F482117

General Info

Members Datasets Scaffolds Average Seq Length
817 542 1634 411

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_000633|Ga0500572_000633_1399_2640
Length 376
Sequence MTDVTMNGEISDDARARRNVARLAAAQALTGANSAVIFTIAPDVSLATVPISMYVVGLAAGTLPTGAISRRFGRRVAFIIGTACGVVTGLLGSFAILRGSFVLFCAATFLGGLYGAVAQSYRFAAADGASAAFRPKAVSWVMAGGIFAGLLGPQLVQWTMEIWQPYLFDLHGGRPLLQIVRQPRFIAAALCGTVAYPVMNLVMTSAPLAMKMCGLTVSDSNFGLQWHIVAMYGPSFFTGALIARFGAPAIVALGLCLEAVAAMIGLSGLTAMHFWATLVMLGMGWNFGFVGASALVLETHLASERNKVQAFNDFLIFGMMALGSFSSGQLLANFGWSAVNLVVFPPVALGLCVLALVWSAKRRQARLEPVPELPEL

Samples

Sample ID Description Type Environment
1 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
78 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
79 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
125 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
308 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
309 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
312 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
319 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
323 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
326 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
327 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
332 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
333 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
334 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
335 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
336 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
337 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
338 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
339 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
340 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
341 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
342 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
343 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
344 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
345 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
346 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
347 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
348 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
349 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
350 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
351 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
352 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
353 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
354 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
355 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
356 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
357 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
358 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
359 2791355199
360 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
361 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
362 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
363 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
364 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
365 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
366 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
367 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
368 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
369 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
370 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
371 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
372 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
373 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
374 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
375 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
376 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
377 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
378 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
379 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
380 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
381 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
382 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
383 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
384 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
385 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
386 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
387 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
388 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
389 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
390 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
391 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
392 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
393 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
394 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
395 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
396 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
397 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
398 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
399 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
400 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
401 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
402 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
403 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
404 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
405 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
406 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
407 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
408 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
409 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
410 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
411 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
412 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
413 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
414 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
415 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
416 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
417 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
418 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
419 2904699407
420 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
421 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
422 2906610324
423 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
424 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
425 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
426 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
427 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
428 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
429 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
430 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
431 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
432 2922368715
433 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
434 2922425934
435 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
436 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
437 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
438 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
439 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
440 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
441 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
442 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
443 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
444 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
445 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
446 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
447 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
448 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
449 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
450 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
451 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
452 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
453 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
454 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
455 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
456 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
457 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
458 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
459 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
460 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
461 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
462 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
463 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
464 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
465 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
466 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
467 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
468 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
469 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
470 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
471 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
472 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
473 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
474 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
475 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
476 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
477 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
478 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
479 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
480 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
481 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
482 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
483 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
484 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
485 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
486 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
487 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
488 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
489 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
490 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
491 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
492 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
493 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
494 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
495 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
496 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
497 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
498 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
499 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
500 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
501 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
502 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
503 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
504 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
505 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
506 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
507 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
508 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
509 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
510 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
511 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
512 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
513 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
514 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
515 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
516 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
517 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
518 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
519 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
520 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
521 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
522 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
523 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
524 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
525 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
526 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
527 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
528 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
529 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
530 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
531 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
532 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
533 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
534 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
535 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
536 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
537 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
538 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
539 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
540 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
541 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
542 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.38
Metatranscriptomes 0.12
Isolates 25.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.04
Nodule 20.56
Rhizoplane 4.65
Rhizosphere 50.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500572_000633 3300053111 Bacteria 11659
2 JGI25406J46586_10002301 3300003203 Bacteria 9008
3 JGI25406J46586_10006164 3300003203 Bacteria 5536
4 JGI25406J46586_10007239 3300003203 Bacteria 5077
5 JGI25153J46596_10000947 3300003215 Bacteria 17623
6 JGI25160J50197_1002310 3300003354 Bacteria 8937
7 Ga0055542_1006056 3300003762 Bacteria 2634
8 Ga0055531_10002401 3300003794 Bacteria 12583
9 Ga0065165_1005891 3300005262 Bacteria 6660
10 Ga0065165_1023874 3300005262 Bacteria 2065
11 Ga0070658_10033274 3300005327 Bacteria 4147
12 Ga0070683_100014340 3300005329 Bacteria 6931
13 Ga0070683_100050291 3300005329 Bacteria 3858
14 Ga0070670_100152733 3300005331 Bacteria 1998
15 Ga0068869_100112245 3300005334 Bacteria 2075
16 Ga0070680_100006331 3300005336 Bacteria 8989
17 Ga0070680_100105807 3300005336 Bacteria 2339
18 Ga0070680_100148329 3300005336 Bacteria 1969
19 Ga0070682_100044950 3300005337 Bacteria 2736
20 Ga0068868_100047915 3300005338 Bacteria 3351
21 Ga0070660_100009964 3300005339 Bacteria 6700
22 Ga0070691_10017608 3300005341 Bacteria 3287
23 Ga0070668_100091727 3300005347 Bacteria 2395
24 Ga0070673_100050863 3300005364 Bacteria 3242
25 Ga0070659_100108110 3300005366 Bacteria 2243
26 Ga0070709_10000732 3300005434 Bacteria 18548
27 Ga0070714_100001031 3300005435 Bacteria 19841
28 Ga0070714_100018874 3300005435 Bacteria 5611
29 Ga0070714_100136932 3300005435 Bacteria 2194
30 Ga0070713_100000447 3300005436 Bacteria 26301
31 Ga0070713_100014459 3300005436 Bacteria 5864
32 Ga0070713_100039153 3300005436 Bacteria 3845
33 Ga0070713_100048359 3300005436 Bacteria 3502
34 Ga0070713_100054432 3300005436 Bacteria 3320
35 Ga0070713_100319796 3300005436 Bacteria 1433
36 Ga0070710_10000211 3300005437 Bacteria 27400
37 Ga0070710_10002104 3300005437 Bacteria 9438
38 Ga0070710_10011225 3300005437 Bacteria 4421
39 Ga0070711_100005283 3300005439 Bacteria 7708
40 Ga0070711_100009790 3300005439 Bacteria 5911
41 Ga0070711_100023869 3300005439 Bacteria 3983
42 Ga0070663_100029366 3300005455 Bacteria 3756
43 Ga0070663_100161009 3300005455 Bacteria 1727
44 Ga0070662_100009681 3300005457 Bacteria 6305
45 Ga0070681_10036946 3300005458 Bacteria 4902
46 Ga0070681_10133621 3300005458 Bacteria 2412
47 Ga0070698_100143497 3300005471 Bacteria 2338
48 Ga0070679_100022491 3300005530 Bacteria 6161
49 Ga0070679_100096241 3300005530 Bacteria 2948
50 Ga0070679_100197670 3300005530 Bacteria 1977
51 Ga0070679_100230981 3300005530 Bacteria 1809
52 Ga0070684_100003114 3300005535 Bacteria 12386
53 Ga0070684_100008647 3300005535 Bacteria 7977
54 Ga0070684_100042422 3300005535 Bacteria 3927
55 Ga0070684_100071338 3300005535 Bacteria 3057
56 Ga0070684_100091923 3300005535 Bacteria 2700
57 Ga0070697_100134688 3300005536 Bacteria 2074
58 Ga0068853_100008174 3300005539 Bacteria 8398
59 Ga0070693_100036325 3300005547 Bacteria 2738
60 Ga0070665_100057781 3300005548 Bacteria 3889
61 Ga0070665_100059724 3300005548 Bacteria 3822
62 Ga0068855_100033793 3300005563 Bacteria 6101
63 Ga0068855_100040910 3300005563 Bacteria 5497
64 Ga0068855_100055240 3300005563 Bacteria 4665
65 Ga0068855_100286651 3300005563 Bacteria 1827
66 Ga0070664_100041783 3300005564 Bacteria 3870
67 Ga0070664_100046895 3300005564 Bacteria 3651
68 Ga0068856_100002749 3300005614 Bacteria 18013
69 Ga0068852_100027195 3300005616 Bacteria 4659
70 Ga0068852_100146597 3300005616 Bacteria 2190
71 Ga0068852_100260656 3300005616 Bacteria 1664
72 Ga0068859_100093609 3300005617 Bacteria 3056
73 Ga0068859_100094950 3300005617 Bacteria 3035
74 Ga0068851_10005126 3300005834 Bacteria 5942
75 Ga0068870_10030391 3300005840 Bacteria 2730
76 Ga0068858_100103546 3300005842 Bacteria 2655
77 Ga0068860_100000257 3300005843 Bacteria 78468
78 Ga0068862_100059192 3300005844 Bacteria 3289
79 Ga0081455_10006921 3300005937 Bacteria 12061
80 Ga0081455_10007517 3300005937 Bacteria 11462
81 Ga0081455_10036677 3300005937 Bacteria 4361
82 Ga0081540_1002991 3300005983 Bacteria 13549
83 Ga0081540_1005442 3300005983 Bacteria 9502
84 Ga0081540_1006739 3300005983 Bacteria 8306
85 Ga0081540_1006907 3300005983 Bacteria 8187
86 Ga0081540_1035800 3300005983 Bacteria 2657
87 Ga0081539_10000048 3300005985 Bacteria 272906
88 Ga0081539_10000530 3300005985 Bacteria 79454
89 Ga0081539_10023403 3300005985 Bacteria 4048
90 Ga0070717_10004501 3300006028 Bacteria 10072
91 Ga0075363_100030835 3300006048 Bacteria 2777
92 Ga0070716_100001713 3300006173 Bacteria 9880
93 Ga0075367_10085542 3300006178 Bacteria 1913
94 Ga0075366_10041070 3300006195 Bacteria 2737
95 Ga0097621_100213847 3300006237 Bacteria 1678
96 Ga0075370_10018723 3300006353 Bacteria 3759
97 Ga0075370_10032739 3300006353 Bacteria 2907
98 Ga0075370_10121913 3300006353 Bacteria 1518
99 Ga0097620_100093609 3300006931 Bacteria 3056
100 Ga0097620_100094952 3300006931 Bacteria 3035
101 Ga0099824_1001145 3300006942 Bacteria 36195
102 Ga0099822_1000135 3300006943 Bacteria 49135
103 Ga0099795_10035443 3300007788 Bacteria 1745
104 Ga0105240_10005693 3300009093 Bacteria 18493
105 Ga0105240_10069560 3300009093 Bacteria 4357
106 Ga0105245_10040748 3300009098 Bacteria 4139
107 Ga0105241_10116078 3300009174 Bacteria 2149
108 Ga0105237_10004882 3300009545 Bacteria 15362
109 Ga0105237_10022753 3300009545 Bacteria 6431
110 Ga0105238_10008395 3300009551 Bacteria 10334
111 Ga0099796_10008899 3300010159 Bacteria 2694
112 Ga0105239_10023381 3300010375 Bacteria 6806
113 Ga0105239_10117102 3300010375 Bacteria 2957
114 Ga0105239_10151690 3300010375 Bacteria 2586
115 Ga0105239_10448479 3300010375 Bacteria 1463
116 Ga0105246_10017164 3300011119 Bacteria 4598
117 Ga0157373_10075513 3300013100 Bacteria 2378
118 Ga0157371_10023913 3300013102 Bacteria 4464
119 Ga0157369_10024800 3300013105 Bacteria 6663
120 Ga0157369_10028904 3300013105 Bacteria 6132
121 Ga0157369_10031823 3300013105 Bacteria 5805
122 Ga0157374_10012415 3300013296 Bacteria 7411
123 Ga0157378_10038827 3300013297 Bacteria 4221
124 Ga0157372_10064246 3300013307 Bacteria 4118
125 Ga0157372_10081164 3300013307 Bacteria 3670
126 Ga0157375_10036499 3300013308 Bacteria 4703
127 Ga0163163_10058864 3300014325 Bacteria 3798
128 Ga0157380_10063259 3300014326 Bacteria 2966
129 Ga0157379_10134198 3300014968 Bacteria 2229
130 Ga0214544_1000087 3300021320 Bacteria 119600
131 Ga0214542_1000018 3300021321 Bacteria 202226
132 Ga0214545_1000009 3300021324 Bacteria 202915
133 Ga0213872_10036852 3300021361 Bacteria 2234
134 Ga0213875_10007759 3300021388 Bacteria 5518
135 Ga0209677_100351 3300025253 Bacteria 28656
136 Ga0209148_1000694 3300025254 Bacteria 27288
137 Ga0209233_1001183 3300025261 Bacteria 10540
138 Ga0209233_1002715 3300025261 Bacteria 6385
139 Ga0209233_1003057 3300025261 Bacteria 5951
140 Ga0209455_1001551 3300025272 Bacteria 10178
141 Ga0209564_1001755 3300025295 Bacteria 20242
142 Ga0209564_1015806 3300025295 Bacteria 3049
143 Ga0209758_1000015 3300025297 Bacteria 851943
144 Ga0209758_1000224 3300025297 Bacteria 121530
145 Ga0209758_1001187 3300025297 Bacteria 32935
146 Ga0209758_1005118 3300025297 Bacteria 10363
147 Ga0209758_1009011 3300025297 Bacteria 6304
148 Ga0209758_1017848 3300025297 Bacteria 3508
149 Ga0207426_1001141 3300025302 Bacteria 23982
150 Ga0207426_1004819 3300025302 Bacteria 6402
151 Ga0209051_1019809 3300025303 Bacteria 2923
152 Ga0209257_1000440 3300025304 Bacteria 79182
153 Ga0207656_10004685 3300025321 Bacteria 4793
154 Ga0207692_10011320 3300025898 Bacteria 3791
155 Ga0207692_10012479 3300025898 Bacteria 3650
156 Ga0207692_10019710 3300025898 Bacteria 3053
157 Ga0207685_10004111 3300025905 Bacteria 3649
158 Ga0207699_10000480 3300025906 Bacteria 20266
159 Ga0207699_10001027 3300025906 Bacteria 13164
160 Ga0207705_10025816 3300025909 Bacteria 4192
161 Ga0207654_10018569 3300025911 Bacteria 3651
162 Ga0207707_10004596 3300025912 Bacteria 12123
163 Ga0207707_10007086 3300025912 Bacteria 9771
164 Ga0207695_10000065 3300025913 Bacteria 336949
165 Ga0207695_10066385 3300025913 Bacteria 3705
166 Ga0207695_10243066 3300025913 Bacteria 1701
167 Ga0207671_10001858 3300025914 Bacteria 23570
168 Ga0207671_10012315 3300025914 Bacteria 6884
169 Ga0207671_10097887 3300025914 Bacteria 2218
170 Ga0207671_10108087 3300025914 Bacteria 2114
171 Ga0207671_10231229 3300025914 Bacteria 1450
172 Ga0207693_10000774 3300025915 Bacteria 28742
173 Ga0207693_10079234 3300025915 Bacteria 2571
174 Ga0207663_10000356 3300025916 Bacteria 19925
175 Ga0207663_10003833 3300025916 Bacteria 7424
176 Ga0207663_10053410 3300025916 Bacteria 2524
177 Ga0207660_10002711 3300025917 Bacteria 11604
178 Ga0207657_10011430 3300025919 Bacteria 8815
179 Ga0207657_10015396 3300025919 Bacteria 7409
180 Ga0207652_10004991 3300025921 Bacteria 10747
181 Ga0207652_10105103 3300025921 Bacteria 2498
182 Ga0207652_10151680 3300025921 Bacteria 2075
183 Ga0207652_10182397 3300025921 Bacteria 1887
184 Ga0207694_10007898 3300025924 Bacteria 8055
185 Ga0207687_10149472 3300025927 Bacteria 1781
186 Ga0207700_10032190 3300025928 Bacteria 3736
187 Ga0207700_10038888 3300025928 Bacteria 3457
188 Ga0207700_10183069 3300025928 Bacteria 1756
189 Ga0207664_10004313 3300025929 Bacteria 9629
190 Ga0207664_10245442 3300025929 Bacteria 1561
191 Ga0207664_10271154 3300025929 Bacteria 1487
192 Ga0207644_10267073 3300025931 Bacteria 1370
193 Ga0207706_10044195 3300025933 Bacteria 3949
194 Ga0207665_10000289 3300025939 Bacteria 34924
195 Ga0207665_10164468 3300025939 Bacteria 1598
196 Ga0207661_10000678 3300025944 Bacteria 22066
197 Ga0207661_10029561 3300025944 Bacteria 4210
198 Ga0207661_10070023 3300025944 Bacteria 2862
199 Ga0207679_10054377 3300025945 Bacteria 2947
200 Ga0207667_10010722 3300025949 Bacteria 10691
201 Ga0207667_10030890 3300025949 Bacteria 5789
202 Ga0207667_10052700 3300025949 Bacteria 4284
203 Ga0207668_10036396 3300025972 Bacteria 3284
204 Ga0207639_10012139 3300026041 Bacteria 5993
205 Ga0207678_10011493 3300026067 Bacteria 7776
206 Ga0207678_10071759 3300026067 Bacteria 2968
207 Ga0207702_10000056 3300026078 Bacteria 131186
208 Ga0207702_10325395 3300026078 Bacteria 1465
209 Ga0207674_10031657 3300026116 Bacteria 5553
210 Ga0207683_10014468 3300026121 Bacteria 6718
211 Ga0207683_10063341 3300026121 Bacteria 3257
212 Ga0207698_10259015 3300026142 Bacteria 1597
213 Ga0209389_1000076 3300027296 Bacteria 92447
214 Ga0209589_1000017 3300027357 Bacteria 215546
215 Ga0209489_100018 3300027361 Bacteria 215546
216 Ga0209489_100416 3300027361 Bacteria 77981
217 Ga0209700_100014 3300027363 Bacteria 299349
218 Ga0209700_100028 3300027363 Bacteria 215546
219 Ga0268266_10009701 3300028379 Bacteria 8460
220 Ga0268266_10014397 3300028379 Bacteria 6800
221 Ga0268266_10052181 3300028379 Bacteria 3511
222 Ga0268266_10053044 3300028379 Bacteria 3483
223 Ga0268265_10047858 3300028380 Bacteria 3206
224 Ga0268264_10000049 3300028381 Bacteria 329992
225 Ga0265318_10007398 3300028577 Bacteria 4968
226 Ga0265323_10001811 3300028653 Bacteria 10147
227 Ga0307517_10000766 3300028786 Bacteria 55210
228 Ga0265338_10000024 3300028800 Bacteria 297778
229 Ga0265324_10007310 3300029957 Bacteria 4493
230 Ga0265330_10031484 3300031235 Bacteria 2378
231 Ga0265332_10023238 3300031238 Bacteria 2734
232 Ga0265325_10003471 3300031241 Bacteria 10279
233 Ga0265340_10009442 3300031247 Bacteria 5235
234 Ga0265339_10005247 3300031249 Bacteria 8648
235 Ga0265339_10047978 3300031249 Bacteria 2343
236 Ga0265331_10019815 3300031250 Bacteria 3465
237 Ga0265316_10095944 3300031344 Bacteria 2258
238 Ga0307513_10206949 3300031456 Bacteria 1797
239 Ga0307509_10011529 3300031507 Bacteria 10685
240 Ga0307509_10060767 3300031507 Bacteria 3992
241 Ga0265313_10088268 3300031595 Bacteria 1396
242 Ga0307508_10000005 3300031616 Bacteria 286511
243 Ga0265314_10005659 3300031711 Bacteria 11226
244 Ga0265314_10047193 3300031711 Bacteria 3033
245 Ga0265342_10023127 3300031712 Bacteria 3938
246 Ga0265342_10054469 3300031712 Bacteria 2376
247 Ga0307516_10072365 3300031730 Bacteria 3307
248 Ga0307516_10087107 3300031730 Bacteria 2958
249 Ga0307412_10150773 3300031911 Bacteria 1715
250 Ga0307507_10008595 3300033179 Bacteria 14023
251 Ga0307510_10001273 3300033180 Bacteria 27490
252 Ga0307510_10007616 3300033180 Bacteria 12905
253 Ga0307510_10057910 3300033180 Bacteria 4016
254 Ga0307510_10083442 3300033180 Bacteria 3085
255 Ga0315911_1000033 3300033442 Bacteria 67159
256 Ga0373926_0022912 3300035083 Bacteria 2167
257 Ga0373944_0032530 3300035089 Bacteria 1576
258 Ga0373923_0009031 3300035111 Bacteria 3580
259 Ga0373936_0016157 3300035113 Bacteria 2869
260 Ga0373936_0042319 3300035113 Bacteria 1828
261 Ga0373953_0001082 3300035117 Bacteria 7700
262 Ga0373953_0011203 3300035117 Bacteria 3142
263 Ga0373954_0002766 3300035118 Bacteria 7387
264 Ga0373954_0021858 3300035118 Bacteria 2898
265 Ga0373956_0000296 3300035119 Bacteria 20068
266 Ga0373957_0001181 3300035120 Bacteria 6958
267 Ga0373957_0066047 3300035120 Bacteria 1408
268 Ga0373943_0006477 3300035170 Bacteria 5259
269 Ga0373946_0003449 3300035171 Bacteria 5614
270 Ga0373924_0014868 3300035410 Bacteria 2946
271 Ga0373924_0040505 3300035410 Bacteria 1907
272 Ga0373935_0001604 3300035692 Bacteria 12605
273 Ga0373935_0041010 3300035692 Bacteria 2907
274 Ga0373935_0083390 3300035692 Bacteria 2080
275 Ga0373927_0000071 3300035695 Bacteria 73794
276 Ga0373927_0054529 3300035695 Bacteria 2586
277 Ga0373933_0000114 3300035724 Bacteria 52016
278 Ga0373933_0004010 3300035724 Bacteria 8111
279 Ga0373933_0029787 3300035724 Bacteria 3158
280 Ga0373933_0125855 3300035724 Bacteria 1608
281 Ga0373947_0010412 3300035725 Bacteria 5336
282 Ga0373947_0010721 3300035725 Bacteria 5260
283 Ga0373947_0089639 3300035725 Bacteria 1916
284 Ga0373937_0005314 3300036401 Bacteria 11007
285 Ga0373937_0075537 3300036401 Bacteria 3111
286 Ga0373937_0098220 3300036401 Bacteria 2716
287 Ga0372808_005196 3300036459 Bacteria 1706
288 Ga0373925_0009450 3300037068 Bacteria 7096
289 Ga0373925_0050474 3300037068 Bacteria 3102
290 Ga0373925_0133108 3300037068 Bacteria 1940
291 Ga0373925_0228811 3300037068 Bacteria 1486
292 Ga0395899_0067636 3300037312 Bacteria 2621
293 Ga0395900_0006407 3300037418 Bacteria 12267
294 Ga0395900_0038973 3300037418 Bacteria 4898
295 Ga0395898_0017762 3300037466 Bacteria 7258
296 Ga0395898_0067697 3300037466 Bacteria 3457
297 Ga0395898_0124991 3300037466 Bacteria 2464
298 Ga0395898_0262021 3300037466 Bacteria 1649
299 Ga0395898_0270675 3300037466 Bacteria 1620
300 Ga0395905_0005511 3300037471 Bacteria 12915
301 Ga0436364_0194875 3300037853 Bacteria 16602
302 Ga0436364_0806245 3300037853 Bacteria 1514
303 Ga0395901_0019529 3300038443 Bacteria 6927
304 Ga0395901_0025443 3300038443 Bacteria 6075
305 Ga0436365_0409965 3300039437 Bacteria 4733
306 Ga0436365_0650112 3300039437 Bacteria 58550
307 Ga0436365_1054137 3300039437 Bacteria 5465
308 Ga0436360_1265645 3300039438 Bacteria 3160
309 Ga0436361_0808880 3300039447 Bacteria 2290
310 Ga0436363_0356954 3300039450 Bacteria 6790
311 Ga0466972_0000103 3300044658 Bacteria 75095
312 Ga0466972_0028761 3300044658 Bacteria 2739
313 Ga0466965_0019402 3300044683 Bacteria 3264
314 Ga0466966_0002297 3300044684 Bacteria 12462
315 Ga0466961_0000129 3300044693 Bacteria 50353
316 Ga0466963_0028235 3300044694 Bacteria 3600
317 Ga0466964_0089359 3300044706 Bacteria 1338
318 Ga0466970_0108567 3300044765 Bacteria 1515
319 Ga0466970_0130378 3300044765 Bacteria 1381
320 Ga0466959_0014058 3300045049 Bacteria 5812
321 Ga0466959_0044960 3300045049 Bacteria 3253
322 Ga0466967_0058387 3300045976 Bacteria 3410
323 Ga0466967_0101123 3300045976 Bacteria 2634
324 Ga0466967_0157719 3300045976 Bacteria 2128
325 Ga0466967_0430260 3300045976 Bacteria 1287
326 Ga0495617_018889 3300046452 Bacteria 2332
327 Ga0495592_0015882 3300046454 Bacteria 5712
328 Ga0495592_0020793 3300046454 Bacteria 4993
329 Ga0495603_0000035 3300046455 Bacteria 57510
330 Ga0495603_0003901 3300046455 Bacteria 8884
331 Ga0495603_0016647 3300046455 Bacteria 4449
332 Ga0495629_0000081 3300046459 Bacteria 85305
333 Ga0495629_0000380 3300046459 Bacteria 37205
334 Ga0495629_0131200 3300046459 Bacteria 1745
335 Ga0495638_0020842 3300046460 Bacteria 4328
336 Ga0495638_0055340 3300046460 Bacteria 2463
337 Ga0495638_0060947 3300046460 Bacteria 2332
338 Ga0495641_0000707 3300046461 Bacteria 28228
339 Ga0495651_0022758 3300046462 Bacteria 4872
340 Ga0495651_0061285 3300046462 Bacteria 2879
341 Ga0495651_0123348 3300046462 Bacteria 1900
342 Ga0495653_0004990 3300046463 Bacteria 10769
343 Ga0495580_0008037 3300046472 Bacteria 8423
344 Ga0495582_0029958 3300046473 Bacteria 2986
345 Ga0495639_0000010 3300046475 Bacteria 93685
346 Ga0495639_0025094 3300046475 Bacteria 2627
347 Ga0495662_0000034 3300046476 Bacteria 46636
348 Ga0495662_0011744 3300046476 Bacteria 4281
349 Ga0495664_0098622 3300046477 Bacteria 1759
350 Ga0495606_0000265 3300046507 Bacteria 92526
351 Ga0495608_0000629 3300046511 Bacteria 24325
352 Ga0495618_0032818 3300046514 Bacteria 3253
353 Ga0495620_0013656 3300046515 Bacteria 4153
354 Ga0495628_0036472 3300046516 Bacteria 3945
355 Ga0495628_0070096 3300046516 Bacteria 2733
356 Ga0495628_0117489 3300046516 Bacteria 2042
357 Ga0495630_0010715 3300046517 Bacteria 6621
358 Ga0495630_0024944 3300046517 Bacteria 4420
359 Ga0495644_0057973 3300046523 Bacteria 1456
360 Ga0495663_0020109 3300046525 Bacteria 1915
361 Ga0495666_0020735 3300046526 Bacteria 3254
362 Ga0495666_0067074 3300046526 Bacteria 1710
363 Ga0495652_0012668 3300046529 Bacteria 7595
364 Ga0495652_0020294 3300046529 Bacteria 5907
365 Ga0495652_0028332 3300046529 Bacteria 4928
366 Ga0495652_0080688 3300046529 Bacteria 2686
367 Ga0495665_0000005 3300046531 Bacteria 86491
368 Ga0495665_0040768 3300046531 Bacteria 2472
369 Ga0495640_0006078 3300046533 Bacteria 9576
370 Ga0495640_0016321 3300046533 Bacteria 5558
371 Ga0495586_0050165 3300046535 Bacteria 2258
372 Ga0495587_0020500 3300046536 Bacteria 4080
373 Ga0495587_0028203 3300046536 Bacteria 3415
374 Ga0495598_0011495 3300046537 Bacteria 2149
375 Ga0495598_0017575 3300046537 Bacteria 1846
376 Ga0495645_0044947 3300046543 Bacteria 3221
377 Ga0495622_0019641 3300046557 Bacteria 3146
378 Ga0495622_0084231 3300046557 Bacteria 1462
379 Ga0495667_0013125 3300046559 Bacteria 5610
380 Ga0495667_0014316 3300046559 Bacteria 5357
381 Ga0495667_0083861 3300046559 Bacteria 2069
382 Ga0495668_0005573 3300046616 Bacteria 8466
383 Ga0495634_0000261 3300046642 Bacteria 49735
384 Ga0495634_0016748 3300046642 Bacteria 5237
385 Ga0495634_0068872 3300046642 Bacteria 2336
386 Ga0495634_0093259 3300046642 Bacteria 1953
387 Ga0495635_0000281 3300046663 Bacteria 32699
388 Ga0495635_0003387 3300046663 Bacteria 11015
389 Ga0495635_0003556 3300046663 Bacteria 10781
390 Ga0495661_0003673 3300046665 Bacteria 11270
391 Ga0495588_0002575 3300046674 Bacteria 7757
392 Ga0495588_0014606 3300046674 Bacteria 3761
393 Ga0495588_0019137 3300046674 Bacteria 3351
394 Ga0495599_0009607 3300046678 Bacteria 5918
395 Ga0495599_0028089 3300046678 Bacteria 3525
396 Ga0495599_0067607 3300046678 Bacteria 2232
397 Ga0495623_0030438 3300046679 Bacteria 3471
398 Ga0495646_0010990 3300046680 Bacteria 5752
399 Ga0495646_0015831 3300046680 Bacteria 4788
400 Ga0495646_0017354 3300046680 Bacteria 4566
401 Ga0495646_0073094 3300046680 Bacteria 2015
402 Ga0495647_0004374 3300046681 Bacteria 4588
403 Ga0495658_0000367 3300046683 Bacteria 25339
404 Ga0495658_0056832 3300046683 Bacteria 2233
405 Ga0495658_0107073 3300046683 Bacteria 1676
406 Ga0495613_0011795 3300046689 Bacteria 6491
407 Ga0495613_0028734 3300046689 Bacteria 4136
408 Ga0495613_0051530 3300046689 Bacteria 3033
409 Ga0495624_0000094 3300046690 Bacteria 59911
410 Ga0495624_0078047 3300046690 Bacteria 2054
411 Ga0495670_0038212 3300046691 Bacteria 2393
412 Ga0495600_0000567 3300046809 Bacteria 19167
413 Ga0495600_0004278 3300046809 Bacteria 8533
414 Ga0495581_0000018 3300047315 Bacteria 58791
415 Ga0495604_0005727 3300047317 Bacteria 9854
416 Ga0495604_0015120 3300047317 Bacteria 6157
417 Ga0495604_0049671 3300047317 Bacteria 3257
418 Ga0495674_0000134 3300047319 Bacteria 56618
419 Ga0495674_0245331 3300047319 Bacteria 1475
420 Ga0495672_0120975 3300047320 Bacteria 1392
421 Ga0495676_0039786 3300047321 Bacteria 3890
422 Ga0495680_0014317 3300047322 Bacteria 6876
423 Ga0495680_0089299 3300047322 Bacteria 2313
424 Ga0495675_0013953 3300047444 Bacteria 5081
425 Ga0495675_0041292 3300047444 Bacteria 2940
426 Ga0495677_0014584 3300047445 Bacteria 2859
427 Ga0495684_0000052 3300047471 Bacteria 85125
428 Ga0495684_0030899 3300047471 Bacteria 4112
429 Ga0495684_0051622 3300047471 Bacteria 3138
430 Ga0495686_0019613 3300047472 Bacteria 4518
431 Ga0495686_0029614 3300047472 Bacteria 3561
432 Ga0495686_0046333 3300047472 Bacteria 2749
433 Ga0495593_0000084 3300047673 Bacteria 41155
434 Ga0495593_0000214 3300047673 Bacteria 30567
435 Ga0495593_0051122 3300047673 Bacteria 2187
436 Ga0495614_0035274 3300048089 Bacteria 2149
437 Ga0496101_0030946 3300048904 Bacteria 3758
438 Ga0496102_0038452 3300048905 Bacteria 4318
439 Ga0496104_0005304 3300048907 Bacteria 11278
440 Ga0496104_0005388 3300048907 Bacteria 11198
441 Ga0496104_0032218 3300048907 Bacteria 4877
442 Ga0496104_0063104 3300048907 Bacteria 3513
443 Ga0496105_0001275 3300048908 Bacteria 17613
444 Ga0496105_0025939 3300048908 Bacteria 4775
445 Ga0496105_0031279 3300048908 Bacteria 4364
446 Ga0496105_0062404 3300048908 Bacteria 3075
447 Ga0496106_0011156 3300048909 Bacteria 6648
448 Ga0496106_0051335 3300048909 Bacteria 3109
449 Ga0496106_0088701 3300048909 Bacteria 2384
450 Ga0496106_0132616 3300048909 Bacteria 1954
451 Ga0496106_0144963 3300048909 Bacteria 1870
452 Ga0496106_0175271 3300048909 Bacteria 1701
453 Ga0496107_0003794 3300048910 Bacteria 10148
454 Ga0496108_0028116 3300048911 Bacteria 4652
455 Ga0496108_0103808 3300048911 Bacteria 2425
456 Ga0496108_0106127 3300048911 Bacteria 2399
457 Ga0496109_0025525 3300048912 Bacteria 5267
458 Ga0496110_0031931 3300048913 Bacteria 4545
459 Ga0496110_0055172 3300048913 Bacteria 3496
460 Ga0496110_0191113 3300048913 Bacteria 1859
461 Ga0496110_0201284 3300048913 Bacteria 1809
462 Ga0496110_0312919 3300048913 Bacteria 1430
463 Ga0496112_0000019 3300048915 Bacteria 185531
464 Ga0496112_0002348 3300048915 Bacteria 15192
465 Ga0496112_0020579 3300048915 Bacteria 6256
466 Ga0496112_0032266 3300048915 Bacteria 5084
467 Ga0496112_0047324 3300048915 Bacteria 4219
468 Ga0496113_0010309 3300048916 Bacteria 6174
469 Ga0496114_0053466 3300048917 Bacteria 3366
470 Ga0496115_0031637 3300048918 Bacteria 4169
471 Ga0496115_0143804 3300048918 Bacteria 1968
472 Ga0496115_0243485 3300048918 Bacteria 1482
473 Ga0496115_0252624 3300048918 Bacteria 1451
474 Ga0496116_0003138 3300048919 Bacteria 16576
475 Ga0496116_0055772 3300048919 Bacteria 2594
476 Ga0496117_0031153 3300048920 Bacteria 4077
477 Ga0496117_0038991 3300048920 Bacteria 3512
478 Ga0496118_0049117 3300048921 Bacteria 3251
479 Ga0496118_0063626 3300048921 Bacteria 2713
480 Ga0496118_0181629 3300048921 Bacteria 1270
481 Ga0496119_0019380 3300048922 Bacteria 5014
482 Ga0496120_0005446 3300048923 Bacteria 10152
483 Ga0496120_0044907 3300048923 Bacteria 2564
484 Ga0496120_0058151 3300048923 Bacteria 2173
485 Ga0496121_0000716 3300048924 Bacteria 61451
486 Ga0496121_0001737 3300048924 Bacteria 35592
487 Ga0496121_0004612 3300048924 Bacteria 18357
488 Ga0496121_0022824 3300048924 Bacteria 6049
489 Ga0496121_0027214 3300048924 Bacteria 5357
490 Ga0496121_0031957 3300048924 Bacteria 4797
491 Ga0496121_0040197 3300048924 Bacteria 4106
492 Ga0496121_0063144 3300048924 Bacteria 3029
493 Ga0496121_0077681 3300048924 Bacteria 2642
494 Ga0496121_0097573 3300048924 Bacteria 2277
495 Ga0496121_0108417 3300048924 Bacteria 2124
496 Ga0496121_0170217 3300048924 Bacteria 1583
497 Ga0496122_0018007 3300048925 Bacteria 6552
498 Ga0496124_0001529 3300048927 Bacteria 33656
499 Ga0496124_0051737 3300048927 Bacteria 3493
500 Ga0496124_0119606 3300048927 Bacteria 2107
501 Ga0496125_0000048 3300048928 Bacteria 290651
502 Ga0496125_0000746 3300048928 Bacteria 53671
503 Ga0496125_0007153 3300048928 Bacteria 11912
504 Ga0496125_0032850 3300048928 Bacteria 4603
505 Ga0496125_0175190 3300048928 Bacteria 1436
506 Ga0496126_0011417 3300048929 Bacteria 9199
507 Ga0496126_0027182 3300048929 Bacteria 5469
508 Ga0496126_0027460 3300048929 Bacteria 5435
509 Ga0496126_0029037 3300048929 Bacteria 5258
510 Ga0496126_0065763 3300048929 Bacteria 3244
511 Ga0496126_0070482 3300048929 Bacteria 3114
512 Ga0496126_0101584 3300048929 Bacteria 2515
513 Ga0501031_0006545 3300049568 Bacteria 7596
514 Ga0501032_0000048 3300049569 Bacteria 106326
515 Ga0501033_0000184 3300049570 Bacteria 59970
516 Ga0501034_0000082 3300049571 Bacteria 170039
517 Ga0501034_0010558 3300049571 Bacteria 9613
518 Ga0501036_0000791 3300049572 Bacteria 23456
519 Ga0501037_0000063 3300049573 Bacteria 97745
520 Ga0501037_0136567 3300049573 Bacteria 1756
521 Ga0501038_0000295 3300049574 Bacteria 42291
522 Ga0501039_0000082 3300049575 Bacteria 72201
523 Ga0501043_0000148 3300049579 Bacteria 65190
524 Ga0501046_0000101 3300049580 Bacteria 91179
525 Ga0501047_0000671 3300049581 Bacteria 35653
526 Ga0501047_0150449 3300049581 Bacteria 2204
527 Ga0501048_0006649 3300049582 Bacteria 8789
528 Ga0501048_0046199 3300049582 Bacteria 3109
529 Ga0501067_0000056 3300049583 Bacteria 64757
530 Ga0501067_0066309 3300049583 Bacteria 1998
531 Ga0501067_0068332 3300049583 Bacteria 1967
532 Ga0501068_0000310 3300049584 Bacteria 24404
533 Ga0501069_0001375 3300049585 Bacteria 11943
534 Ga0501069_0049199 3300049585 Bacteria 2343
535 Ga0501070_0043351 3300049586 Bacteria 3744
536 Ga0501072_0006466 3300049588 Bacteria 8922
537 Ga0501073_0000053 3300049589 Bacteria 73023
538 Ga0501074_0000331 3300049590 Bacteria 27484
539 Ga0501074_0205662 3300049590 Bacteria 1403
540 Ga0501079_0000586 3300049741 Bacteria 24123
541 Ga0501080_0000922 3300049742 Bacteria 24020
542 Ga0501080_0049187 3300049742 Bacteria 3924
543 Ga0501083_0005043 3300049744 Bacteria 9353
544 Ga0501035_0000474 3300049822 Bacteria 45071
545 Ga0501035_0019650 3300049822 Bacteria 6208
546 Ga0501044_0000408 3300049823 Bacteria 52994
547 Ga0501044_0267764 3300049823 Bacteria 1645
548 Ga0501045_0001959 3300049824 Bacteria 13895
549 nmdc:mga07m45_37482_c2 3300050496 Bacteria 1593
550 nmdc:mga07m45_9280_c1 3300050496 Bacteria 5095
551 nmdc:mga0sz30_9859_c1 3300050516 Bacteria 3644
552 Ga0495601_0135290 3300053077 Bacteria 1607
553 Ga0500635_0000644 3300053080 Bacteria 8951
554 Ga0495595_0003526 3300053084 Bacteria 6211
555 Ga0495619_0003340 3300053085 Bacteria 10379
556 Ga0495619_0178693 3300053085 Bacteria 1468
557 Ga0500578_0035655 3300053086 Bacteria 3196
558 Ga0500643_000062 3300053087 Bacteria 122407
559 Ga0500643_007900 3300053087 Bacteria 4236
560 Ga0500583_0067309 3300053092 Bacteria 1706
561 Ga0500566_0000754 3300053094 Bacteria 18223
562 Ga0500566_0000896 3300053094 Bacteria 17020
563 Ga0500566_0002969 3300053094 Bacteria 10127
564 Ga0500641_0005076 3300053096 Bacteria 4664
565 Ga0500641_0012945 3300053096 Bacteria 3057
566 Ga0500554_000781 3300053102 Bacteria 6353
567 Ga0500556_0000012 3300053104 Bacteria 250391
568 Ga0500557_000043 3300053105 Bacteria 63389
569 Ga0500569_002435 3300053109 Bacteria 3664
570 Ga0500591_015490 3300053115 Bacteria 3669
571 Ga0500594_0004199 3300053118 Bacteria 3177
572 Ga0500595_003786 3300053119 Bacteria 6958
573 Ga0500595_004250 3300053119 Bacteria 6461
574 Ga0500595_008925 3300053119 Bacteria 4072
575 Ga0500595_013017 3300053119 Bacteria 3194
576 Ga0500595_025259 3300053119 Bacteria 2062
577 Ga0500642_0000193 3300053130 Bacteria 24969
578 Ga0500652_000891 3300053131 Bacteria 9886
579 Ga0500559_0001232 3300053136 Bacteria 15083
580 Ga0500559_0018624 3300053136 Bacteria 2933
581 Ga0500568_0008164 3300053139 Bacteria 5074
582 Ga0500568_0011131 3300053139 Bacteria 4191
583 Ga0500568_0064106 3300053139 Bacteria 1416
584 Ga0500573_0156872 3300053140 Bacteria 1241
585 Ga0500577_0000112 3300053142 Bacteria 19856
586 Ga0500590_039868 3300053148 Bacteria 2421
587 Ga0500603_001634 3300053150 Bacteria 5050
588 Ga0500603_017792 3300053150 Bacteria 1703
589 Ga0500616_0000035 3300053153 Bacteria 394242
590 Ga0500627_0075848 3300053158 Bacteria 1494
591 Ga0500634_0008134 3300053161 Bacteria 5224
592 Ga0500639_004728 3300053163 Bacteria 6929
593 Ga0500636_0000075 3300053177 Bacteria 48415
594 Ga0500636_0000934 3300053177 Bacteria 15698
595 Ga0500636_0019627 3300053177 Bacteria 3999
596 Ga0500637_0000155 3300053178 Bacteria 25033
597 Ga0500637_0002240 3300053178 Bacteria 8531
598 Ga0500637_0039657 3300053178 Bacteria 2657
599 Ga0500625_000791 3300053729 Bacteria 9601
600 Ga0500596_004199 3300053735 Bacteria 2664
601 Ga0500596_004749 3300053735 Bacteria 2463
602 Ga0500596_006081 3300053735 Bacteria 2071
603 Ga0501084_0002066 3300054114 Bacteria 16019
604 Ga0500661_000408 3300055283 Bacteria 7948
605 Ga0501082_0007314 3300060353 Bacteria 9528
606 2507504837 2507262055 Bacteria 8048963
607 2508546192 2508501009 Bacteria 7784016
608 2508695124 2508501042 Bacteria 8719808
609 2509149792 2508501128 Bacteria 8613869
610 2511398309 2511231028 Bacteria 8046582
611 2513625419 2513237092 Bacteria 8341956
612 2513639548 2513237094 Bacteria 8789602
613 2513647968 2513237095 Bacteria 8976980
614 2513672984 2513237098 Bacteria 9902361
615 2513694918 2513237101 Bacteria 7952346
616 2513703346 2513237102 Bacteria 7703324
617 2513715703 2513237104 Bacteria 10034502
618 2513862931 2513237137 Bacteria 9558895
619 2513889777 2513237141 Bacteria 8496279
620 2514012892 2513237161 Bacteria 8871253
621 2515625870 2515154112 Bacteria 8294334
622 2517102393 2517093001 Bacteria 9002274
623 2517889310 2517572143 Bacteria 9484767
624 2524435738 2524023205 Bacteria 8918781
625 2524466460 2524023210 Bacteria 9029266
626 2524540357 2524023228 Bacteria 10118060
627 2603857874 2602042107 Bacteria 6226103
628 2617351695 2617270735 Bacteria 9163226
629 2723842033 2721755755 Bacteria 8322773
630 2728755367 2728368998 Bacteria 8720350
631 2745079034 2744054633 Bacteria 8678936
632 2793066042 2791355196 Bacteria 7323613
633 2793070968 2791355197 Bacteria 8420563
634 2793077416
635 2805916002 2802429603 Bacteria 8777136
636 2818237274 2816332527 Bacteria 8933356
637 2824602569 2824600985 Bacteria 8488197
638 2824612651 2824609381 Bacteria 8672835
639 2824621113 2824617872 Bacteria 8814715
640 2824630120 2824626560 Bacteria 8813858
641 2824640725 2824635225 Bacteria 8785348
642 2824654466 2824653114 Bacteria 8493680
643 2824674860 2824671348 Bacteria 8369588
644 2824691928 2824687955 Bacteria 8360029
645 2824727937 2824723954 Bacteria 8758240
646 2824757120 2824753945 Bacteria 9787441
647 2824774949 2824773399 Bacteria 8360218
648 2838129552 2838122688 Bacteria 8803140
649 2841944453 2841941048 Bacteria 8688029
650 2841951594 2841949485 Bacteria 8680857
651 2841964619 2841957949 Bacteria 8652217
652 2841969230 2841966195 Bacteria 8673214
653 2841982895 2841974524 Bacteria 8931498
654 2841991023 2841983080 Bacteria 8395090
655 2842043889 2842038055 Bacteria 8002051
656 2842052121 2842045827 Bacteria 8006841
657 2844321816 2844315083 Bacteria 8138177
658 2847931475 2847930680 Bacteria 9342022
659 2847941747 2847939898 Bacteria 8606328
660 2849082669 2849076700 Bacteria 7039503
661 2857511562 2857509624 Bacteria 7472071
662 2857527247 2857524615 Bacteria 6615449
663 2874596831 2874590934 Bacteria 8299676
664 2874610353 2874604998 Bacteria 7834745
665 2874617925 2874612657 Bacteria 8252029
666 2874624415 2874620515 Bacteria 8290088
667 2874636702 2874628541 Bacteria 8630250
668 2874648636 2874645413 Bacteria 8214782
669 2876766419 2876761206 Bacteria 10111113
670 2876777295 2876771140 Bacteria 8287509
671 2876825377 2876818435 Bacteria 8274608
672 2879077626 2879074833 Bacteria 8279565
673 2879087488 2879083081 Bacteria 8587928
674 2879107219 2879099564 Bacteria 10442239
675 2879111671 2879110137 Bacteria 8907982
676 2879130769 2879127579 Bacteria 8294491
677 2879146071 2879142872 Bacteria 8267021
678 2881371008 2881364244 Bacteria 7710352
679 2881665689 2881665667 Bacteria 8175609
680 2885371405 2885366525 Bacteria 8326213
681 2885377739 2885374607 Bacteria 8927485
682 2885391426 2885383462 Bacteria 9473874
683 2885414606 2885409591 Bacteria 9235467
684 2888379969 2888378607 Bacteria 9652610
685 2888391047 2888388044 Bacteria 7304136
686 2888420778 2888419890 Bacteria 7857137
687 2889035064 2889033259 Bacteria 9099371
688 2893067979 2893066018 Bacteria 6158120
689 2903727634 2903727486 Bacteria 8281579
690 2903749928 2903748898 Bacteria 9972761
691 2903772317 2903768456 Bacteria 9749579
692 2904672246 2904666416 Bacteria 8226587
693 2904692498 2904690495 Bacteria 9412302
694 2904709182
695 2904716177 2904711408 Bacteria 9771557
696 2906602876 2906602504 Bacteria 8295279
697 2906613213
698 2906627035 2906626472 Bacteria 8826946
699 2906635496 2906635258 Bacteria 8601019
700 2906647585 2906643746 Bacteria 8722424
701 2906668627 2906660503 Bacteria 8595048
702 2908747911 2908739725 Bacteria 8628932
703 2908757234 2908756301 Bacteria 8864324
704 2908775759 2908775508 Bacteria 8092255
705 2919078364 2919073203 Bacteria 6531949
706 2922363326 2922361189 Bacteria 7436256
707 2922378355
708 2922388605 2922386360 Bacteria 7017218
709 2922433711
710 2929622544 2929615660 Bacteria 9193770
711 2929631238 2929624759 Bacteria 9339455
712 2932786340 2932784394 Bacteria 9704911
713 2932794692 2932794094 Bacteria 7915132
714 2932805497 2932801729 Bacteria 7987968
715 2932812585 2932809354 Bacteria 9135765
716 2932822947 2932818245 Bacteria 9955613
717 2932829578 2932828146 Bacteria 9745859
718 2933584377 2933577622 Bacteria 9116884
719 2935614964 2935608549 Bacteria 8203142
720 2935618096 2935616580 Bacteria 9032984
721 2935634757 2935630451 Bacteria 8169952
722 2935641506 2935638405 Bacteria 10015038
723 2935652991 2935648319 Bacteria 8801166
724 2935661574 2935656913 Bacteria 8965014
725 2935669436 2935665750 Bacteria 9571747
726 2935677966 2935675223 Bacteria 9928132
727 2935689583 2935684952 Bacteria 9590419
728 2935701796 2935694250 Bacteria 9291695
729 2935707261 2935703347 Bacteria 10242284
730 2935717102 2935713505 Bacteria 9608509
731 2935730064 2935722832 Bacteria 9608746
732 2935738517 2935732158 Bacteria 9706831
733 2935749235 2935741537 Bacteria 9707219
734 2935756936 2935750917 Bacteria 9590372
735 2935764450 2935760218 Bacteria 9817913
736 2935772781 2935769743 Bacteria 7878163
737 2935778082 2935777560 Bacteria 8077691
738 2935787310 2935785616 Bacteria 7962367
739 2935795902 2935793552 Bacteria 8012592
740 2935804360 2935801545 Bacteria 9301974
741 2935817221 2935810662 Bacteria 9401221
742 2935825997 2935819856 Bacteria 8261050
743 2935831237 2935827899 Bacteria 10038562
744 2935841846 2935837841 Bacteria 9454360
745 2935851616 2935847175 Bacteria 8228321
746 2935856405 2935855204 Bacteria 9035059
747 2935871072 2935864058 Bacteria 9784707
748 2935874569 2935873716 Bacteria 9632195
749 2935888906 2935883170 Bacteria 7964738
750 2935910362 2935908558 Bacteria 8568796
751 2935918352 2935916978 Bacteria 9113783
752 2935927727 2935926038 Bacteria 8601059
753 2935936401 2935934488 Bacteria 8602579
754 2935944046 2935942939 Bacteria 8599779
755 2935952483 2935951376 Bacteria 8602333
756 2935964150 2935959822 Bacteria 7869783
757 2935969323 2935967501 Bacteria 8603075
758 2935977912 2935975950 Bacteria 8347125
759 2935984784 2935984226 Bacteria 8302647
760 2935994030 2935992306 Bacteria 9802711
761 2936004959 2936002035 Bacteria 9362176
762 2936015697 2936011229 Bacteria 8801034
763 2936024331 2936019824 Bacteria 8804134
764 2936031782 2936028420 Bacteria 8965941
765 2936044017 2936037263 Bacteria 9446081
766 2936051604 2936046547 Bacteria 8903709
767 2936055955 2936055302 Bacteria 8785755
768 2940562850 2940556831 Bacteria 9590747
769 2941511913 2941507105 Bacteria 8166816
770 2941519615 2941515067 Bacteria 8166720
771 2941527693 2941523033 Bacteria 8169134
772 2941532348 2941531003 Bacteria 7653939
773 2941543919 2941538514 Bacteria 9402094
774 3005475550 3005474847 Bacteria 9259049
775 3005486423 3005483717 Bacteria 7877331
776 3005509551 3005506211 Bacteria 6943378
777 3005589016 3005587118 Bacteria 7794411
778 3005602165 3005594810 Bacteria 8716512
779 3005717922 3005710791 Bacteria 7622528
780 3005724956 3005718088 Bacteria 8283608
781 8006929783 8006926726 Bacteria 6749210
782 8006935747 8006933436 Bacteria 10410654
783 8006968320 8006964411 Bacteria 8966052
784 8006975666 8006973647 Bacteria 10679141
785 8006985942 8006984368 Bacteria 9651211
786 8007000253 8006994254 Bacteria 8309700
787 8016518632 8016511872 Bacteria 9921665
788 8016526610 8016522445 Bacteria 8156687
789 8016531693 8016530956 Bacteria 8155261
790 8016544890 8016539877 Bacteria 8155419
791 8016569963 8016566248 Bacteria 8158151
792 8016582541 8016575299 Bacteria 8154085
793 8016603156 8016595262 Bacteria 8149947
794 8016617954 8016613128 Bacteria 8794220
795 8016623617 8016622563 Bacteria 7999408
796 8016636092 8016630954 Bacteria 9217207
797 8017058038 8017057580 Bacteria 10023680
798 8019531517 8019530166 Bacteria 8155624
799 8019540017 8019538911 Bacteria 7872763
800 8019550639 8019547302 Bacteria 7996444
801 8019563044 8019555841 Bacteria 9642137
802 8019573125 8019565922 Bacteria 9639779
803 8019577696 8019576017 Bacteria 10049540
804 8019595795 8019586578 Bacteria 10212056
805 8019605964 8019597564 Bacteria 10041141
806 8019612568 8019608314 Bacteria 10042931
807 8019622551 8019619141 Bacteria 9218857
808 8019630564 8019629233 Bacteria 8687553
809 8019640050 8019638758 Bacteria 9062356
810 8019652883 8019648815 Bacteria 10014479
811 8019677162 8019668869 Bacteria 8791617
812 8019678822 8019678201 Bacteria 8863603
813 8019696709 8019687851 Bacteria 8712826
814 8055750995 8055742211 Bacteria 9226248
815 8056677733 8056673599 Bacteria 7871253
816 8056688453 8056681323 Bacteria 8472857
817 8056694107 8056689827 Bacteria 6712655
818 Ga0500572_000633
819 JGI25406J46586_10002301
820 JGI25406J46586_10006164
821 JGI25406J46586_10007239
822 JGI25153J46596_10000947
823 JGI25160J50197_1002310
824 Ga0055542_1006056
825 Ga0055531_10002401
826 Ga0065165_1005891
827 Ga0065165_1023874
828 Ga0070658_10033274
829 Ga0070683_100014340
830 Ga0070683_100050291
831 Ga0070670_100152733
832 Ga0068869_100112245
833 Ga0070680_100006331
834 Ga0070680_100105807
835 Ga0070680_100148329
836 Ga0070682_100044950
837 Ga0068868_100047915
838 Ga0070660_100009964
839 Ga0070691_10017608
840 Ga0070668_100091727
841 Ga0070673_100050863
842 Ga0070659_100108110
843 Ga0070709_10000732
844 Ga0070714_100001031
845 Ga0070714_100018874
846 Ga0070714_100136932
847 Ga0070713_100000447
848 Ga0070713_100014459
849 Ga0070713_100039153
850 Ga0070713_100048359
851 Ga0070713_100054432
852 Ga0070713_100319796
853 Ga0070710_10000211
854 Ga0070710_10002104
855 Ga0070710_10011225
856 Ga0070711_100005283
857 Ga0070711_100009790
858 Ga0070711_100023869
859 Ga0070663_100029366
860 Ga0070663_100161009
861 Ga0070662_100009681
862 Ga0070681_10036946
863 Ga0070681_10133621
864 Ga0070698_100143497
865 Ga0070679_100022491
866 Ga0070679_100096241
867 Ga0070679_100197670
868 Ga0070679_100230981
869 Ga0070684_100003114
870 Ga0070684_100008647
871 Ga0070684_100042422
872 Ga0070684_100071338
873 Ga0070684_100091923
874 Ga0070697_100134688
875 Ga0068853_100008174
876 Ga0070693_100036325
877 Ga0070665_100057781
878 Ga0070665_100059724
879 Ga0068855_100033793
880 Ga0068855_100040910
881 Ga0068855_100055240
882 Ga0068855_100286651
883 Ga0070664_100041783
884 Ga0070664_100046895
885 Ga0068856_100002749
886 Ga0068852_100027195
887 Ga0068852_100146597
888 Ga0068852_100260656
889 Ga0068859_100093609
890 Ga0068859_100094950
891 Ga0068851_10005126
892 Ga0068870_10030391
893 Ga0068858_100103546
894 Ga0068860_100000257
895 Ga0068862_100059192
896 Ga0081455_10006921
897 Ga0081455_10007517
898 Ga0081455_10036677
899 Ga0081540_1002991
900 Ga0081540_1005442
901 Ga0081540_1006739
902 Ga0081540_1006907
903 Ga0081540_1035800
904 Ga0081539_10000048
905 Ga0081539_10000530
906 Ga0081539_10023403
907 Ga0070717_10004501
908 Ga0075363_100030835
909 Ga0070716_100001713
910 Ga0075367_10085542
911 Ga0075366_10041070
912 Ga0097621_100213847
913 Ga0075370_10018723
914 Ga0075370_10032739
915 Ga0075370_10121913
916 Ga0097620_100093609
917 Ga0097620_100094952
918 Ga0099824_1001145
919 Ga0099822_1000135
920 Ga0099795_10035443
921 Ga0105240_10005693
922 Ga0105240_10069560
923 Ga0105245_10040748
924 Ga0105241_10116078
925 Ga0105237_10004882
926 Ga0105237_10022753
927 Ga0105238_10008395
928 Ga0099796_10008899
929 Ga0105239_10023381
930 Ga0105239_10117102
931 Ga0105239_10151690
932 Ga0105239_10448479
933 Ga0105246_10017164
934 Ga0157373_10075513
935 Ga0157371_10023913
936 Ga0157369_10024800
937 Ga0157369_10028904
938 Ga0157369_10031823
939 Ga0157374_10012415
940 Ga0157378_10038827
941 Ga0157372_10064246
942 Ga0157372_10081164
943 Ga0157375_10036499
944 Ga0163163_10058864
945 Ga0157380_10063259
946 Ga0157379_10134198
947 Ga0214544_1000087
948 Ga0214542_1000018
949 Ga0214545_1000009
950 Ga0213872_10036852
951 Ga0213875_10007759
952 Ga0209677_100351
953 Ga0209148_1000694
954 Ga0209233_1001183
955 Ga0209233_1002715
956 Ga0209233_1003057
957 Ga0209455_1001551
958 Ga0209564_1001755
959 Ga0209564_1015806
960 Ga0209758_1000015
961 Ga0209758_1000224
962 Ga0209758_1001187
963 Ga0209758_1005118
964 Ga0209758_1009011
965 Ga0209758_1017848
966 Ga0207426_1001141
967 Ga0207426_1004819
968 Ga0209051_1019809
969 Ga0209257_1000440
970 Ga0207656_10004685
971 Ga0207692_10011320
972 Ga0207692_10012479
973 Ga0207692_10019710
974 Ga0207685_10004111
975 Ga0207699_10000480
976 Ga0207699_10001027
977 Ga0207705_10025816
978 Ga0207654_10018569
979 Ga0207707_10004596
980 Ga0207707_10007086
981 Ga0207695_10000065
982 Ga0207695_10066385
983 Ga0207695_10243066
984 Ga0207671_10001858
985 Ga0207671_10012315
986 Ga0207671_10097887
987 Ga0207671_10108087
988 Ga0207671_10231229
989 Ga0207693_10000774
990 Ga0207693_10079234
991 Ga0207663_10000356
992 Ga0207663_10003833
993 Ga0207663_10053410
994 Ga0207660_10002711
995 Ga0207657_10011430
996 Ga0207657_10015396
997 Ga0207652_10004991
998 Ga0207652_10105103
999 Ga0207652_10151680
1000 Ga0207652_10182397
1001 Ga0207694_10007898
1002 Ga0207687_10149472
1003 Ga0207700_10032190
1004 Ga0207700_10038888
1005 Ga0207700_10183069
1006 Ga0207664_10004313
1007 Ga0207664_10245442
1008 Ga0207664_10271154
1009 Ga0207644_10267073
1010 Ga0207706_10044195
1011 Ga0207665_10000289
1012 Ga0207665_10164468
1013 Ga0207661_10000678
1014 Ga0207661_10029561
1015 Ga0207661_10070023
1016 Ga0207679_10054377
1017 Ga0207667_10010722
1018 Ga0207667_10030890
1019 Ga0207667_10052700
1020 Ga0207668_10036396
1021 Ga0207639_10012139
1022 Ga0207678_10011493
1023 Ga0207678_10071759
1024 Ga0207702_10000056
1025 Ga0207702_10325395
1026 Ga0207674_10031657
1027 Ga0207683_10014468
1028 Ga0207683_10063341
1029 Ga0207698_10259015
1030 Ga0209389_1000076
1031 Ga0209589_1000017
1032 Ga0209489_100018
1033 Ga0209489_100416
1034 Ga0209700_100014
1035 Ga0209700_100028
1036 Ga0268266_10009701
1037 Ga0268266_10014397
1038 Ga0268266_10052181
1039 Ga0268266_10053044
1040 Ga0268265_10047858
1041 Ga0268264_10000049
1042 Ga0265318_10007398
1043 Ga0265323_10001811
1044 Ga0307517_10000766
1045 Ga0265338_10000024
1046 Ga0265324_10007310
1047 Ga0265330_10031484
1048 Ga0265332_10023238
1049 Ga0265325_10003471
1050 Ga0265340_10009442
1051 Ga0265339_10005247
1052 Ga0265339_10047978
1053 Ga0265331_10019815
1054 Ga0265316_10095944
1055 Ga0307513_10206949
1056 Ga0307509_10011529
1057 Ga0307509_10060767
1058 Ga0265313_10088268
1059 Ga0307508_10000005
1060 Ga0265314_10005659
1061 Ga0265314_10047193
1062 Ga0265342_10023127
1063 Ga0265342_10054469
1064 Ga0307516_10072365
1065 Ga0307516_10087107
1066 Ga0307412_10150773
1067 Ga0307507_10008595
1068 Ga0307510_10001273
1069 Ga0307510_10007616
1070 Ga0307510_10057910
1071 Ga0307510_10083442
1072 Ga0315911_1000033
1073 Ga0373926_0022912
1074 Ga0373944_0032530
1075 Ga0373923_0009031
1076 Ga0373936_0016157
1077 Ga0373936_0042319
1078 Ga0373953_0001082
1079 Ga0373953_0011203
1080 Ga0373954_0002766
1081 Ga0373954_0021858
1082 Ga0373956_0000296
1083 Ga0373957_0001181
1084 Ga0373957_0066047
1085 Ga0373943_0006477
1086 Ga0373946_0003449
1087 Ga0373924_0014868
1088 Ga0373924_0040505
1089 Ga0373935_0001604
1090 Ga0373935_0041010
1091 Ga0373935_0083390
1092 Ga0373927_0000071
1093 Ga0373927_0054529
1094 Ga0373933_0000114
1095 Ga0373933_0004010
1096 Ga0373933_0029787
1097 Ga0373933_0125855
1098 Ga0373947_0010412
1099 Ga0373947_0010721
1100 Ga0373947_0089639
1101 Ga0373937_0005314
1102 Ga0373937_0075537
1103 Ga0373937_0098220
1104 Ga0372808_005196
1105 Ga0373925_0009450
1106 Ga0373925_0050474
1107 Ga0373925_0133108
1108 Ga0373925_0228811
1109 Ga0395899_0067636
1110 Ga0395900_0006407
1111 Ga0395900_0038973
1112 Ga0395898_0017762
1113 Ga0395898_0067697
1114 Ga0395898_0124991
1115 Ga0395898_0262021
1116 Ga0395898_0270675
1117 Ga0395905_0005511
1118 Ga0436364_0194875
1119 Ga0436364_0806245
1120 Ga0395901_0019529
1121 Ga0395901_0025443
1122 Ga0436365_0409965
1123 Ga0436365_0650112
1124 Ga0436365_1054137
1125 Ga0436360_1265645
1126 Ga0436361_0808880
1127 Ga0436363_0356954
1128 Ga0466972_0000103
1129 Ga0466972_0028761
1130 Ga0466965_0019402
1131 Ga0466966_0002297
1132 Ga0466961_0000129
1133 Ga0466963_0028235
1134 Ga0466964_0089359
1135 Ga0466970_0108567
1136 Ga0466970_0130378
1137 Ga0466959_0014058
1138 Ga0466959_0044960
1139 Ga0466967_0058387
1140 Ga0466967_0101123
1141 Ga0466967_0157719
1142 Ga0466967_0430260
1143 Ga0495617_018889
1144 Ga0495592_0015882
1145 Ga0495592_0020793
1146 Ga0495603_0000035
1147 Ga0495603_0003901
1148 Ga0495603_0016647
1149 Ga0495629_0000081
1150 Ga0495629_0000380
1151 Ga0495629_0131200
1152 Ga0495638_0020842
1153 Ga0495638_0055340
1154 Ga0495638_0060947
1155 Ga0495641_0000707
1156 Ga0495651_0022758
1157 Ga0495651_0061285
1158 Ga0495651_0123348
1159 Ga0495653_0004990
1160 Ga0495580_0008037
1161 Ga0495582_0029958
1162 Ga0495639_0000010
1163 Ga0495639_0025094
1164 Ga0495662_0000034
1165 Ga0495662_0011744
1166 Ga0495664_0098622
1167 Ga0495606_0000265
1168 Ga0495608_0000629
1169 Ga0495618_0032818
1170 Ga0495620_0013656
1171 Ga0495628_0036472
1172 Ga0495628_0070096
1173 Ga0495628_0117489
1174 Ga0495630_0010715
1175 Ga0495630_0024944
1176 Ga0495644_0057973
1177 Ga0495663_0020109
1178 Ga0495666_0020735
1179 Ga0495666_0067074
1180 Ga0495652_0012668
1181 Ga0495652_0020294
1182 Ga0495652_0028332
1183 Ga0495652_0080688
1184 Ga0495665_0000005
1185 Ga0495665_0040768
1186 Ga0495640_0006078
1187 Ga0495640_0016321
1188 Ga0495586_0050165
1189 Ga0495587_0020500
1190 Ga0495587_0028203
1191 Ga0495598_0011495
1192 Ga0495598_0017575
1193 Ga0495645_0044947
1194 Ga0495622_0019641
1195 Ga0495622_0084231
1196 Ga0495667_0013125
1197 Ga0495667_0014316
1198 Ga0495667_0083861
1199 Ga0495668_0005573
1200 Ga0495634_0000261
1201 Ga0495634_0016748
1202 Ga0495634_0068872
1203 Ga0495634_0093259
1204 Ga0495635_0000281
1205 Ga0495635_0003387
1206 Ga0495635_0003556
1207 Ga0495661_0003673
1208 Ga0495588_0002575
1209 Ga0495588_0014606
1210 Ga0495588_0019137
1211 Ga0495599_0009607
1212 Ga0495599_0028089
1213 Ga0495599_0067607
1214 Ga0495623_0030438
1215 Ga0495646_0010990
1216 Ga0495646_0015831
1217 Ga0495646_0017354
1218 Ga0495646_0073094
1219 Ga0495647_0004374
1220 Ga0495658_0000367
1221 Ga0495658_0056832
1222 Ga0495658_0107073
1223 Ga0495613_0011795
1224 Ga0495613_0028734
1225 Ga0495613_0051530
1226 Ga0495624_0000094
1227 Ga0495624_0078047
1228 Ga0495670_0038212
1229 Ga0495600_0000567
1230 Ga0495600_0004278
1231 Ga0495581_0000018
1232 Ga0495604_0005727
1233 Ga0495604_0015120
1234 Ga0495604_0049671
1235 Ga0495674_0000134
1236 Ga0495674_0245331
1237 Ga0495672_0120975
1238 Ga0495676_0039786
1239 Ga0495680_0014317
1240 Ga0495680_0089299
1241 Ga0495675_0013953
1242 Ga0495675_0041292
1243 Ga0495677_0014584
1244 Ga0495684_0000052
1245 Ga0495684_0030899
1246 Ga0495684_0051622
1247 Ga0495686_0019613
1248 Ga0495686_0029614
1249 Ga0495686_0046333
1250 Ga0495593_0000084
1251 Ga0495593_0000214
1252 Ga0495593_0051122
1253 Ga0495614_0035274
1254 Ga0496101_0030946
1255 Ga0496102_0038452
1256 Ga0496104_0005304
1257 Ga0496104_0005388
1258 Ga0496104_0032218
1259 Ga0496104_0063104
1260 Ga0496105_0001275
1261 Ga0496105_0025939
1262 Ga0496105_0031279
1263 Ga0496105_0062404
1264 Ga0496106_0011156
1265 Ga0496106_0051335
1266 Ga0496106_0088701
1267 Ga0496106_0132616
1268 Ga0496106_0144963
1269 Ga0496106_0175271
1270 Ga0496107_0003794
1271 Ga0496108_0028116
1272 Ga0496108_0103808
1273 Ga0496108_0106127
1274 Ga0496109_0025525
1275 Ga0496110_0031931
1276 Ga0496110_0055172
1277 Ga0496110_0191113
1278 Ga0496110_0201284
1279 Ga0496110_0312919
1280 Ga0496112_0000019
1281 Ga0496112_0002348
1282 Ga0496112_0020579
1283 Ga0496112_0032266
1284 Ga0496112_0047324
1285 Ga0496113_0010309
1286 Ga0496114_0053466
1287 Ga0496115_0031637
1288 Ga0496115_0143804
1289 Ga0496115_0243485
1290 Ga0496115_0252624
1291 Ga0496116_0003138
1292 Ga0496116_0055772
1293 Ga0496117_0031153
1294 Ga0496117_0038991
1295 Ga0496118_0049117
1296 Ga0496118_0063626
1297 Ga0496118_0181629
1298 Ga0496119_0019380
1299 Ga0496120_0005446
1300 Ga0496120_0044907
1301 Ga0496120_0058151
1302 Ga0496121_0000716
1303 Ga0496121_0001737
1304 Ga0496121_0004612
1305 Ga0496121_0022824
1306 Ga0496121_0027214
1307 Ga0496121_0031957
1308 Ga0496121_0040197
1309 Ga0496121_0063144
1310 Ga0496121_0077681
1311 Ga0496121_0097573
1312 Ga0496121_0108417
1313 Ga0496121_0170217
1314 Ga0496122_0018007
1315 Ga0496124_0001529
1316 Ga0496124_0051737
1317 Ga0496124_0119606
1318 Ga0496125_0000048
1319 Ga0496125_0000746
1320 Ga0496125_0007153
1321 Ga0496125_0032850
1322 Ga0496125_0175190
1323 Ga0496126_0011417
1324 Ga0496126_0027182
1325 Ga0496126_0027460
1326 Ga0496126_0029037
1327 Ga0496126_0065763
1328 Ga0496126_0070482
1329 Ga0496126_0101584
1330 Ga0501031_0006545
1331 Ga0501032_0000048
1332 Ga0501033_0000184
1333 Ga0501034_0000082
1334 Ga0501034_0010558
1335 Ga0501036_0000791
1336 Ga0501037_0000063
1337 Ga0501037_0136567
1338 Ga0501038_0000295
1339 Ga0501039_0000082
1340 Ga0501043_0000148
1341 Ga0501046_0000101
1342 Ga0501047_0000671
1343 Ga0501047_0150449
1344 Ga0501048_0006649
1345 Ga0501048_0046199
1346 Ga0501067_0000056
1347 Ga0501067_0066309
1348 Ga0501067_0068332
1349 Ga0501068_0000310
1350 Ga0501069_0001375
1351 Ga0501069_0049199
1352 Ga0501070_0043351
1353 Ga0501072_0006466
1354 Ga0501073_0000053
1355 Ga0501074_0000331
1356 Ga0501074_0205662
1357 Ga0501079_0000586
1358 Ga0501080_0000922
1359 Ga0501080_0049187
1360 Ga0501083_0005043
1361 Ga0501035_0000474
1362 Ga0501035_0019650
1363 Ga0501044_0000408
1364 Ga0501044_0267764
1365 Ga0501045_0001959
1366 nmdc:mga07m45_37482_c2
1367 nmdc:mga07m45_9280_c1
1368 nmdc:mga0sz30_9859_c1
1369 Ga0495601_0135290
1370 Ga0500635_0000644
1371 Ga0495595_0003526
1372 Ga0495619_0003340
1373 Ga0495619_0178693
1374 Ga0500578_0035655
1375 Ga0500643_000062
1376 Ga0500643_007900
1377 Ga0500583_0067309
1378 Ga0500566_0000754
1379 Ga0500566_0000896
1380 Ga0500566_0002969
1381 Ga0500641_0005076
1382 Ga0500641_0012945
1383 Ga0500554_000781
1384 Ga0500556_0000012
1385 Ga0500557_000043
1386 Ga0500569_002435
1387 Ga0500591_015490
1388 Ga0500594_0004199
1389 Ga0500595_003786
1390 Ga0500595_004250
1391 Ga0500595_008925
1392 Ga0500595_013017
1393 Ga0500595_025259
1394 Ga0500642_0000193
1395 Ga0500652_000891
1396 Ga0500559_0001232
1397 Ga0500559_0018624
1398 Ga0500568_0008164
1399 Ga0500568_0011131
1400 Ga0500568_0064106
1401 Ga0500573_0156872
1402 Ga0500577_0000112
1403 Ga0500590_039868
1404 Ga0500603_001634
1405 Ga0500603_017792
1406 Ga0500616_0000035
1407 Ga0500627_0075848
1408 Ga0500634_0008134
1409 Ga0500639_004728
1410 Ga0500636_0000075
1411 Ga0500636_0000934
1412 Ga0500636_0019627
1413 Ga0500637_0000155
1414 Ga0500637_0002240
1415 Ga0500637_0039657
1416 Ga0500625_000791
1417 Ga0500596_004199
1418 Ga0500596_004749
1419 Ga0500596_006081
1420 Ga0501084_0002066
1421 Ga0500661_000408
1422 Ga0501082_0007314
1423 2507504837
1424 2508546192
1425 2508695124
1426 2509149792
1427 2511398309
1428 2513625419
1429 2513639548
1430 2513647968
1431 2513672984
1432 2513694918
1433 2513703346
1434 2513715703
1435 2513862931
1436 2513889777
1437 2514012892
1438 2515625870
1439 2517102393
1440 2517889310
1441 2524435738
1442 2524466460
1443 2524540357
1444 2603857874
1445 2617351695
1446 2723842033
1447 2728755367
1448 2745079034
1449 2793066042
1450 2793070968
1451 2793077416
1452 2805916002
1453 2818237274
1454 2824602569
1455 2824612651
1456 2824621113
1457 2824630120
1458 2824640725
1459 2824654466
1460 2824674860
1461 2824691928
1462 2824727937
1463 2824757120
1464 2824774949
1465 2838129552
1466 2841944453
1467 2841951594
1468 2841964619
1469 2841969230
1470 2841982895
1471 2841991023
1472 2842043889
1473 2842052121
1474 2844321816
1475 2847931475
1476 2847941747
1477 2849082669
1478 2857511562
1479 2857527247
1480 2874596831
1481 2874610353
1482 2874617925
1483 2874624415
1484 2874636702
1485 2874648636
1486 2876766419
1487 2876777295
1488 2876825377
1489 2879077626
1490 2879087488
1491 2879107219
1492 2879111671
1493 2879130769
1494 2879146071
1495 2881371008
1496 2881665689
1497 2885371405
1498 2885377739
1499 2885391426
1500 2885414606
1501 2888379969
1502 2888391047
1503 2888420778
1504 2889035064
1505 2893067979
1506 2903727634
1507 2903749928
1508 2903772317
1509 2904672246
1510 2904692498
1511 2904709182
1512 2904716177
1513 2906602876
1514 2906613213
1515 2906627035
1516 2906635496
1517 2906647585
1518 2906668627
1519 2908747911
1520 2908757234
1521 2908775759
1522 2919078364
1523 2922363326
1524 2922378355
1525 2922388605
1526 2922433711
1527 2929622544
1528 2929631238
1529 2932786340
1530 2932794692
1531 2932805497
1532 2932812585
1533 2932822947
1534 2932829578
1535 2933584377
1536 2935614964
1537 2935618096
1538 2935634757
1539 2935641506
1540 2935652991
1541 2935661574
1542 2935669436
1543 2935677966
1544 2935689583
1545 2935701796
1546 2935707261
1547 2935717102
1548 2935730064
1549 2935738517
1550 2935749235
1551 2935756936
1552 2935764450
1553 2935772781
1554 2935778082
1555 2935787310
1556 2935795902
1557 2935804360
1558 2935817221
1559 2935825997
1560 2935831237
1561 2935841846
1562 2935851616
1563 2935856405
1564 2935871072
1565 2935874569
1566 2935888906
1567 2935910362
1568 2935918352
1569 2935927727
1570 2935936401
1571 2935944046
1572 2935952483
1573 2935964150
1574 2935969323
1575 2935977912
1576 2935984784
1577 2935994030
1578 2936004959
1579 2936015697
1580 2936024331
1581 2936031782
1582 2936044017
1583 2936051604
1584 2936055955
1585 2940562850
1586 2941511913
1587 2941519615
1588 2941527693
1589 2941532348
1590 2941543919
1591 3005475550
1592 3005486423
1593 3005509551
1594 3005589016
1595 3005602165
1596 3005717922
1597 3005724956
1598 8006929783
1599 8006935747
1600 8006968320
1601 8006975666
1602 8006985942
1603 8007000253
1604 8016518632
1605 8016526610
1606 8016531693
1607 8016544890
1608 8016569963
1609 8016582541
1610 8016603156
1611 8016617954
1612 8016623617
1613 8016636092
1614 8017058038
1615 8019531517
1616 8019540017
1617 8019550639
1618 8019563044
1619 8019573125
1620 8019577696
1621 8019595795
1622 8019605964
1623 8019612568
1624 8019622551
1625 8019630564
1626 8019640050
1627 8019652883
1628 8019677162
1629 8019678822
1630 8019696709
1631 8055750995
1632 8056677733
1633 8056688453
1634 8056694107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8314 21 387
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8303 20 387
6n3i-assembly1.cif.gz_A crystal structure of a double trp xyle mutants (g58w/l315w) 0.8192 16 387
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.8189 16 389
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.816 20 387
ID Description Score Start End Superfamily
af_Q4D047_16_187_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9259 223 387 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9159 216 388 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9119 212 388 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9079 218 389 1.20.1250.20
af_A0A1D8PTY2_75_285_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9075 218 389 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2H0ER64-F1-model_v4 MFS transporter 0.9652 55 395 GO:0016020
GO:0022857
AF-A0A0A1PSC9-F1-model_v4 Multidrug efflux system protein MdtL 0.96 19 394 GO:0016020
GO:0022857
AF-A0A351CXL4-F1-model_v4 MFS transporter 0.9589 16 395 GO:0016020
GO:0022857
AF-A0A1E4FX45-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9586 14 396 GO:0016020
GO:0022857
AF-A0A6L7ZVP9-F1-model_v4 MFS transporter 0.9507 16 401 GO:0016020
GO:0022857

Map