048906 | Bacteria | 98260 |
| 626 | Ga0496103_0000154 | 3300048906 | Bacteria | 72239 |
| 627 | Ga0496103_0000984 | 3300048906 | Bacteria | 20114 |
| 628 | Ga0496103_0001305 | 3300048906 | Bacteria | 16975 |
| 629 | Ga0496103_0024978 | 3300048906 | Bacteria | 3608 |
| 630 | Ga0496104_0000060 | 3300048907 | Bacteria | 117966 |
| 631 | Ga0496104_0083563 | 3300048907 | Bacteria | 3045 |
| 632 | Ga0496105_0000274 | 3300048908 | Bacteria | 34048 |
| 633 | Ga0496107_0004473 | 3300048910 | Bacteria | 9480 |
| 634 | Ga0496108_0019377 | 3300048911 | Bacteria | 5586 |
| 635 | Ga0496110_0002630 | 3300048913 | Bacteria | 13523 |
| 636 | Ga0496110_0008273 | 3300048913 | Bacteria | 8364 |
| 637 | Ga0496111_0023431 | 3300048914 | Bacteria | 4334 |
| 638 | Ga0496112_0074755 | 3300048915 | Bacteria | 3351 |
| 639 | Ga0496112_0121955 | 3300048915 | Bacteria | 2577 |
| 640 | Ga0496113_0003962 | 3300048916 | Bacteria | 8994 |
| 641 | Ga0496115_0000134 | 3300048918 | Bacteria | 67910 |
| 642 | Ga0496115_0000172 | 3300048918 | Bacteria | 59971 |
| 643 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 644 | Ga0496116_0004809 | 3300048919 | Bacteria | 12742 |
| 645 | Ga0496116_0014370 | 3300048919 | Bacteria | 6328 |
| 646 | Ga0496117_0000317 | 3300048920 | Bacteria | 84472 |
| 647 | Ga0496117_0000366 | 3300048920 | Bacteria | 78816 |
| 648 | Ga0496117_0000582 | 3300048920 | Bacteria | 60157 |
| 649 | Ga0496117_0003953 | 3300048920 | Bacteria | 16753 |
| 650 | Ga0496118_0000303 | 3300048921 | Bacteria | 85332 |
| 651 | Ga0496118_0000392 | 3300048921 | Bacteria | 74074 |
| 652 | Ga0496118_0003549 | 3300048921 | Bacteria | 19478 |
| 653 | Ga0496118_0033548 | 3300048921 | Bacteria | 4209 |
| 654 | Ga0496119_0001213 | 3300048922 | Bacteria | 32201 |
| 655 | Ga0496119_0047407 | 3300048922 | Bacteria | 2674 |
| 656 | Ga0496120_0001109 | 3300048923 | Bacteria | 35064 |
| 657 | Ga0496121_0004566 | 3300048924 | Bacteria | 18476 |
| 658 | Ga0496121_0005396 | 3300048924 | Bacteria | 16416 |
| 659 | Ga0496121_0013959 | 3300048924 | Bacteria | 8580 |
| 660 | Ga0496122_0002369 | 3300048925 | Bacteria | 26990 |
| 661 | Ga0496122_0004287 | 3300048925 | Bacteria | 17866 |
| 662 | Ga0496122_0009082 | 3300048925 | Bacteria | 10542 |
| 663 | Ga0496122_0017843 | 3300048925 | Bacteria | 6599 |
| 664 | Ga0496123_0000518 | 3300048926 | Bacteria | 67308 |
| 665 | Ga0496123_0001557 | 3300048926 | Bacteria | 31501 |
| 666 | Ga0496123_0007047 | 3300048926 | Bacteria | 10696 |
| 667 | Ga0496124_0000214 | 3300048927 | Bacteria | 113007 |
| 668 | Ga0496124_0000606 | 3300048927 | Bacteria | 60251 |
| 669 | Ga0496124_0001819 | 3300048927 | Bacteria | 29505 |
| 670 | Ga0496124_0007214 | 3300048927 | Bacteria | 11876 |
| 671 | Ga0496124_0009700 | 3300048927 | Bacteria | 9855 |
| 672 | Ga0496124_0037659 | 3300048927 | Bacteria | 4204 |
| 673 | Ga0496125_0000666 | 3300048928 | Bacteria | 57200 |
| 674 | Ga0496125_0091998 | 3300048928 | Bacteria | 2269 |
| 675 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 676 | Ga0496126_0000294 | 3300048929 | Bacteria | 106327 |
| 677 | Ga0496126_0004606 | 3300048929 | Bacteria | 16354 |
| 678 | Ga0501292_000172 | 3300049515 | Bacteria | 10490 |
| 679 | Ga0501294_000303 | 3300049517 | Bacteria | 6028 |
| 680 | Ga0501300_000548 | 3300049523 | Bacteria | 5631 |
| 681 | Ga0501032_0001272 | 3300049569 | Bacteria | 20206 |
| 682 | Ga0501037_0005776 | 3300049573 | Bacteria | 9035 |
| 683 | Ga0501047_0003383 | 3300049581 | Bacteria | 15102 |
| 684 | Ga0501047_0051581 | 3300049581 | Bacteria | 3976 |
| 685 | Ga0501047_0156997 | 3300049581 | Bacteria | 2148 |
| 686 | Ga0501047_0181061 | 3300049581 | Bacteria | 1974 |
| 687 | Ga0501067_0000227 | 3300049583 | Bacteria | 31300 |
| 688 | Ga0501073_0000004 | 3300049589 | Bacteria | 261794 |
| 689 | Ga0501077_0000008 | 3300049593 | Bacteria | 106496 |
| 690 | Ga0501223_000495 | 3300049663 | Bacteria | 9553 |
| 691 | Ga0501223_000734 | 3300049663 | Bacteria | 7804 |
| 692 | Ga0501224_000006 | 3300049664 | Bacteria | 149611 |
| 693 | Ga0501233_000165 | 3300049668 | Bacteria | 9518 |
| 694 | Ga0501249_001926 | 3300049679 | Bacteria | 4218 |
| 695 | Ga0501257_000031 | 3300049686 | Bacteria | 40822 |
| 696 | Ga0501259_002260 | 3300049688 | Bacteria | 3158 |
| 697 | Ga0501261_000301 | 3300049690 | Bacteria | 6784 |
| 698 | Ga0501225_0000845 | 3300049705 | Bacteria | 9521 |
| 699 | Ga0501080_0000654 | 3300049742 | Bacteria | 27505 |
| 700 | Ga0501279_000239 | 3300049775 | Bacteria | 7546 |
| 701 | Ga0501280_000005 | 3300049776 | Bacteria | 85174 |
| 702 | Ga0501280_000342 | 3300049776 | Bacteria | 11591 |
| 703 | Ga0501281_00513 | 3300049777 | Bacteria | 3598 |
| 704 | Ga0501282_000535 | 3300049778 | Bacteria | 4462 |
| 705 | Ga0501283_000937 | 3300049779 | Bacteria | 3872 |
| 706 | Ga0501035_0023615 | 3300049822 | Bacteria | 5641 |
| 707 | Ga0501044_0000868 | 3300049823 | Bacteria | 36400 |
| 708 | Ga0501044_0011325 | 3300049823 | Bacteria | 9664 |
| 709 | nmdc:mga00v17_1761_c1 | 3300050491 | Bacteria | 11247 |
| 710 | nmdc:mga00v17_2745_c1 | 3300050491 | Bacteria | 4132 |
| 711 | nmdc:mga0k408_4871_c1 | 3300050493 | Bacteria | 7118 |
| 712 | nmdc:mga06z11_26_c1 | 3300050494 | Bacteria | 64283 |
| 713 | nmdc:mga04h51_118_c1 | 3300050495 | Bacteria | 23239 |
| 714 | nmdc:mga04h51_22_c1 | 3300050495 | Bacteria | 64371 |
| 715 | nmdc:mga07m45_22923_c1 | 3300050496 | Bacteria | 3410 |
| 716 | nmdc:mga07m45_403_c1 | 3300050496 | Bacteria | 17870 |
| 717 | nmdc:mga07m45_43825_c1 | 3300050496 | Bacteria | 2509 |
| 718 | nmdc:mga0qj67_18352_c1 | 3300050509 | Bacteria | 5331 |
| 719 | nmdc:mga0sz30_1259_c1 | 3300050516 | Bacteria | 9051 |
| 720 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 721 | Ga0500643_000030 | 3300053087 | Bacteria | 206784 |
| 722 | Ga0500643_001071 | 3300053087 | Bacteria | 16543 |
| 723 | Ga0500643_001104 | 3300053087 | Bacteria | 16160 |
| 724 | Ga0500643_002047 | 3300053087 | Bacteria | 10799 |
| 725 | Ga0500643_002494 | 3300053087 | Bacteria | 9443 |
| 726 | Ga0500643_002878 | 3300053087 | Bacteria | 8571 |
| 727 | Ga0500643_003295 | 3300053087 | Bacteria | 7838 |
| 728 | Ga0500643_006377 | 3300053087 | Bacteria | 4935 |
| 729 | Ga0500643_009984 | 3300053087 | Bacteria | 3577 |
| 730 | Ga0500643_023246 | 3300053087 | Bacteria | 1982 |
| 731 | Ga0500643_023489 | 3300053087 | Bacteria | 1969 |
| 732 | Ga0500566_0003635 | 3300053094 | Bacteria | 9199 |
| 733 | Ga0500641_0019379 | 3300053096 | Bacteria | 2572 |
| 734 | Ga0500556_0000049 | 3300053104 | Bacteria | 122572 |
| 735 | Ga0500592_000270 | 3300053116 | Bacteria | 9225 |
| 736 | Ga0500592_000280 | 3300053116 | Bacteria | 9035 |
| 737 | Ga0500594_0002630 | 3300053118 | Bacteria | 3902 |
| 738 | Ga0500594_0003469 | 3300053118 | Bacteria | 3466 |
| 739 | Ga0500595_001337 | 3300053119 | Bacteria | 13334 |
| 740 | Ga0500595_022036 | 3300053119 | Bacteria | 2264 |
| 741 | Ga0500597_007055 | 3300053120 | Bacteria | 3779 |
| 742 | Ga0500607_001726 | 3300053121 | Bacteria | 18994 |
| 743 | Ga0500607_002875 | 3300053121 | Bacteria | 13266 |
| 744 | Ga0500608_002406 | 3300053122 | Bacteria | 6808 |
| 745 | Ga0500608_004409 | 3300053122 | Bacteria | 5446 |
| 746 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 747 | Ga0500658_0000108 | 3300053134 | Bacteria | 38564 |
| 748 | Ga0500658_0002704 | 3300053134 | Bacteria | 6820 |
| 749 | Ga0500559_0002377 | 3300053136 | Bacteria | 9801 |
| 750 | Ga0500559_0006954 | 3300053136 | Bacteria | 5059 |
| 751 | Ga0500568_0001734 | 3300053139 | Bacteria | 13523 |
| 752 | Ga0500573_0000034 | 3300053140 | Bacteria | 113547 |
| 753 | Ga0500616_0003384 | 3300053153 | Bacteria | 12243 |
| 754 | Ga0500622_0006524 | 3300053156 | Bacteria | 6747 |
| 755 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 756 | Ga0500624_000024 | 3300053157 | Bacteria | 114404 |
| 757 | Ga0500624_000088 | 3300053157 | Bacteria | 47211 |
| 758 | Ga0500627_0000049 | 3300053158 | Bacteria | 58947 |
| 759 | Ga0500627_0000199 | 3300053158 | Bacteria | 17319 |
| 760 | Ga0500627_0000335 | 3300053158 | Bacteria | 12748 |
| 761 | Ga0500636_0006191 | 3300053177 | Bacteria | 6874 |
| 762 | Ga0500636_0008307 | 3300053177 | Bacteria | 6022 |
| 763 | Ga0500637_0000097 | 3300053178 | Bacteria | 31449 |
| 764 | Ga0500637_0007967 | 3300053178 | Bacteria | 5321 |
| 765 | Ga0500567_000103 | 3300053723 | Bacteria | 21300 |
| 766 | Ga0500625_000029 | 3300053729 | Bacteria | 54479 |
| 767 | Ga0500645_000173 | 3300053730 | Bacteria | 50903 |
| 768 | Ga0500645_000300 | 3300053730 | Bacteria | 35408 |
| 769 | Ga0500645_000452 | 3300053730 | Bacteria | 28126 |
| 770 | Ga0501082_0138497 | 3300060353 | Bacteria | 2112 |
| 771 | 2511130117 | 2510917021 | Bacteria | 5705459 |
| 772 | 2512642122 | 2512564014 | Bacteria | 4639632 |
| 773 | 2600202669 | 2599185354 | Bacteria | 4398675 |
| 774 | 2600226475 | 2599185359 | Bacteria | 4772316 |
| 775 | 2643726851 | 2643221541 | Bacteria | 5498788 |
| 776 | 2643820085 | 2643221560 | Bacteria | 4801179 |
| 777 | 2643836386 | 2643221563 | Bacteria | 4726935 |
| 778 | 2644040865 | 2643221605 | Bacteria | 4772303 |
| 779 | 2644046108 | 2643221606 | Bacteria | 5588032 |
| 780 | 2644052862 | 2643221608 | Bacteria | 4724829 |
| 781 | 2644128894 | 2643221622 | Bacteria | 4212502 |
| 782 | 2644393081 | 2643221671 | Bacteria | 5496681 |
| 783 | 2738712570 | 2738541275 | Bacteria | 4830863 |
| 784 | 2738850994 | 2738541301 | Bacteria | 4834102 |
| 785 | 2738866724 | 2738541304 | Bacteria | 4833665 |
| 786 | 2739299241 | 2738543022 | Bacteria | 4835059 |
| 787 | 2739360920 | 2738543033 | Bacteria | 4833336 |
| 788 | 2739650373 | 2739367664 | Bacteria | 4114334 |
| 789 | 2740028846 | 2739367865 | Bacteria | 4114482 |
| 790 | 2753764454 | 2751185897 | Bacteria | 5322941 |
| 791 | 2809063651 | 2808606401 | Bacteria | 4586670 |
| 792 | 2809079731 | 2808606404 | Bacteria | 4652788 |
| 793 | 2809084096 | 2808606405 | Bacteria | 4586632 |
| 794 | 2819553163 | 2818991438 | Bacteria | 5793701 |
| 795 | 2819712544 | 2818991466 | Bacteria | 4748179 |
| 796 | 2821449023 | 2821443989 | Bacteria | 7658172 |
| 797 | 2830077115 | 2830075706 | Bacteria | 3855215 |
| 798 | 2844536020 | 2844533157 | Bacteria | 7517899 |
| 799 | 2852653986 | 2852653556 | Bacteria | 4050083 |
| 800 | 2852683260 | 2852680915 | Bacteria | 4100189 |
| 801 | 2879166644 | 2879163058 | Bacteria | 4223965 |
| 802 | 2880519420 | 2880518877 | Bacteria | 5012590 |
| 803 | 2882808374 | 2882806704 | Bacteria | 3007728 |
| 804 | 2885428352 | 2885427238 | Bacteria | 2291351 |
| 805 | 2895882645 | 2895880812 | Bacteria | 11255272 |
| 806 | 2896430231 | 2896429255 | Bacteria | 2557483 |
| 807 | 2919711158 | 2919709256 | Bacteria | 4318106 |
| 808 | 2928030895 | 2928027323 | Bacteria | 4382488 |
| 809 | 2928103878 | 2928100450 | Bacteria | 4837635 |
| 810 | 2928527137 | 2928526807 | Bacteria | 4760224 |
| 811 | 2928961807 | 2928959182 | Bacteria | 4725774 |
| 812 | 2928969377 | 2928968154 | Bacteria | 4633371 |
| 813 | 2946788831 | 2946787523 | Bacteria | 4366789 |
| 814 | 2984557867 | 2984555340 | Bacteria | 4247089 |
| 815 | 2984567767 | 2984564862 | Bacteria | 4339992 |
| 816 | 2993358819 | 2993356040 | Bacteria | 4247105 |
| 817 | 8054304792 | 8054302542 | Bacteria | 5698134 |
| 818 | Ga0496122_0001187 | |||
| 819 | SwRhRL2b_contig_3540226 | |||
| 820 | SwRhRL2b_contig_3705000 | |||
| 821 | JGI24736J21556_1000121 | |||
| 822 | JGI24752J21851_1000155 | |||
| 823 | JGI24752J21851_1000461 | |||
| 824 | JGI24737J22298_10003404 | |||
| 825 | JGI24735J21928_10000918 | |||
| 826 | JGI24750J21931_1000359 | |||
| 827 | JGI24748J21848_1000044 | |||
| 828 | JGI24749J21850_1000330 | |||
| 829 | JGI24749J21850_1000531 | |||
| 830 | JGI24034J26672_10000020 | |||
| 831 | JGI24742J22300_10001043 | |||
| 832 | JGI24751J29686_10000052 | |||
| 833 | JGI25150J39212_1000046 | |||
| 834 | JGI25159J45721_1007784 | |||
| 835 | JGI25151J46595_10001638 | |||
| 836 | JGI25165J46597_1000073 | |||
| 837 | JGI25153J46596_10000006 | |||
| 838 | JGI25153J46596_10000124 | |||
| 839 | Ga0055525_1000090 | |||
| 840 | Ga0055542_1000046 | |||
| 841 | Ga0055529_1000007 | |||
| 842 | Ga0055529_1000109 | |||
| 843 | Ga0055526_1007061 | |||
| 844 | Ga0055524_1001907 | |||
| 845 | Ga0055536_1003381 | |||
| 846 | Ga0055536_1006713 | |||
| 847 | Ga0055536_1008867 | |||
| 848 | Ga0055530_10001655 | |||
| 849 | Ga0055530_10002492 | |||
| 850 | Ga0055530_10013862 | |||
| 851 | Ga0055540_1003937 | |||
| 852 | Ga0055531_10000008 | |||
| 853 | Ga0055531_10001714 | |||
| 854 | Ga0055531_10001722 | |||
| 855 | Ga0055531_10009693 | |||
| 856 | Ga0065165_1001443 | |||
| 857 | Ga0065165_1002698 | |||
| 858 | Ga0065704_10000191 | |||
| 859 | Ga0065704_10070744 | |||
| 860 | Ga0065704_10081289 | |||
| 861 | Ga0065704_10100052 | |||
| 862 | Ga0065715_10000978 | |||
| 863 | Ga0065707_10081865 | |||
| 864 | Ga0065707_10086251 | |||
| 865 | Ga0070658_10000227 | |||
| 866 | Ga0070658_10024952 | |||
| 867 | Ga0070676_10007834 | |||
| 868 | Ga0070690_100000180 | |||
| 869 | Ga0070670_100000024 | |||
| 870 | Ga0070670_100000792 | |||
| 871 | Ga0070670_100003165 | |||
| 872 | Ga0070670_100005522 | |||
| 873 | Ga0070670_100032156 | |||
| 874 | Ga0070670_100052533 | |||
| 875 | Ga0070670_100087376 | |||
| 876 | Ga0070677_10001757 | |||
| 877 | Ga0070666_10000027 | |||
| 878 | Ga0070666_10000352 | |||
| 879 | Ga0070666_10010284 | |||
| 880 | Ga0070666_10029018 | |||
| 881 | Ga0070660_100004165 | |||
| 882 | Ga0070689_100008132 | |||
| 883 | Ga0070661_100000010 | |||
| 884 | Ga0070661_100002364 | |||
| 885 | Ga0070661_100015823 | |||
| 886 | Ga0070661_100026844 | |||
| 887 | Ga0070668_100000027 | |||
| 888 | Ga0070668_100000068 | |||
| 889 | Ga0070668_100000646 | |||
| 890 | Ga0070668_100004087 | |||
| 891 | Ga0070668_100019269 | |||
| 892 | Ga0070668_100019894 | |||
| 893 | Ga0070668_100066155 | |||
| 894 | Ga0070669_100000018 | |||
| 895 | Ga0070669_100000047 | |||
| 896 | Ga0070669_100000099 | |||
| 897 | Ga0070669_100001232 | |||
| 898 | Ga0070669_100016595 | |||
| 899 | Ga0070669_100021839 | |||
| 900 | Ga0070675_100004161 | |||
| 901 | Ga0070675_100012526 | |||
| 902 | Ga0070675_100023281 | |||
| 903 | Ga0070671_100000011 | |||
| 904 | Ga0070671_100000353 | |||
| 905 | Ga0070671_100001241 | |||
| 906 | Ga0070671_100004632 | |||
| 907 | Ga0070671_100008988 | |||
| 908 | Ga0070673_100029291 | |||
| 909 | Ga0070673_100032493 | |||
| 910 | Ga0070688_100000293 | |||
| 911 | Ga0070659_100013031 | |||
| 912 | Ga0070667_100000017 | |||
| 913 | Ga0070667_100000066 | |||
| 914 | Ga0070667_100000067 | |||
| 915 | Ga0070667_100000290 | |||
| 916 | Ga0070667_100000459 | |||
| 917 | Ga0070667_100000480 | |||
| 918 | Ga0070667_100001292 | |||
| 919 | Ga0070667_100011712 | |||
| 920 | Ga0070667_100012620 | |||
| 921 | Ga0070667_100019588 | |||
| 922 | Ga0070678_100000076 | |||
| 923 | Ga0070662_100005311 | |||
| 924 | Ga0070662_100058572 | |||
| 925 | Ga0070681_10089493 | |||
| 926 | Ga0070685_10000238 | |||
| 927 | Ga0070679_100000168 | |||
| 928 | Ga0070679_100165301 | |||
| 929 | Ga0068853_100002669 | |||
| 930 | Ga0068853_100020182 | |||
| 931 | Ga0070672_100003237 | |||
| 932 | Ga0070686_100000010 | |||
| 933 | Ga0070695_100075744 | |||
| 934 | Ga0070665_100000086 | |||
| 935 | Ga0070665_100000254 | |||
| 936 | Ga0070665_100002933 | |||
| 937 | Ga0070665_100013328 | |||
| 938 | Ga0070665_100015010 | |||
| 939 | Ga0070664_100009278 | |||
| 940 | Ga0070664_100090692 | |||
| 941 | Ga0068854_100013256 | |||
| 942 | Ga0068852_100034615 | |||
| 943 | Ga0068852_100156023 | |||
| 944 | Ga0068859_100002363 | |||
| 945 | Ga0068859_100004889 | |||
| 946 | Ga0068859_100006146 | |||
| 947 | Ga0068859_100013485 | |||
| 948 | Ga0068859_100020790 | |||
| 949 | Ga0068859_100027164 | |||
| 950 | Ga0068859_100109660 | |||
| 951 | Ga0068859_100169626 | |||
| 952 | Ga0068864_100000036 | |||
| 953 | Ga0068864_100000063 | |||
| 954 | Ga0068864_100001646 | |||
| 955 | Ga0068864_100003044 | |||
| 956 | Ga0068861_100000005 | |||
| 957 | Ga0068861_100002905 | |||
| 958 | Ga0068861_100007125 | |||
| 959 | Ga0068861_100013995 | |||
| 960 | Ga0068863_100000001 | |||
| 961 | Ga0068863_100000038 | |||
| 962 | Ga0068863_100000062 | |||
| 963 | Ga0068863_100000603 | |||
| 964 | Ga0068863_100000775 | |||
| 965 | Ga0068863_100003283 | |||
| 966 | Ga0068863_100006015 | |||
| 967 | Ga0068863_100006939 | |||
| 968 | Ga0068863_100008950 | |||
| 969 | Ga0068863_100010531 | |||
| 970 | Ga0068863_100011823 | |||
| 971 | Ga0068858_100000103 | |||
| 972 | Ga0068858_100000530 | |||
| 973 | Ga0068858_100000777 | |||
| 974 | Ga0068858_100003512 | |||
| 975 | Ga0068860_100000013 | |||
| 976 | Ga0068860_100000056 | |||
| 977 | Ga0068860_100000080 | |||
| 978 | Ga0068860_100024655 | |||
| 979 | Ga0068862_100000033 | |||
| 980 | Ga0068862_100000069 | |||
| 981 | Ga0068862_100000115 | |||
| 982 | Ga0068862_100000485 | |||
| 983 | Ga0068862_100004188 | |||
| 984 | Ga0068862_100005376 | |||
| 985 | Ga0068862_100005633 | |||
| 986 | Ga0068862_100012106 | |||
| 987 | Ga0068862_100018068 | |||
| 988 | Ga0068862_100030185 | |||
| 989 | Ga0068862_100032674 | |||
| 990 | Ga0068862_100059599 | |||
| 991 | Ga0081455_10002228 | |||
| 992 | Ga0081539_10018190 | |||
| 993 | Ga0081539_10019805 | |||
| 994 | Ga0075368_10000704 | |||
| 995 | Ga0075367_10000042 | |||
| 996 | Ga0075366_10004887 | |||
| 997 | Ga0075366_10012022 | |||
| 998 | Ga0075370_10024116 | |||
| 999 | Ga0075430_100018966 | |||
| 1000 | Ga0075431_100007563 | |||
| 1001 | Ga0097620_100002363 | |||
| 1002 | Ga0097620_100004889 | |||
| 1003 | Ga0097620_100006146 | |||
| 1004 | Ga0097620_100013486 | |||
| 1005 | Ga0097620_100020789 | |||
| 1006 | Ga0097620_100027165 | |||
| 1007 | Ga0097620_100109659 | |||
| 1008 | Ga0097620_100169630 | |||
| 1009 | Ga0105251_10001006 | |||
| 1010 | Ga0111539_10000017 | |||
| 1011 | Ga0111539_10029495 | |||
| 1012 | Ga0105245_10002260 | |||
| 1013 | Ga0105247_10004862 | |||
| 1014 | Ga0105247_10016928 | |||
| 1015 | Ga0105243_10000224 | |||
| 1016 | Ga0105241_10097937 | |||
| 1017 | Ga0105248_10000091 | |||
| 1018 | Ga0105248_10000536 | |||
| 1019 | Ga0105248_10003098 | |||
| 1020 | Ga0105248_10008150 | |||
| 1021 | Ga0105248_10009842 | |||
| 1022 | Ga0105248_10025435 | |||
| 1023 | Ga0105248_10036917 | |||
| 1024 | Ga0105237_10050794 | |||
| 1025 | Ga0105238_10047095 | |||
| 1026 | Ga0105238_10062799 | |||
| 1027 | Ga0105249_10000064 | |||
| 1028 | Ga0105249_10000160 | |||
| 1029 | Ga0105249_10000567 | |||
| 1030 | Ga0105249_10017175 | |||
| 1031 | Ga0105249_10025445 | |||
| 1032 | Ga0105249_10040062 | |||
| 1033 | Ga0105249_10064607 | |||
| 1034 | Ga0105239_10113654 | |||
| 1035 | Ga0157326_1000059 | |||
| 1036 | Ga0157373_10009216 | |||
| 1037 | Ga0157371_10000097 | |||
| 1038 | Ga0157369_10025937 | |||
| 1039 | Ga0157378_10003298 | |||
| 1040 | Ga0157378_10094681 | |||
| 1041 | Ga0163162_10035914 | |||
| 1042 | Ga0163162_10048106 | |||
| 1043 | Ga0163162_10085262 | |||
| 1044 | Ga0157372_10214297 | |||
| 1045 | Ga0163163_10000107 | |||
| 1046 | Ga0157380_10000086 | |||
| 1047 | Ga0157380_10000217 | |||
| 1048 | Ga0157380_10003002 | |||
| 1049 | Ga0157380_10003455 | |||
| 1050 | Ga0157380_10013463 | |||
| 1051 | Ga0157380_10051349 | |||
| 1052 | Ga0157379_10009125 | |||
| 1053 | Ga0157379_10065983 | |||
| 1054 | Ga0183363_1001 | |||
| 1055 | Ga0163161_10000110 | |||
| 1056 | Ga0163161_10103664 | |||
| 1057 | Ga0213873_10000015 | |||
| 1058 | Ga0213876_10000005 | |||
| 1059 | Ga0209147_100321 | |||
| 1060 | Ga0209563_100111 | |||
| 1061 | Ga0207425_1000020 | |||
| 1062 | Ga0209646_1004636 | |||
| 1063 | Ga0209148_1000026 | |||
| 1064 | Ga0209129_1000586 | |||
| 1065 | Ga0209233_1000142 | |||
| 1066 | Ga0209565_1000008 | |||
| 1067 | Ga0209565_1000210 | |||
| 1068 | Ga0209455_1000005 | |||
| 1069 | Ga0209673_1000984 | |||
| 1070 | Ga0209130_1000512 | |||
| 1071 | Ga0209675_1000838 | |||
| 1072 | Ga0209676_1000518 | |||
| 1073 | Ga0209676_1000554 | |||
| 1074 | Ga0209676_1000929 | |||
| 1075 | Ga0209676_1008339 | |||
| 1076 | Ga0209025_1000114 | |||
| 1077 | Ga0209025_1000326 | |||
| 1078 | Ga0209564_1001114 | |||
| 1079 | Ga0209758_1000001 | |||
| 1080 | Ga0209758_1000004 | |||
| 1081 | Ga0209758_1001428 | |||
| 1082 | Ga0209758_1017781 | |||
| 1083 | Ga0209050_1000001 | |||
| 1084 | Ga0209050_1000017 | |||
| 1085 | Ga0209050_1000026 | |||
| 1086 | Ga0209050_1002610 | |||
| 1087 | Ga0209050_1008085 | |||
| 1088 | Ga0209050_1014081 | |||
| 1089 | Ga0209256_1000009 | |||
| 1090 | Ga0209256_1000010 | |||
| 1091 | Ga0207426_1000181 | |||
| 1092 | Ga0209051_1000476 | |||
| 1093 | Ga0209257_1000009 | |||
| 1094 | Ga0209257_1001405 | |||
| 1095 | Ga0209257_1002894 | |||
| 1096 | Ga0209257_1003790 | |||
| 1097 | Ga0209257_1005509 | |||
| 1098 | Ga0207697_10000211 | |||
| 1099 | Ga0207697_10003297 | |||
| 1100 | Ga0207713_1001151 | |||
| 1101 | Ga0207713_1002611 | |||
| 1102 | Ga0207682_10002080 | |||
| 1103 | Ga0207710_10002208 | |||
| 1104 | Ga0207710_10008695 | |||
| 1105 | Ga0207710_10034094 | |||
| 1106 | Ga0207680_10000009 | |||
| 1107 | Ga0207680_10023993 | |||
| 1108 | Ga0207680_10049495 | |||
| 1109 | Ga0207647_10031699 | |||
| 1110 | Ga0207645_10004405 | |||
| 1111 | Ga0207645_10012931 | |||
| 1112 | Ga0207705_10000450 | |||
| 1113 | Ga0207705_10051400 | |||
| 1114 | Ga0207654_10004079 | |||
| 1115 | Ga0207707_10075179 | |||
| 1116 | Ga0207707_10090256 | |||
| 1117 | Ga0207671_10006655 | |||
| 1118 | Ga0207671_10014738 | |||
| 1119 | Ga0207657_10009966 | |||
| 1120 | Ga0207657_10011805 | |||
| 1121 | Ga0207657_10022107 | |||
| 1122 | Ga0207649_10000178 | |||
| 1123 | Ga0207649_10002255 | |||
| 1124 | Ga0207652_10000282 | |||
| 1125 | Ga0207681_10000008 | |||
| 1126 | Ga0207681_10000014 | |||
| 1127 | Ga0207681_10000106 | |||
| 1128 | Ga0207681_10000259 | |||
| 1129 | Ga0207681_10027414 | |||
| 1130 | Ga0207681_10053593 | |||
| 1131 | Ga0207694_10020172 | |||
| 1132 | Ga0207694_10023064 | |||
| 1133 | Ga0207694_10025520 | |||
| 1134 | Ga0207650_10000015 | |||
| 1135 | Ga0207650_10015218 | |||
| 1136 | Ga0207650_10018925 | |||
| 1137 | Ga0207650_10020051 | |||
| 1138 | Ga0207650_10032859 | |||
| 1139 | Ga0207650_10035934 | |||
| 1140 | Ga0207659_10045306 | |||
| 1141 | Ga0207659_10054702 | |||
| 1142 | Ga0207644_10000006 | |||
| 1143 | Ga0207644_10000544 | |||
| 1144 | Ga0207644_10000574 | |||
| 1145 | Ga0207644_10003236 | |||
| 1146 | Ga0207644_10003746 | |||
| 1147 | Ga0207644_10008789 | |||
| 1148 | Ga0207644_10033072 | |||
| 1149 | Ga0207690_10004587 | |||
| 1150 | Ga0207706_10004467 | |||
| 1151 | Ga0207706_10006993 | |||
| 1152 | Ga0207706_10014593 | |||
| 1153 | Ga0207706_10031363 | |||
| 1154 | Ga0207706_10092745 | |||
| 1155 | Ga0207706_10120023 | |||
| 1156 | Ga0207709_10000519 | |||
| 1157 | Ga0207709_10011498 | |||
| 1158 | Ga0207670_10010660 | |||
| 1159 | Ga0207669_10000161 | |||
| 1160 | Ga0207669_10006712 | |||
| 1161 | Ga0207669_10083879 | |||
| 1162 | Ga0207691_10004823 | |||
| 1163 | Ga0207691_10005772 | |||
| 1164 | Ga0207711_10000017 | |||
| 1165 | Ga0207711_10000252 | |||
| 1166 | Ga0207711_10003251 | |||
| 1167 | Ga0207711_10003634 | |||
| 1168 | Ga0207711_10018314 | |||
| 1169 | Ga0207711_10023381 | |||
| 1170 | Ga0207711_10041275 | |||
| 1171 | Ga0207711_10074113 | |||
| 1172 | Ga0207711_10075264 | |||
| 1173 | Ga0207689_10093863 | |||
| 1174 | Ga0207661_10114574 | |||
| 1175 | Ga0207679_10004610 | |||
| 1176 | Ga0207667_10000010 | |||
| 1177 | Ga0207667_10014565 | |||
| 1178 | Ga0207667_10105697 | |||
| 1179 | Ga0207712_10000008 | |||
| 1180 | Ga0207712_10000044 | |||
| 1181 | Ga0207712_10000222 | |||
| 1182 | Ga0207712_10006379 | |||
| 1183 | Ga0207712_10009432 | |||
| 1184 | Ga0207712_10015834 | |||
| 1185 | Ga0207712_10038733 | |||
| 1186 | Ga0207668_10000012 | |||
| 1187 | Ga0207668_10000629 | |||
| 1188 | Ga0207668_10000860 | |||
| 1189 | Ga0207668_10001683 | |||
| 1190 | Ga0207668_10002528 | |||
| 1191 | Ga0207668_10003159 | |||
| 1192 | Ga0207668_10009770 | |||
| 1193 | Ga0207668_10041715 | |||
| 1194 | Ga0207668_10052374 | |||
| 1195 | Ga0207668_10055215 | |||
| 1196 | Ga0207668_10068228 | |||
| 1197 | Ga0207668_10074452 | |||
| 1198 | Ga0207668_10085580 | |||
| 1199 | Ga0207640_10009509 | |||
| 1200 | Ga0207640_10009819 | |||
| 1201 | Ga0207658_10000011 | |||
| 1202 | Ga0207658_10000089 | |||
| 1203 | Ga0207658_10000132 | |||
| 1204 | Ga0207658_10000133 | |||
| 1205 | Ga0207658_10000291 | |||
| 1206 | Ga0207658_10002473 | |||
| 1207 | Ga0207658_10002564 | |||
| 1208 | Ga0207658_10009504 | |||
| 1209 | Ga0207658_10012206 | |||
| 1210 | Ga0207658_10025815 | |||
| 1211 | Ga0207658_10026771 | |||
| 1212 | Ga0207658_10033271 | |||
| 1213 | Ga0207703_10000691 | |||
| 1214 | Ga0207703_10001013 | |||
| 1215 | Ga0207703_10003167 | |||
| 1216 | Ga0207639_10026227 | |||
| 1217 | Ga0207639_10026739 | |||
| 1218 | Ga0207678_10020460 | |||
| 1219 | Ga0207702_10007378 | |||
| 1220 | Ga0207702_10032064 | |||
| 1221 | Ga0207641_10000001 | |||
| 1222 | Ga0207641_10000022 | |||
| 1223 | Ga0207641_10000047 | |||
| 1224 | Ga0207641_10000060 | |||
| 1225 | Ga0207641_10001074 | |||
| 1226 | Ga0207641_10002092 | |||
| 1227 | Ga0207641_10004584 | |||
| 1228 | Ga0207641_10006843 | |||
| 1229 | Ga0207641_10016494 | |||
| 1230 | Ga0207641_10018011 | |||
| 1231 | Ga0207676_10000021 | |||
| 1232 | Ga0207676_10000056 | |||
| 1233 | Ga0207676_10000827 | |||
| 1234 | Ga0207676_10000894 | |||
| 1235 | Ga0207676_10001517 | |||
| 1236 | Ga0207676_10002294 | |||
| 1237 | Ga0207674_10007137 | |||
| 1238 | Ga0207674_10069644 | |||
| 1239 | Ga0207674_10084252 | |||
| 1240 | Ga0207675_100000020 | |||
| 1241 | Ga0207675_100000207 | |||
| 1242 | Ga0207675_100002282 | |||
| 1243 | Ga0207675_100004785 | |||
| 1244 | Ga0207675_100084771 | |||
| 1245 | Ga0207675_100150282 | |||
| 1246 | Ga0207683_10000655 | |||
| 1247 | Ga0207683_10033010 | |||
| 1248 | Ga0207698_10051391 | |||
| 1249 | Ga0209813_10000042 | |||
| 1250 | Ga0209813_10000126 | |||
| 1251 | Ga0209974_10003218 | |||
| 1252 | Ga0209974_10003430 | |||
| 1253 | Ga0268266_10000002 | |||
| 1254 | Ga0268266_10000069 | |||
| 1255 | Ga0268266_10004036 | |||
| 1256 | Ga0268266_10011818 | |||
| 1257 | Ga0268266_10016904 | |||
| 1258 | Ga0268265_10000013 | |||
| 1259 | Ga0268265_10000044 | |||
| 1260 | Ga0268265_10000082 | |||
| 1261 | Ga0268265_10000100 | |||
| 1262 | Ga0268265_10000958 | |||
| 1263 | Ga0268265_10006174 | |||
| 1264 | Ga0268265_10006969 | |||
| 1265 | Ga0268264_10000010 | |||
| 1266 | Ga0268264_10000039 | |||
| 1267 | Ga0268264_10000089 | |||
| 1268 | Ga0268264_10000131 | |||
| 1269 | Ga0268264_10000933 | |||
| 1270 | Ga0268264_10000935 | |||
| 1271 | Ga0268264_10021281 | |||
| 1272 | Ga0268264_10053953 | |||
| 1273 | Ga0307513_10075874 | |||
| 1274 | Ga0307509_10000115 | |||
| 1275 | Ga0307408_100015727 | |||
| 1276 | Ga0307408_100017748 | |||
| 1277 | Ga0307408_100019173 | |||
| 1278 | Ga0307408_100087906 | |||
| 1279 | Ga0307508_10025163 | |||
| 1280 | Ga0307405_10000391 | |||
| 1281 | Ga0307405_10010450 | |||
| 1282 | Ga0307405_10041028 | |||
| 1283 | Ga0307405_10054567 | |||
| 1284 | Ga0307413_10001504 | |||
| 1285 | Ga0307413_10007329 | |||
| 1286 | Ga0307413_10007679 | |||
| 1287 | Ga0307413_10012702 | |||
| 1288 | Ga0307413_10028311 | |||
| 1289 | Ga0307413_10029103 | |||
| 1290 | Ga0307413_10051241 | |||
| 1291 | Ga0307410_10000684 | |||
| 1292 | Ga0307410_10002446 | |||
| 1293 | Ga0307410_10003698 | |||
| 1294 | Ga0307410_10004043 | |||
| 1295 | Ga0307410_10014143 | |||
| 1296 | Ga0307410_10019814 | |||
| 1297 | Ga0307410_10021645 | |||
| 1298 | Ga0307410_10033329 | |||
| 1299 | Ga0307410_10037184 | |||
| 1300 | Ga0307410_10074721 | |||
| 1301 | Ga0307406_10019894 | |||
| 1302 | Ga0307406_10021789 | |||
| 1303 | Ga0307406_10036423 | |||
| 1304 | Ga0307407_10004107 | |||
| 1305 | Ga0307407_10019115 | |||
| 1306 | Ga0307407_10040428 | |||
| 1307 | Ga0307407_10051333 | |||
| 1308 | Ga0307412_10007668 | |||
| 1309 | Ga0307412_10008746 | |||
| 1310 | Ga0307412_10010587 | |||
| 1311 | Ga0307412_10045050 | |||
| 1312 | Ga0307412_10078260 | |||
| 1313 | Ga0307412_10090273 | |||
| 1314 | Ga0307409_100023016 | |||
| 1315 | Ga0307409_100036824 | |||
| 1316 | Ga0307409_100064704 | |||
| 1317 | Ga0307416_100037671 | |||
| 1318 | Ga0307416_100043746 | |||
| 1319 | Ga0307416_100080138 | |||
| 1320 | Ga0307416_100103237 | |||
| 1321 | Ga0307416_100139612 | |||
| 1322 | Ga0307414_10000346 | |||
| 1323 | Ga0307414_10002088 | |||
| 1324 | Ga0307414_10002337 | |||
| 1325 | Ga0307414_10009428 | |||
| 1326 | Ga0307414_10014644 | |||
| 1327 | Ga0307414_10016059 | |||
| 1328 | Ga0307414_10019577 | |||
| 1329 | Ga0307414_10022219 | |||
| 1330 | Ga0307414_10028125 | |||
| 1331 | Ga0307414_10046312 | |||
| 1332 | Ga0307414_10050216 | |||
| 1333 | Ga0307414_10114411 | |||
| 1334 | Ga0307411_10004783 | |||
| 1335 | Ga0307411_10005751 | |||
| 1336 | Ga0307411_10024249 | |||
| 1337 | Ga0307411_10034144 | |||
| 1338 | Ga0307411_10062055 | |||
| 1339 | Ga0307411_10104906 | |||
| 1340 | Ga0307415_100009023 | |||
| 1341 | Ga0307415_100012323 | |||
| 1342 | Ga0307415_100035245 | |||
| 1343 | Ga0307415_100055878 | |||
| 1344 | Ga0307510_10016486 | |||
| 1345 | Ga0307510_10092283 | |||
| 1346 | Ga0373943_0033198 | |||
| 1347 | Ga0373946_0020771 | |||
| 1348 | Ga0373935_0028704 | |||
| 1349 | Ga0395900_0000503 | |||
| 1350 | Ga0395905_0007001 | |||
| 1351 | Ga0395905_0094244 | |||
| 1352 | Ga0395901_0000520 | |||
| 1353 | Ga0395901_0023161 | |||
| 1354 | Ga0436365_1132330 | |||
| 1355 | Ga0436365_1277439 | |||
| 1356 | Ga0436365_1921522 | |||
| 1357 | Ga0436362_0875621 | |||
| 1358 | Ga0439461_0000190 | |||
| 1359 | Ga0439465_0000420 | |||
| 1360 | Ga0439431_0000645 | |||
| 1361 | Ga0439432_018266 | |||
| 1362 | Ga0439449_0014110 | |||
| 1363 | Ga0439462_0000249 | |||
| 1364 | Ga0439462_0001856 | |||
| 1365 | Ga0439434_0000823 | |||
| 1366 | Ga0451576_0000023 | |||
| 1367 | Ga0495627_000158 | |||
| 1368 | Ga0495627_000636 | |||
| 1369 | Ga0495627_001522 | |||
| 1370 | Ga0495629_0033426 | |||
| 1371 | Ga0495638_0002237 | |||
| 1372 | Ga0495650_0000492 | |||
| 1373 | Ga0495650_0008181 | |||
| 1374 | Ga0495650_0012961 | |||
| 1375 | Ga0495662_0027591 | |||
| 1376 | Ga0495596_0000141 | |||
| 1377 | Ga0495596_0007033 | |||
| 1378 | Ga0495583_0002564 | |||
| 1379 | Ga0495583_0010721 | |||
| 1380 | Ga0495583_0016240 | |||
| 1381 | Ga0495606_0000359 | |||
| 1382 | Ga0495610_0000020 | |||
| 1383 | Ga0495610_0000071 | |||
| 1384 | Ga0495610_0002395 | |||
| 1385 | Ga0495610_0005363 | |||
| 1386 | Ga0495610_0021839 | |||
| 1387 | Ga0495610_0031373 | |||
| 1388 | Ga0495620_0031636 | |||
| 1389 | Ga0495632_0000211 | |||
| 1390 | Ga0495637_0014469 | |||
| 1391 | Ga0495643_0000053 | |||
| 1392 | Ga0495643_0000132 | |||
| 1393 | Ga0495643_0004044 | |||
| 1394 | Ga0495643_0004426 | |||
| 1395 | Ga0495643_0019902 | |||
| 1396 | Ga0495648_0000256 | |||
| 1397 | Ga0495663_0000020 | |||
| 1398 | Ga0495663_0001269 | |||
| 1399 | Ga0495654_0001382 | |||
| 1400 | Ga0495640_0027903 | |||
| 1401 | Ga0495609_0005528 | |||
| 1402 | Ga0495621_0005314 | |||
| 1403 | Ga0495633_0000983 | |||
| 1404 | Ga0495633_0001072 | |||
| 1405 | Ga0495633_0002904 | |||
| 1406 | Ga0495633_0020069 | |||
| 1407 | Ga0495668_0000004 | |||
| 1408 | Ga0495668_0000163 | |||
| 1409 | Ga0495668_0002911 | |||
| 1410 | Ga0495668_0015770 | |||
| 1411 | Ga0495668_0061841 | |||
| 1412 | Ga0495668_0067068 | |||
| 1413 | Ga0495634_0031949 | |||
| 1414 | Ga0495625_0000332 | |||
| 1415 | Ga0495625_0000553 | |||
| 1416 | Ga0495625_0000568 | |||
| 1417 | Ga0495625_0043887 | |||
| 1418 | Ga0495625_0055633 | |||
| 1419 | Ga0495669_0000629 | |||
| 1420 | Ga0495670_0000007 | |||
| 1421 | Ga0495671_0000031 | |||
| 1422 | Ga0495589_0008334 | |||
| 1423 | Ga0495600_0000914 | |||
| 1424 | Ga0495674_0068220 | |||
| 1425 | Ga0495687_000511 | |||
| 1426 | Ga0495687_001938 | |||
| 1427 | Ga0495677_0000956 | |||
| 1428 | Ga0495681_0000008 | |||
| 1429 | Ga0495681_0000094 | |||
| 1430 | Ga0495681_0003826 | |||
| 1431 | Ga0495681_0025529 | |||
| 1432 | Ga0495686_0000013 | |||
| 1433 | Ga0495686_0005293 | |||
| 1434 | Ga0495686_0006390 | |||
| 1435 | Ga0495615_0000239 | |||
| 1436 | Ga0495615_0002333 | |||
| 1437 | Ga0496101_0001612 | |||
| 1438 | Ga0496102_0000106 | |||
| 1439 | Ga0496102_0000120 | |||
| 1440 | Ga0496102_0002374 | |||
| 1441 | Ga0496102_0008515 | |||
| 1442 | Ga0496103_0000095 | |||
| 1443 | Ga0496103_0000154 | |||
| 1444 | Ga0496103_0000984 | |||
| 1445 | Ga0496103_0001305 | |||
| 1446 | Ga0496103_0024978 | |||
| 1447 | Ga0496104_0000060 | |||
| 1448 | Ga0496104_0083563 | |||
| 1449 | Ga0496105_0000274 | |||
| 1450 | Ga0496107_0004473 | |||
| 1451 | Ga0496108_0019377 | |||
| 1452 | Ga0496110_0002630 | |||
| 1453 | Ga0496110_0008273 | |||
| 1454 | Ga0496111_0023431 | |||
| 1455 | Ga0496112_0074755 | |||
| 1456 | Ga0496112_0121955 | |||
| 1457 | Ga0496113_0003962 | |||
| 1458 | Ga0496115_0000134 | |||
| 1459 | Ga0496115_0000172 | |||
| 1460 | Ga0496116_0000028 | |||
| 1461 | Ga0496116_0004809 | |||
| 1462 | Ga0496116_0014370 | |||
| 1463 | Ga0496117_0000317 | |||
| 1464 | Ga0496117_0000366 | |||
| 1465 | Ga0496117_0000582 | |||
| 1466 | Ga0496117_0003953 | |||
| 1467 | Ga0496118_0000303 | |||
| 1468 | Ga0496118_0000392 | |||
| 1469 | Ga0496118_0003549 | |||
| 1470 | Ga0496118_0033548 | |||
| 1471 | Ga0496119_0001213 | |||
| 1472 | Ga0496119_0047407 | |||
| 1473 | Ga0496120_0001109 | |||
| 1474 | Ga0496121_0004566 | |||
| 1475 | Ga0496121_0005396 | |||
| 1476 | Ga0496121_0013959 | |||
| 1477 | Ga0496122_0002369 | |||
| 1478 | Ga0496122_0004287 | |||
| 1479 | Ga0496122_0009082 | |||
| 1480 | Ga0496122_0017843 | |||
| 1481 | Ga0496123_0000518 | |||
| 1482 | Ga0496123_0001557 | |||
| 1483 | Ga0496123_0007047 | |||
| 1484 | Ga0496124_0000214 | |||
| 1485 | Ga0496124_0000606 | |||
| 1486 | Ga0496124_0001819 | |||
| 1487 | Ga0496124_0007214 | |||
| 1488 | Ga0496124_0009700 | |||
| 1489 | Ga0496124_0037659 | |||
| 1490 | Ga0496125_0000666 | |||
| 1491 | Ga0496125_0091998 | |||
| 1492 | Ga0496126_0000079 | |||
| 1493 | Ga0496126_0000294 | |||
| 1494 | Ga0496126_0004606 | |||
| 1495 | Ga0501292_000172 | |||
| 1496 | Ga0501294_000303 | |||
| 1497 | Ga0501300_000548 | |||
| 1498 | Ga0501032_0001272 | |||
| 1499 | Ga0501037_0005776 | |||
| 1500 | Ga0501047_0003383 | |||
| 1501 | Ga0501047_0051581 | |||
| 1502 | Ga0501047_0156997 | |||
| 1503 | Ga0501047_0181061 | |||
| 1504 | Ga0501067_0000227 | |||
| 1505 | Ga0501073_0000004 | |||
| 1506 | Ga0501077_0000008 | |||
| 1507 | Ga0501223_000495 | |||
| 1508 | Ga0501223_000734 | |||
| 1509 | Ga0501224_000006 | |||
| 1510 | Ga0501233_000165 | |||
| 1511 | Ga0501249_001926 | |||
| 1512 | Ga0501257_000031 | |||
| 1513 | Ga0501259_002260 | |||
| 1514 | Ga0501261_000301 | |||
| 1515 | Ga0501225_0000845 | |||
| 1516 | Ga0501080_0000654 | |||
| 1517 | Ga0501279_000239 | |||
| 1518 | Ga0501280_000005 | |||
| 1519 | Ga0501280_000342 | |||
| 1520 | Ga0501281_00513 | |||
| 1521 | Ga0501282_000535 | |||
| 1522 | Ga0501283_000937 | |||
| 1523 | Ga0501035_0023615 | |||
| 1524 | Ga0501044_0000868 | |||
| 1525 | Ga0501044_0011325 | |||
| 1526 | nmdc:mga00v17_1761_c1 | |||
| 1527 | nmdc:mga00v17_2745_c1 | |||
| 1528 | nmdc:mga0k408_4871_c1 | |||
| 1529 | nmdc:mga06z11_26_c1 | |||
| 1530 | nmdc:mga04h51_118_c1 | |||
| 1531 | nmdc:mga04h51_22_c1 | |||
| 1532 | nmdc:mga07m45_22923_c1 | |||
| 1533 | nmdc:mga07m45_403_c1 | |||
| 1534 | nmdc:mga07m45_43825_c1 | |||
| 1535 | nmdc:mga0qj67_18352_c1 | |||
| 1536 | nmdc:mga0sz30_1259_c1 | |||
| 1537 | Ga0500643_000001 | |||
| 1538 | Ga0500643_000030 | |||
| 1539 | Ga0500643_001071 | |||
| 1540 | Ga0500643_001104 | |||
| 1541 | Ga0500643_002047 | |||
| 1542 | Ga0500643_002494 | |||
| 1543 | Ga0500643_002878 | |||
| 1544 | Ga0500643_003295 | |||
| 1545 | Ga0500643_006377 | |||
| 1546 | Ga0500643_009984 | |||
| 1547 | Ga0500643_023246 | |||
| 1548 | Ga0500643_023489 | |||
| 1549 | Ga0500566_0003635 | |||
| 1550 | Ga0500641_0019379 | |||
| 1551 | Ga0500556_0000049 | |||
| 1552 | Ga0500592_000270 | |||
| 1553 | Ga0500592_000280 | |||
| 1554 | Ga0500594_0002630 | |||
| 1555 | Ga0500594_0003469 | |||
| 1556 | Ga0500595_001337 | |||
| 1557 | Ga0500595_022036 | |||
| 1558 | Ga0500597_007055 | |||
| 1559 | Ga0500607_001726 | |||
| 1560 | Ga0500607_002875 | |||
| 1561 | Ga0500608_002406 | |||
| 1562 | Ga0500608_004409 | |||
| 1563 | Ga0500642_0000002 | |||
| 1564 | Ga0500658_0000108 | |||
| 1565 | Ga0500658_0002704 | |||
| 1566 | Ga0500559_0002377 | |||
| 1567 | Ga0500559_0006954 | |||
| 1568 | Ga0500568_0001734 | |||
| 1569 | Ga0500573_0000034 | |||
| 1570 | Ga0500616_0003384 | |||
| 1571 | Ga0500622_0006524 | |||
| 1572 | Ga0500624_000001 | |||
| 1573 | Ga0500624_000024 | |||
| 1574 | Ga0500624_000088 | |||
| 1575 | Ga0500627_0000049 | |||
| 1576 | Ga0500627_0000199 | |||
| 1577 | Ga0500627_0000335 | |||
| 1578 | Ga0500636_0006191 | |||
| 1579 | Ga0500636_0008307 | |||
| 1580 | Ga0500637_0000097 | |||
| 1581 | Ga0500637_0007967 | |||
| 1582 | Ga0500567_000103 | |||
| 1583 | Ga0500625_000029 | |||
| 1584 | Ga0500645_000173 | |||
| 1585 | Ga0500645_000300 | |||
| 1586 | Ga0500645_000452 | |||
| 1587 | Ga0501082_0138497 | |||
| 1588 | 2511130117 | |||
| 1589 | 2512642122 | |||
| 1590 | 2600202669 | |||
| 1591 | 2600226475 | |||
| 1592 | 2643726851 | |||
| 1593 | 2643820085 | |||
| 1594 | 2643836386 | |||
| 1595 | 2644040865 | |||
| 1596 | 2644046108 | |||
| 1597 | 2644052862 | |||
| 1598 | 2644128894 | |||
| 1599 | 2644393081 | |||
| 1600 | 2738712570 | |||
| 1601 | 2738850994 | |||
| 1602 | 2738866724 | |||
| 1603 | 2739299241 | |||
| 1604 | 2739360920 | |||
| 1605 | 2739650373 | |||
| 1606 | 2740028846 | |||
| 1607 | 2753764454 | |||
| 1608 | 2809063651 | |||
| 1609 | 2809079731 | |||
| 1610 | 2809084096 | |||
| 1611 | 2819553163 | |||
| 1612 | 2819712544 | |||
| 1613 | 2821449023 | |||
| 1614 | 2830077115 | |||
| 1615 | 2844536020 | |||
| 1616 | 2852653986 | |||
| 1617 | 2852683260 | |||
| 1618 | 2879166644 | |||
| 1619 | 2880519420 | |||
| 1620 | 2882808374 | |||
| 1621 | 2885428352 | |||
| 1622 | 2895882645 | |||
| 1623 | 2896430231 | |||
| 1624 | 2919711158 | |||
| 1625 | 2928030895 | |||
| 1626 | 2928103878 | |||
| 1627 | 2928527137 | |||
| 1628 | 2928961807 | |||
| 1629 | 2928969377 | |||
| 1630 | 2946788831 | |||
| 1631 | 2984557867 | |||
| 1632 | 2984567767 | |||
| 1633 | 2993358819 | |||
| 1634 | 8054304792 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ydm-assembly1.cif.gz_A | structural characterization of angiotensin-i converting enzyme in complex with a selenium analogue of captopril | 0.9533 | 11 | 588 |
| 3bkl-assembly1.cif.gz_A | testis ace co-crystal structure with ketone ace inhibitor kaw | 0.9531 | 11 | 588 |
| 2iux-assembly1.cif.gz_A | human tace mutant g1234 | 0.953 | 11 | 588 |
| 2oc2-assembly1.cif.gz_A | structure of testis ace with rxpa380 | 0.9526 | 13 | 588 |
| 4bzr-assembly1.cif.gz_A | human testis angiotensin converting enzyme in complex with k-26 | 0.9521 | 11 | 588 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P09470_45_628_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9489 | 11 | 588 | 1.10.1370.30 |
| af_Q10714_28_605_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9481 | 19 | 587 | 1.10.1370.30 |
| af_P09470_45_628_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9377 | 11 | 588 | 1.10.1370.30 |
| af_Q10714_28_605_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.9321 | 19 | 587 | 1.10.1370.30 |
| af_Q8SXX2_207_793_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.8694 | 13 | 588 | 1.10.1370.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2XDG7-F1-model_v4 | deleted | 0.9973 | 118 | 547 |
|
| AF-A0A2R7PLK0-F1-model_v4 | deleted | 0.9965 | 195 | 546 |
|
| AF-A0A3D2LH96-F1-model_v4 | deleted | 0.9943 | 176 | 495 |
|
| AF-A0A4Q2YYI3-F1-model_v4 | Peptidase M2 family protein | 0.9941 | 11 | 588 |
GO:0006508
GO:0008237 GO:0008241 GO:0016020 |
| AF-A0A520JBP9-F1-model_v4 | Peptidase M2 family protein | 0.9937 | 252 | 588 |
GO:0006508
GO:0008237 GO:0008241 GO:0016020 |