F482122

General Info

Members Datasets Scaffolds Average Seq Length
818 307 1636 495

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100019780|Ga0068868_1000197802
Length 506
Sequence MLAKNLTEALTFDDVLLIPAYSEVVPAQVSTQTQLTRDITLNTPLLSSAMDTVTESRMAIAMAQQGGIGIVHRNLTIEAQAGEIDKVKRSESGMIVDPVTIGPDQQIADALEVMRRYKISGVPVTKGTKLVGILTNRDLRFETRVDVPVGDVMTKENLITVAVGTTLEEAELILHKHRVEKLLVVDDQYNLKGLITVKDIQKKLKYPSASKDEKGRLRVGGAIGATGDFLERAEELVNARVDVLAIDSAHGHSSRVLEAVREVKKRFPGVGVLAGNVATYEGAQALMDAGADAIKVGIGPGSICTTRMVTGAGMPQITAIAESARAAQERGIPVIADGGIKYSGEVTKAIAAGASSVMIGSLFAGVDESPGETILYQGRSFKSYRGMGSLTAMSQGSGERYFQSAEDLAKEIDTEGVVQRERNGQNRLAKFVPEGIEGRVPYRGPLEAMVYQLVGGLRSGMGYLGCGTIAELQQKAQFVRISNAGLRESHVHDVIITREAPNYHVE

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
166 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 1.47
Rhizosphere 95.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100019780 3300005338 Bacteria 5050
2 Ga0065715_10093704 3300005293 Bacteria 4593
3 Ga0070658_10057258 3300005327 Bacteria 3170
4 Ga0070676_10009362 3300005328 Bacteria 5294
5 Ga0070676_10051548 3300005328 Bacteria 2417
6 Ga0070683_100000002 3300005329 Bacteria 427530
7 Ga0070683_100007932 3300005329 Bacteria 9004
8 Ga0070683_100078429 3300005329 Bacteria 3090
9 Ga0070683_100099042 3300005329 Bacteria 2744
10 Ga0070670_100001949 3300005331 Bacteria 16915
11 Ga0070666_10017503 3300005335 Bacteria 4594
12 Ga0070666_10041327 3300005335 Bacteria 3081
13 Ga0070666_10103624 3300005335 Bacteria 1963
14 Ga0070680_100026699 3300005336 Bacteria 4618
15 Ga0070680_100032224 3300005336 Bacteria 4217
16 Ga0070682_100064443 3300005337 Bacteria 2326
17 Ga0068868_100001660 3300005338 Bacteria 15197
18 Ga0068868_100015752 3300005338 Bacteria 5600
19 Ga0068868_100021745 3300005338 Bacteria 4833
20 Ga0068868_100066500 3300005338 Bacteria 2866
21 Ga0068868_100067628 3300005338 Bacteria 2844
22 Ga0070660_100007894 3300005339 Bacteria 7425
23 Ga0070660_100115767 3300005339 Bacteria 2137
24 Ga0070687_100054056 3300005343 Bacteria 2091
25 Ga0070661_100008885 3300005344 Bacteria 6954
26 Ga0070661_100019563 3300005344 Bacteria 4826
27 Ga0070661_100025646 3300005344 Bacteria 4238
28 Ga0070661_100054741 3300005344 Bacteria 2922
29 Ga0070668_100011535 3300005347 Bacteria 6579
30 Ga0070675_100003550 3300005354 Bacteria 11840
31 Ga0070675_100020001 3300005354 Bacteria 5341
32 Ga0070675_100020069 3300005354 Bacteria 5331
33 Ga0070675_100055347 3300005354 Bacteria 3265
34 Ga0070675_100114608 3300005354 Bacteria 2284
35 Ga0070671_100000378 3300005355 Bacteria 30628
36 Ga0070671_100015148 3300005355 Bacteria 6228
37 Ga0070671_100042917 3300005355 Bacteria 3761
38 Ga0070674_100012266 3300005356 Bacteria 5259
39 Ga0070673_100007515 3300005364 Bacteria 7198
40 Ga0070673_100098684 3300005364 Bacteria 2401
41 Ga0070688_100038813 3300005365 Bacteria 2911
42 Ga0070659_100016010 3300005366 Bacteria 5625
43 Ga0070667_100004263 3300005367 Bacteria 12077
44 Ga0070667_100015915 3300005367 Bacteria 6223
45 Ga0070667_100019425 3300005367 Bacteria 5638
46 Ga0070703_10009229 3300005406 Bacteria 2783
47 Ga0070709_10000423 3300005434 Bacteria 25611
48 Ga0070714_100000096 3300005435 Bacteria 74616
49 Ga0070714_100001908 3300005435 Bacteria 15192
50 Ga0070714_100102955 3300005435 Bacteria 2518
51 Ga0070713_100000364 3300005436 Bacteria 29177
52 Ga0070713_100008685 3300005436 Bacteria 7225
53 Ga0070713_100011727 3300005436 Bacteria 6397
54 Ga0070713_100103287 3300005436 Bacteria 2473
55 Ga0070701_10007710 3300005438 Bacteria 4618
56 Ga0070711_100103524 3300005439 Bacteria 2075
57 Ga0070705_100047339 3300005440 Bacteria 2485
58 Ga0070705_100049561 3300005440 Bacteria 2439
59 Ga0070694_100012714 3300005444 Bacteria 5241
60 Ga0070708_100000805 3300005445 Bacteria 23638
61 Ga0070708_100003971 3300005445 Bacteria 11607
62 Ga0070708_100007485 3300005445 Bacteria 8742
63 Ga0070708_100012412 3300005445 Bacteria 6955
64 Ga0070663_100010931 3300005455 Bacteria 5673
65 Ga0070663_100062398 3300005455 Bacteria 2687
66 Ga0070662_100006651 3300005457 Bacteria 7465
67 Ga0070662_100053402 3300005457 Bacteria 2925
68 Ga0070662_100056115 3300005457 Bacteria 2859
69 Ga0070681_10006468 3300005458 Bacteria 11407
70 Ga0070681_10073881 3300005458 Bacteria 3371
71 Ga0070681_10092236 3300005458 Bacteria 2978
72 Ga0070681_10157601 3300005458 Bacteria 2194
73 Ga0068867_100007704 3300005459 Bacteria 7619
74 Ga0068867_100022763 3300005459 Bacteria 4482
75 Ga0070685_10019908 3300005466 Bacteria 3627
76 Ga0070706_100000278 3300005467 Bacteria 62365
77 Ga0070706_100021666 3300005467 Bacteria 5918
78 Ga0070706_100245321 3300005467 Bacteria 1672
79 Ga0070707_100000221 3300005468 Bacteria 57035
80 Ga0070698_100023905 3300005471 Bacteria 6380
81 Ga0070699_100015903 3300005518 Bacteria 6461
82 Ga0070699_100018350 3300005518 Bacteria 6011
83 Ga0070679_100003386 3300005530 Bacteria 14614
84 Ga0070679_100009883 3300005530 Bacteria 9026
85 Ga0070679_100047135 3300005530 Bacteria 4297
86 Ga0070679_100068323 3300005530 Bacteria 3545
87 Ga0070684_100000007 3300005535 Bacteria 217174
88 Ga0070684_100039558 3300005535 Bacteria 4057
89 Ga0070684_100044069 3300005535 Bacteria 3857
90 Ga0070684_100099199 3300005535 Bacteria 2599
91 Ga0070697_100000993 3300005536 Bacteria 21455
92 Ga0070697_100001847 3300005536 Bacteria 16183
93 Ga0070697_100033249 3300005536 Bacteria 4152
94 Ga0068853_100014788 3300005539 Bacteria 6405
95 Ga0068853_100022773 3300005539 Bacteria 5236
96 Ga0070672_100101299 3300005543 Bacteria 2336
97 Ga0070686_100032737 3300005544 Bacteria 3189
98 Ga0070695_100010421 3300005545 Bacteria 5550
99 Ga0070696_100002464 3300005546 Bacteria 12271
100 Ga0070696_100006664 3300005546 Bacteria 7714
101 Ga0070693_100000037 3300005547 Bacteria 50504
102 Ga0070665_100028376 3300005548 Bacteria 5638
103 Ga0068855_100000642 3300005563 Bacteria 42759
104 Ga0068855_100002278 3300005563 Bacteria 23709
105 Ga0068855_100013554 3300005563 Bacteria 9834
106 Ga0068855_100022851 3300005563 Bacteria 7496
107 Ga0068855_100085072 3300005563 Bacteria 3660
108 Ga0068855_100158826 3300005563 Bacteria 2567
109 Ga0068855_100235951 3300005563 Bacteria 2045
110 Ga0070664_100001989 3300005564 Bacteria 16388
111 Ga0070664_100104305 3300005564 Bacteria 2469
112 Ga0070664_100204667 3300005564 Bacteria 1762
113 Ga0068857_100001478 3300005577 Bacteria 18698
114 Ga0068857_100009230 3300005577 Bacteria 8556
115 Ga0068857_100040887 3300005577 Bacteria 4110
116 Ga0068857_100134234 3300005577 Bacteria 2234
117 Ga0068854_100029876 3300005578 Bacteria 3776
118 Ga0068856_100003152 3300005614 Bacteria 16815
119 Ga0068856_100014834 3300005614 Bacteria 7521
120 Ga0068856_100014853 3300005614 Bacteria 7515
121 Ga0068856_100016878 3300005614 Bacteria 7076
122 Ga0068856_100042132 3300005614 Bacteria 4491
123 Ga0068856_100043286 3300005614 Bacteria 4430
124 Ga0068852_100000415 3300005616 Bacteria 28473
125 Ga0068852_100073456 3300005616 Bacteria 3009
126 Ga0068852_100081737 3300005616 Bacteria 2869
127 Ga0068852_100206405 3300005616 Bacteria 1862
128 Ga0068859_100006813 3300005617 Bacteria 11608
129 Ga0068859_100010766 3300005617 Bacteria 9204
130 Ga0068859_100033639 3300005617 Bacteria 5148
131 Ga0068859_100077042 3300005617 Bacteria 3375
132 Ga0068859_100100435 3300005617 Bacteria 2949
133 Ga0068859_100120349 3300005617 Bacteria 2692
134 Ga0068864_100001669 3300005618 Bacteria 18274
135 Ga0068864_100003645 3300005618 Bacteria 12734
136 Ga0068864_100004251 3300005618 Bacteria 11784
137 Ga0068864_100135900 3300005618 Bacteria 2214
138 Ga0068866_10021754 3300005718 Bacteria 2958
139 Ga0068866_10038702 3300005718 Bacteria 2350
140 Ga0068851_10006846 3300005834 Bacteria 5219
141 Ga0068851_10008567 3300005834 Bacteria 4731
142 Ga0068851_10015529 3300005834 Bacteria 3629
143 Ga0068863_100004389 3300005841 Bacteria 13905
144 Ga0068863_100030408 3300005841 Bacteria 5157
145 Ga0068863_100064567 3300005841 Bacteria 3462
146 Ga0068863_100067932 3300005841 Bacteria 3372
147 Ga0068863_100138445 3300005841 Bacteria 2326
148 Ga0068858_100003482 3300005842 Bacteria 15606
149 Ga0068858_100004396 3300005842 Bacteria 13831
150 Ga0068858_100007847 3300005842 Bacteria 10295
151 Ga0068858_100014966 3300005842 Bacteria 7300
152 Ga0068858_100026791 3300005842 Bacteria 5355
153 Ga0068858_100031600 3300005842 Bacteria 4918
154 Ga0068858_100083674 3300005842 Bacteria 2967
155 Ga0068860_100002369 3300005843 Bacteria 19794
156 Ga0068860_100011406 3300005843 Bacteria 8756
157 Ga0068860_100023431 3300005843 Bacteria 5966
158 Ga0068860_100049370 3300005843 Bacteria 4008
159 Ga0068860_100072062 3300005843 Bacteria 3283
160 Ga0081455_10000246 3300005937 Bacteria 70584
161 Ga0081455_10013820 3300005937 Bacteria 7944
162 Ga0081455_10047850 3300005937 Bacteria 3699
163 Ga0081538_10000663 3300005981 Bacteria 38027
164 Ga0081538_10001749 3300005981 Bacteria 22060
165 Ga0081538_10006844 3300005981 Bacteria 9935
166 Ga0081540_1005801 3300005983 Bacteria 9136
167 Ga0081540_1016962 3300005983 Bacteria 4529
168 Ga0070717_10002621 3300006028 Bacteria 12687
169 Ga0070717_10045959 3300006028 Bacteria 3571
170 Ga0070717_10193400 3300006028 Bacteria 1778
171 Ga0075365_10021836 3300006038 Bacteria 3999
172 Ga0075364_10005747 3300006051 Bacteria 7234
173 Ga0070712_100002672 3300006175 Bacteria 11005
174 Ga0070712_100010032 3300006175 Bacteria 5971
175 Ga0070712_100137108 3300006175 Bacteria 1862
176 Ga0075367_10009184 3300006178 Bacteria 5157
177 Ga0075366_10001249 3300006195 Bacteria 12628
178 Ga0097621_100004652 3300006237 Bacteria 9582
179 Ga0097621_100015449 3300006237 Bacteria 5743
180 Ga0097621_100020172 3300006237 Bacteria 5134
181 Ga0097621_100024268 3300006237 Bacteria 4733
182 Ga0097621_100031066 3300006237 Bacteria 4235
183 Ga0097621_100036253 3300006237 Bacteria 3945
184 Ga0097621_100052500 3300006237 Bacteria 3321
185 Ga0097621_100111216 3300006237 Bacteria 2315
186 Ga0068871_100014111 3300006358 Bacteria 5943
187 Ga0068871_100026889 3300006358 Bacteria 4494
188 Ga0068871_100030778 3300006358 Bacteria 4230
189 Ga0068871_100039111 3300006358 Bacteria 3793
190 Ga0068871_100058314 3300006358 Bacteria 3143
191 Ga0068871_100078857 3300006358 Bacteria 2723
192 Ga0075428_100003081 3300006844 Bacteria 18188
193 Ga0075428_100132027 3300006844 Bacteria 2716
194 Ga0075428_100357777 3300006844 Bacteria 1566
195 Ga0075431_100005846 3300006847 Bacteria 12173
196 Ga0075431_100109414 3300006847 Bacteria 2852
197 Ga0075433_10015741 3300006852 Bacteria 6214
198 Ga0075433_10082186 3300006852 Bacteria 2841
199 Ga0075433_10089230 3300006852 Bacteria 2725
200 Ga0075433_10209197 3300006852 Bacteria 1734
201 Ga0075434_100003909 3300006871 Bacteria 13339
202 Ga0075434_100005331 3300006871 Bacteria 11701
203 Ga0075434_100008203 3300006871 Bacteria 9690
204 Ga0075434_100033223 3300006871 Bacteria 5091
205 Ga0075429_100024549 3300006880 Bacteria 5230
206 Ga0068865_100007218 3300006881 Bacteria 6826
207 Ga0068865_100011388 3300006881 Bacteria 5563
208 Ga0068865_100019789 3300006881 Bacteria 4359
209 Ga0068865_100020714 3300006881 Bacteria 4268
210 Ga0097620_100006814 3300006931 Bacteria 11608
211 Ga0097620_100010766 3300006931 Bacteria 9204
212 Ga0097620_100033641 3300006931 Bacteria 5148
213 Ga0097620_100077030 3300006931 Bacteria 3375
214 Ga0097620_100100428 3300006931 Bacteria 2949
215 Ga0097620_100120348 3300006931 Bacteria 2692
216 Ga0075435_100009419 3300007076 Bacteria 7069
217 Ga0099795_10031829 3300007788 Bacteria 1820
218 Ga0105240_10000734 3300009093 Bacteria 59913
219 Ga0105240_10001326 3300009093 Bacteria 42653
220 Ga0105240_10001395 3300009093 Bacteria 41517
221 Ga0105240_10025014 3300009093 Bacteria 7860
222 Ga0105240_10030445 3300009093 Bacteria 7015
223 Ga0105240_10032052 3300009093 Bacteria 6806
224 Ga0105240_10081283 3300009093 Bacteria 3982
225 Ga0105240_10098075 3300009093 Bacteria 3570
226 Ga0111539_10004140 3300009094 Bacteria 19023
227 Ga0111539_10009382 3300009094 Bacteria 12354
228 Ga0111539_10012378 3300009094 Bacteria 10697
229 Ga0111539_10029920 3300009094 Bacteria 6624
230 Ga0111539_10035040 3300009094 Bacteria 6078
231 Ga0111539_10219191 3300009094 Bacteria 2216
232 Ga0105245_10007394 3300009098 Bacteria 9618
233 Ga0105245_10028226 3300009098 Bacteria 4947
234 Ga0105245_10029145 3300009098 Bacteria 4874
235 Ga0105245_10036728 3300009098 Bacteria 4353
236 Ga0105245_10055244 3300009098 Bacteria 3566
237 Ga0105245_10073069 3300009098 Bacteria 3117
238 Ga0105245_10126779 3300009098 Bacteria 2390
239 Ga0114129_10000777 3300009147 Bacteria 40773
240 Ga0114129_10008706 3300009147 Bacteria 14466
241 Ga0114129_10058156 3300009147 Bacteria 5408
242 Ga0114129_10147701 3300009147 Bacteria 3219
243 Ga0114129_10225080 3300009147 Bacteria 2529
244 Ga0114129_10501756 3300009147 Bacteria 1585
245 Ga0105243_10019881 3300009148 Bacteria 5093
246 Ga0105241_10032077 3300009174 Bacteria 3935
247 Ga0105241_10043258 3300009174 Bacteria 3411
248 Ga0105241_10049056 3300009174 Bacteria 3214
249 Ga0105242_10056943 3300009176 Bacteria 3199
250 Ga0105248_10000094 3300009177 Bacteria 98558
251 Ga0105248_10000806 3300009177 Bacteria 35108
252 Ga0105248_10001021 3300009177 Bacteria 30968
253 Ga0105248_10003639 3300009177 Bacteria 17111
254 Ga0105248_10013851 3300009177 Bacteria 8872
255 Ga0105248_10020967 3300009177 Bacteria 7244
256 Ga0105248_10056649 3300009177 Bacteria 4397
257 Ga0105248_10064389 3300009177 Bacteria 4116
258 Ga0105248_10138686 3300009177 Bacteria 2743
259 Ga0105248_10261284 3300009177 Bacteria 1949
260 Ga0105237_10022562 3300009545 Bacteria 6457
261 Ga0105237_10031468 3300009545 Bacteria 5380
262 Ga0105237_10076730 3300009545 Bacteria 3332
263 Ga0105237_10231164 3300009545 Bacteria 1850
264 Ga0105238_10000635 3300009551 Bacteria 37013
265 Ga0105238_10017459 3300009551 Bacteria 7293
266 Ga0105238_10060106 3300009551 Bacteria 3806
267 Ga0105238_10064670 3300009551 Bacteria 3657
268 Ga0105238_10067857 3300009551 Bacteria 3567
269 Ga0105249_10032997 3300009553 Bacteria 4686
270 Ga0105249_10055655 3300009553 Bacteria 3620
271 Ga0105239_10002713 3300010375 Bacteria 22271
272 Ga0105239_10029098 3300010375 Bacteria 6073
273 Ga0105239_10030580 3300010375 Bacteria 5922
274 Ga0105239_10069943 3300010375 Bacteria 3855
275 Ga0105239_10105811 3300010375 Bacteria 3116
276 Ga0105246_10016520 3300011119 Bacteria 4674
277 Ga0157370_10000137 3300013104 Bacteria 88336
278 Ga0157370_10058522 3300013104 Bacteria 3663
279 Ga0157370_10179396 3300013104 Bacteria 1968
280 Ga0157369_10001369 3300013105 Bacteria 30048
281 Ga0157369_10001777 3300013105 Bacteria 26103
282 Ga0157369_10023951 3300013105 Bacteria 6793
283 Ga0157369_10097222 3300013105 Bacteria 3141
284 Ga0157374_10000659 3300013296 Bacteria 30341
285 Ga0157374_10007218 3300013296 Bacteria 9465
286 Ga0157374_10011444 3300013296 Bacteria 7682
287 Ga0157374_10014732 3300013296 Bacteria 6848
288 Ga0157374_10015360 3300013296 Bacteria 6714
289 Ga0157374_10021536 3300013296 Bacteria 5738
290 Ga0157374_10041913 3300013296 Bacteria 4221
291 Ga0157374_10112524 3300013296 Bacteria 2619
292 Ga0157378_10000217 3300013297 Bacteria 55710
293 Ga0157378_10000368 3300013297 Bacteria 44566
294 Ga0157378_10009309 3300013297 Bacteria 8557
295 Ga0157378_10105385 3300013297 Bacteria 2578
296 Ga0157378_10142141 3300013297 Bacteria 2229
297 Ga0163162_10003509 3300013306 Bacteria 14999
298 Ga0163162_10010248 3300013306 Bacteria 9105
299 Ga0163162_10013499 3300013306 Bacteria 7974
300 Ga0163162_10044186 3300013306 Bacteria 4462
301 Ga0163162_10050679 3300013306 Bacteria 4163
302 Ga0163162_10194436 3300013306 Bacteria 2157
303 Ga0163162_10253473 3300013306 Bacteria 1892
304 Ga0163162_10328964 3300013306 Bacteria 1661
305 Ga0157372_10000134 3300013307 Bacteria 81431
306 Ga0157372_10000424 3300013307 Bacteria 46469
307 Ga0157372_10005022 3300013307 Bacteria 14053
308 Ga0157372_10022198 3300013307 Bacteria 6866
309 Ga0157372_10109955 3300013307 Bacteria 3157
310 Ga0157372_10249923 3300013307 Bacteria 2058
311 Ga0157375_10001430 3300013308 Bacteria 20541
312 Ga0157375_10051835 3300013308 Bacteria 4032
313 Ga0157375_10060584 3300013308 Bacteria 3754
314 Ga0157375_10122408 3300013308 Bacteria 2713
315 Ga0157375_10129329 3300013308 Bacteria 2643
316 Ga0157375_10287886 3300013308 Bacteria 1806
317 Ga0163163_10000729 3300014325 Bacteria 27951
318 Ga0163163_10007573 3300014325 Bacteria 9591
319 Ga0163163_10026318 3300014325 Bacteria 5559
320 Ga0163163_10051412 3300014325 Bacteria 4064
321 Ga0163163_10075764 3300014325 Bacteria 3358
322 Ga0163163_10205888 3300014325 Bacteria 2016
323 Ga0157380_10023314 3300014326 Bacteria 4668
324 Ga0157377_10039805 3300014745 Bacteria 2601
325 Ga0157379_10022635 3300014968 Bacteria 5568
326 Ga0157379_10045112 3300014968 Bacteria 3935
327 Ga0157376_10021045 3300014969 Bacteria 5060
328 Ga0157376_10032863 3300014969 Bacteria 4170
329 Ga0157376_10036571 3300014969 Bacteria 3979
330 Ga0157376_10066786 3300014969 Bacteria 3041
331 Ga0157376_10067881 3300014969 Bacteria 3017
332 Ga0157376_10094775 3300014969 Bacteria 2594
333 Ga0182007_10005535 3300015262 Bacteria 5530
334 Ga0163161_10018153 3300017792 Bacteria 4931
335 Ga0213872_10001564 3300021361 Bacteria 14608
336 Ga0213872_10034060 3300021361 Bacteria 2332
337 Ga0213876_10036843 3300021384 Bacteria 2580
338 Ga0213875_10000004 3300021388 Bacteria 703388
339 Ga0213875_10000313 3300021388 Bacteria 46302
340 Ga0213875_10010292 3300021388 Bacteria 4686
341 Ga0213875_10010911 3300021388 Bacteria 4539
342 Ga0213871_10003941 3300021441 Bacteria 2918
343 Ga0224569_100108 3300022732 Bacteria 5748
344 Ga0228598_1001374 3300024227 Bacteria 5347
345 Ga0207656_10008171 3300025321 Bacteria 3841
346 Ga0207692_10027104 3300025898 Bacteria 2695
347 Ga0207642_10034805 3300025899 Bacteria 2145
348 Ga0207680_10008418 3300025903 Bacteria 5063
349 Ga0207680_10017582 3300025903 Bacteria 3781
350 Ga0207680_10041434 3300025903 Bacteria 2686
351 Ga0207699_10000209 3300025906 Bacteria 34945
352 Ga0207699_10126074 3300025906 Bacteria 1662
353 Ga0207643_10032617 3300025908 Bacteria 2910
354 Ga0207684_10011624 3300025910 Bacteria 7688
355 Ga0207684_10027366 3300025910 Bacteria 4859
356 Ga0207684_10029639 3300025910 Bacteria 4659
357 Ga0207684_10040107 3300025910 Bacteria 3969
358 Ga0207684_10055510 3300025910 Bacteria 3360
359 Ga0207654_10056884 3300025911 Bacteria 2271
360 Ga0207654_10082870 3300025911 Bacteria 1935
361 Ga0207707_10021854 3300025912 Bacteria 5592
362 Ga0207707_10037500 3300025912 Bacteria 4236
363 Ga0207695_10000379 3300025913 Bacteria 101331
364 Ga0207695_10003457 3300025913 Bacteria 22260
365 Ga0207695_10017528 3300025913 Bacteria 8330
366 Ga0207695_10025208 3300025913 Bacteria 6664
367 Ga0207695_10026384 3300025913 Bacteria 6484
368 Ga0207695_10027004 3300025913 Bacteria 6397
369 Ga0207695_10030031 3300025913 Bacteria 5992
370 Ga0207695_10052463 3300025913 Bacteria 4272
371 Ga0207695_10134305 3300025913 Bacteria 2429
372 Ga0207695_10275964 3300025913 Bacteria 1575
373 Ga0207671_10143354 3300025914 Bacteria 1842
374 Ga0207671_10190968 3300025914 Bacteria 1597
375 Ga0207693_10000026 3300025915 Bacteria 122717
376 Ga0207693_10062889 3300025915 Bacteria 2908
377 Ga0207693_10085307 3300025915 Bacteria 2474
378 Ga0207693_10120672 3300025915 Bacteria 2059
379 Ga0207663_10030366 3300025916 Bacteria 3188
380 Ga0207663_10050554 3300025916 Bacteria 2584
381 Ga0207663_10116911 3300025916 Bacteria 1819
382 Ga0207662_10013090 3300025918 Bacteria 4634
383 Ga0207657_10002375 3300025919 Bacteria 20365
384 Ga0207657_10168175 3300025919 Bacteria 1777
385 Ga0207652_10016109 3300025921 Bacteria 6097
386 Ga0207652_10019567 3300025921 Bacteria 5569
387 Ga0207652_10185568 3300025921 Bacteria 1870
388 Ga0207652_10285851 3300025921 Bacteria 1488
389 Ga0207646_10000037 3300025922 Bacteria 196362
390 Ga0207646_10015090 3300025922 Bacteria 7310
391 Ga0207646_10026227 3300025922 Bacteria 5320
392 Ga0207646_10116923 3300025922 Bacteria 2395
393 Ga0207646_10126089 3300025922 Bacteria 2302
394 Ga0207694_10000580 3300025924 Bacteria 33080
395 Ga0207694_10021413 3300025924 Bacteria 4899
396 Ga0207694_10032572 3300025924 Bacteria 3990
397 Ga0207694_10096202 3300025924 Bacteria 2342
398 Ga0207694_10097298 3300025924 Bacteria 2329
399 Ga0207694_10117124 3300025924 Bacteria 2124
400 Ga0207650_10020427 3300025925 Bacteria 4671
401 Ga0207659_10000323 3300025926 Bacteria 28799
402 Ga0207687_10006068 3300025927 Bacteria 7996
403 Ga0207687_10030888 3300025927 Bacteria 3616
404 Ga0207687_10036583 3300025927 Bacteria 3344
405 Ga0207687_10096892 3300025927 Bacteria 2163
406 Ga0207700_10000306 3300025928 Bacteria 28993
407 Ga0207700_10032295 3300025928 Bacteria 3732
408 Ga0207700_10098503 3300025928 Bacteria 2326
409 Ga0207664_10000087 3300025929 Bacteria 88607
410 Ga0207664_10012309 3300025929 Bacteria 6111
411 Ga0207664_10041011 3300025929 Bacteria 3604
412 Ga0207664_10127559 3300025929 Bacteria 2138
413 Ga0207644_10000680 3300025931 Bacteria 21467
414 Ga0207644_10022432 3300025931 Bacteria 4314
415 Ga0207644_10029090 3300025931 Bacteria 3830
416 Ga0207690_10054616 3300025932 Bacteria 2686
417 Ga0207706_10011869 3300025933 Bacteria 7931
418 Ga0207706_10060961 3300025933 Bacteria 3322
419 Ga0207670_10028880 3300025936 Bacteria 3527
420 Ga0207665_10007676 3300025939 Bacteria 7121
421 Ga0207665_10017617 3300025939 Bacteria 4694
422 Ga0207665_10038334 3300025939 Bacteria 3191
423 Ga0207665_10137176 3300025939 Bacteria 1742
424 Ga0207691_10002288 3300025940 Bacteria 18746
425 Ga0207691_10002504 3300025940 Bacteria 17973
426 Ga0207691_10005514 3300025940 Bacteria 12227
427 Ga0207711_10000086 3300025941 Bacteria 99422
428 Ga0207711_10000700 3300025941 Bacteria 33079
429 Ga0207711_10001388 3300025941 Bacteria 22791
430 Ga0207711_10010324 3300025941 Bacteria 7758
431 Ga0207711_10031160 3300025941 Bacteria 4500
432 Ga0207711_10046036 3300025941 Bacteria 3727
433 Ga0207711_10066709 3300025941 Bacteria 3112
434 Ga0207711_10122552 3300025941 Bacteria 2322
435 Ga0207689_10021270 3300025942 Bacteria 5454
436 Ga0207661_10000003 3300025944 Bacteria 611941
437 Ga0207661_10033901 3300025944 Bacteria 3966
438 Ga0207661_10146655 3300025944 Bacteria 2037
439 Ga0207679_10015286 3300025945 Bacteria 5067
440 Ga0207679_10049078 3300025945 Bacteria 3077
441 Ga0207679_10079496 3300025945 Bacteria 2501
442 Ga0207679_10136949 3300025945 Bacteria 1973
443 Ga0207667_10002416 3300025949 Bacteria 23398
444 Ga0207667_10004201 3300025949 Bacteria 17682
445 Ga0207667_10019621 3300025949 Bacteria 7540
446 Ga0207667_10042670 3300025949 Bacteria 4820
447 Ga0207667_10109697 3300025949 Bacteria 2846
448 Ga0207667_10117717 3300025949 Bacteria 2738
449 Ga0207667_10162015 3300025949 Bacteria 2300
450 Ga0207651_10018593 3300025960 Bacteria 4141
451 Ga0207640_10009549 3300025981 Bacteria 5435
452 Ga0207640_10068528 3300025981 Bacteria 2378
453 Ga0207658_10013308 3300025986 Bacteria 5618
454 Ga0207658_10027029 3300025986 Bacteria 4029
455 Ga0207677_10008947 3300026023 Bacteria 5617
456 Ga0207677_10084994 3300026023 Bacteria 2282
457 Ga0207703_10001176 3300026035 Bacteria 24683
458 Ga0207703_10042274 3300026035 Bacteria 3655
459 Ga0207703_10152881 3300026035 Bacteria 2014
460 Ga0207639_10002985 3300026041 Bacteria 11391
461 Ga0207639_10012613 3300026041 Bacteria 5890
462 Ga0207702_10016913 3300026078 Bacteria 6036
463 Ga0207702_10033923 3300026078 Bacteria 4265
464 Ga0207702_10045554 3300026078 Bacteria 3689
465 Ga0207702_10060335 3300026078 Bacteria 3233
466 Ga0207702_10076439 3300026078 Bacteria 2895
467 Ga0207702_10113976 3300026078 Bacteria 2409
468 Ga0207641_10008247 3300026088 Bacteria 8611
469 Ga0207641_10024896 3300026088 Bacteria 4934
470 Ga0207641_10039613 3300026088 Bacteria 3942
471 Ga0207641_10131929 3300026088 Bacteria 2244
472 Ga0207641_10223320 3300026088 Bacteria 1748
473 Ga0207641_10243380 3300026088 Bacteria 1677
474 Ga0207648_10051935 3300026089 Bacteria 3584
475 Ga0207676_10001580 3300026095 Bacteria 16746
476 Ga0207676_10007865 3300026095 Bacteria 7582
477 Ga0207676_10023619 3300026095 Bacteria 4539
478 Ga0207676_10120621 3300026095 Bacteria 2211
479 Ga0207674_10045779 3300026116 Bacteria 4497
480 Ga0207683_10031448 3300026121 Bacteria 4607
481 Ga0207683_10199904 3300026121 Bacteria 1816
482 Ga0207698_10000039 3300026142 Bacteria 101073
483 Ga0207698_10146550 3300026142 Bacteria 2043
484 Ga0209179_1000419 3300027512 Bacteria 4230
485 Ga0209588_1008548 3300027671 Bacteria 3039
486 Ga0207428_10000328 3300027907 Bacteria 61709
487 Ga0207428_10014125 3300027907 Bacteria 6952
488 Ga0207428_10017744 3300027907 Bacteria 6103
489 Ga0207428_10049822 3300027907 Bacteria 3354
490 Ga0207428_10126900 3300027907 Bacteria 1953
491 Ga0265354_1001157 3300028016 Bacteria 4025
492 Ga0265356_1000458 3300028017 Bacteria 7408
493 Ga0268266_10007530 3300028379 Bacteria 9809
494 Ga0268266_10018388 3300028379 Bacteria 5956
495 Ga0268266_10019116 3300028379 Bacteria 5834
496 Ga0268266_10032090 3300028379 Bacteria 4461
497 Ga0268265_10036808 3300028380 Bacteria 3587
498 Ga0268264_10002388 3300028381 Bacteria 16546
499 Ga0268264_10003579 3300028381 Bacteria 13380
500 Ga0268264_10009249 3300028381 Bacteria 8158
501 Ga0268264_10047817 3300028381 Bacteria 3557
502 Ga0268264_10183319 3300028381 Bacteria 1903
503 Ga0265319_1000426 3300028563 Bacteria 30400
504 Ga0265318_10000466 3300028577 Bacteria 30068
505 Ga0265318_10002124 3300028577 Bacteria 10787
506 Ga0265323_10001872 3300028653 Bacteria 9946
507 Ga0265336_10002446 3300028666 Bacteria 7654
508 Ga0265336_10003601 3300028666 Bacteria 6050
509 Ga0265338_10007828 3300028800 Bacteria 13133
510 Ga0265338_10045724 3300028800 Bacteria 4021
511 Ga0265338_10132983 3300028800 Bacteria 1961
512 Ga0265762_1003998 3300030760 Bacteria 2643
513 Ga0265760_10000014 3300031090 Bacteria 93274
514 Ga0265330_10000107 3300031235 Bacteria 69658
515 Ga0265330_10006445 3300031235 Bacteria 5801
516 Ga0265332_10006044 3300031238 Bacteria 5530
517 Ga0265332_10022224 3300031238 Bacteria 2800
518 Ga0265328_10000456 3300031239 Bacteria 19024
519 Ga0265328_10003578 3300031239 Bacteria 6851
520 Ga0265320_10000126 3300031240 Bacteria 66933
521 Ga0265320_10006467 3300031240 Bacteria 7386
522 Ga0265320_10040964 3300031240 Bacteria 2306
523 Ga0265325_10000066 3300031241 Bacteria 73035
524 Ga0265325_10000701 3300031241 Bacteria 24270
525 Ga0265325_10001419 3300031241 Bacteria 16872
526 Ga0265325_10005096 3300031241 Bacteria 8175
527 Ga0265325_10010234 3300031241 Bacteria 5442
528 Ga0265325_10010895 3300031241 Bacteria 5238
529 Ga0265329_10000274 3300031242 Bacteria 27297
530 Ga0265340_10001016 3300031247 Bacteria 15986
531 Ga0265340_10001113 3300031247 Bacteria 15346
532 Ga0265340_10006158 3300031247 Bacteria 6616
533 Ga0265340_10007209 3300031247 Bacteria 6053
534 Ga0265340_10039049 3300031247 Bacteria 2346
535 Ga0265339_10000029 3300031249 Bacteria 139089
536 Ga0265339_10000555 3300031249 Bacteria 29182
537 Ga0265339_10000921 3300031249 Bacteria 22618
538 Ga0265339_10001016 3300031249 Bacteria 21354
539 Ga0265339_10003294 3300031249 Bacteria 11307
540 Ga0265339_10036200 3300031249 Bacteria 2764
541 Ga0265331_10000025 3300031250 Bacteria 229346
542 Ga0265331_10009321 3300031250 Bacteria 5518
543 Ga0265331_10019068 3300031250 Bacteria 3546
544 Ga0265316_10000447 3300031344 Bacteria 46965
545 Ga0265316_10000784 3300031344 Bacteria 35048
546 Ga0265316_10003190 3300031344 Bacteria 16676
547 Ga0265316_10008523 3300031344 Bacteria 9504
548 Ga0265316_10010718 3300031344 Bacteria 8328
549 Ga0265316_10012698 3300031344 Bacteria 7537
550 Ga0265316_10052881 3300031344 Bacteria 3184
551 Ga0265316_10101414 3300031344 Bacteria 2187
552 Ga0265313_10001112 3300031595 Bacteria 25726
553 Ga0265313_10001195 3300031595 Bacteria 24872
554 Ga0265313_10001537 3300031595 Bacteria 21459
555 Ga0265313_10012844 3300031595 Bacteria 5082
556 Ga0265313_10023461 3300031595 Bacteria 3322
557 Ga0265314_10000195 3300031711 Bacteria 90391
558 Ga0265314_10001212 3300031711 Bacteria 29629
559 Ga0265314_10001907 3300031711 Bacteria 22286
560 Ga0265314_10029621 3300031711 Bacteria 4064
561 Ga0265314_10081880 3300031711 Bacteria 2125
562 Ga0265342_10000078 3300031712 Bacteria 105279
563 Ga0265342_10000307 3300031712 Bacteria 55504
564 Ga0265342_10000362 3300031712 Bacteria 50260
565 Ga0265342_10001748 3300031712 Bacteria 19819
566 Ga0265342_10008829 3300031712 Bacteria 7186
567 Ga0265342_10032177 3300031712 Bacteria 3236
568 Ga0265342_10040530 3300031712 Bacteria 2824
569 Ga0265342_10081202 3300031712 Bacteria 1873
570 Ga0265342_10089954 3300031712 Bacteria 1761
571 Ga0307510_10027922 3300033180 Bacteria 6455
572 Ga0373926_0018032 3300035083 Bacteria 2426
573 Ga0373936_0005113 3300035113 Bacteria 4938
574 Ga0373956_0027979 3300035119 Bacteria 2451
575 Ga0373943_0000594 3300035170 Bacteria 15714
576 Ga0373935_0002647 3300035692 Bacteria 10291
577 Ga0373927_0000747 3300035695 Bacteria 24845
578 Ga0373927_0000934 3300035695 Bacteria 22198
579 Ga0373927_0013916 3300035695 Bacteria 5337
580 Ga0373927_0020079 3300035695 Bacteria 4382
581 Ga0373927_0095626 3300035695 Bacteria 1931
582 Ga0373933_0000129 3300035724 Bacteria 47946
583 Ga0373933_0029156 3300035724 Bacteria 3189
584 Ga0373933_0039134 3300035724 Bacteria 2789
585 Ga0373947_0000971 3300035725 Bacteria 17501
586 Ga0373947_0007329 3300035725 Bacteria 6387
587 Ga0373947_0020980 3300035725 Bacteria 3779
588 Ga0373947_0037861 3300035725 Bacteria 2863
589 Ga0373937_0000015 3300036401 Bacteria 148228
590 Ga0373937_0010379 3300036401 Bacteria 8133
591 Ga0373937_0063269 3300036401 Bacteria 3403
592 Ga0373937_0083455 3300036401 Bacteria 2956
593 Ga0373937_0110752 3300036401 Bacteria 2553
594 Ga0373937_0166954 3300036401 Bacteria 2064
595 Ga0373925_0015527 3300037068 Bacteria 5509
596 Ga0373925_0019549 3300037068 Bacteria 4927
597 Ga0373925_0028771 3300037068 Bacteria 4073
598 Ga0373925_0118237 3300037068 Bacteria 2055
599 Ga0395905_0057134 3300037471 Bacteria 3650
600 Ga0436364_0177309 3300037853 Bacteria 4598
601 Ga0436364_0288437 3300037853 Bacteria 7086
602 Ga0436364_0748068 3300037853 Bacteria 528910
603 Ga0436364_0880534 3300037853 Bacteria 127762
604 Ga0436364_0895125 3300037853 Bacteria 1982
605 Ga0436364_1448794 3300037853 Bacteria 5505
606 Ga0436364_1499157 3300037853 Bacteria 5197
607 Ga0436364_1535143 3300037853 Bacteria 15848
608 Ga0436365_0343849 3300039437 Bacteria 5409
609 Ga0436365_0612444 3300039437 Bacteria 5369
610 Ga0436365_1466946 3300039437 Bacteria 2639
611 Ga0436360_1307109 3300039438 Bacteria 36883
612 Ga0436360_1314441 3300039438 Bacteria 19937
613 Ga0436361_0350897 3300039447 Bacteria 18933
614 Ga0436361_0379682 3300039447 Bacteria 5824
615 Ga0436361_0464047 3300039447 Bacteria 78853
616 Ga0436363_0100069 3300039450 Bacteria 1900
617 Ga0451577_0044266 3300042876 Bacteria 3985
618 Ga0453683_0042654 3300044673 Bacteria 2848
619 Ga0466963_0117463 3300044694 Bacteria 1828
620 Ga0453684_0000397 3300044712 Bacteria 179262
621 Ga0451576_0013704 3300045051 Bacteria 9056
622 Ga0451576_0100191 3300045051 Bacteria 3013
623 Ga0466967_0135452 3300045976 Bacteria 2290
624 Ga0495592_0004333 3300046454 Bacteria 10382
625 Ga0495592_0007581 3300046454 Bacteria 8126
626 Ga0495592_0079214 3300046454 Bacteria 2378
627 Ga0495603_0047299 3300046455 Bacteria 2562
628 Ga0495629_0011385 3300046459 Bacteria 6461
629 Ga0495629_0044354 3300046459 Bacteria 3121
630 Ga0495629_0063849 3300046459 Bacteria 2571
631 Ga0495629_0082179 3300046459 Bacteria 2248
632 Ga0495651_0000269 3300046462 Bacteria 40351
633 Ga0495651_0006179 3300046462 Bacteria 9147
634 Ga0495651_0006705 3300046462 Bacteria 8801
635 Ga0495651_0029939 3300046462 Bacteria 4245
636 Ga0495651_0080881 3300046462 Bacteria 2453
637 Ga0495653_0007181 3300046463 Bacteria 9131
638 Ga0495653_0010352 3300046463 Bacteria 7627
639 Ga0495650_0000010 3300046471 Bacteria 645599
640 Ga0495580_0001289 3300046472 Bacteria 22103
641 Ga0495580_0004497 3300046472 Bacteria 11712
642 Ga0495580_0004544 3300046472 Bacteria 11653
643 Ga0495580_0005237 3300046472 Bacteria 10776
644 Ga0495580_0009412 3300046472 Bacteria 7686
645 Ga0495580_0017276 3300046472 Bacteria 5400
646 Ga0495580_0025378 3300046472 Bacteria 4332
647 Ga0495580_0026686 3300046472 Bacteria 4208
648 Ga0495580_0046103 3300046472 Bacteria 3095
649 Ga0495580_0048974 3300046472 Bacteria 2990
650 Ga0495582_0000706 3300046473 Bacteria 18439
651 Ga0495582_0002662 3300046473 Bacteria 9966
652 Ga0495582_0008306 3300046473 Bacteria 5731
653 Ga0495582_0017131 3300046473 Bacteria 3966
654 Ga0495639_0011597 3300046475 Bacteria 3803
655 Ga0495662_0007670 3300046476 Bacteria 5318
656 Ga0495662_0053847 3300046476 Bacteria 1943
657 Ga0495664_0007875 3300046477 Bacteria 5931
658 Ga0495664_0016909 3300046477 Bacteria 4164
659 Ga0495594_0032020 3300046499 Bacteria 2852
660 Ga0495606_0038902 3300046507 Bacteria 3213
661 Ga0495608_0038397 3300046511 Bacteria 3216
662 Ga0495628_0001626 3300046516 Bacteria 20577
663 Ga0495628_0021843 3300046516 Bacteria 5260
664 Ga0495628_0048485 3300046516 Bacteria 3367
665 Ga0495630_0065793 3300046517 Bacteria 2724
666 Ga0495644_0000350 3300046523 Bacteria 20849
667 Ga0495652_0002034 3300046529 Bacteria 21479
668 Ga0495652_0071196 3300046529 Bacteria 2904
669 Ga0495652_0079728 3300046529 Bacteria 2706
670 Ga0495665_0000288 3300046531 Bacteria 25561
671 Ga0495665_0048691 3300046531 Bacteria 2247
672 Ga0495640_0033523 3300046533 Bacteria 3647
673 Ga0495586_0046721 3300046535 Bacteria 2335
674 Ga0495587_0000081 3300046536 Bacteria 74942
675 Ga0495587_0010143 3300046536 Bacteria 6009
676 Ga0495587_0065985 3300046536 Bacteria 2112
677 Ga0495587_0093025 3300046536 Bacteria 1741
678 Ga0495645_0005411 3300046543 Bacteria 8757
679 Ga0495645_0047065 3300046543 Bacteria 3143
680 Ga0495645_0063109 3300046543 Bacteria 2683
681 Ga0495667_0000465 3300046559 Bacteria 25809
682 Ga0495667_0000598 3300046559 Bacteria 22976
683 Ga0495667_0004027 3300046559 Bacteria 9878
684 Ga0495667_0004030 3300046559 Bacteria 9875
685 Ga0495667_0032624 3300046559 Bacteria 3489
686 Ga0495668_0022228 3300046616 Bacteria 3627
687 Ga0495634_0004373 3300046642 Bacteria 11123
688 Ga0495634_0027186 3300046642 Bacteria 3981
689 Ga0495634_0065842 3300046642 Bacteria 2400
690 Ga0495625_0035758 3300046660 Bacteria 3658
691 Ga0495635_0026072 3300046663 Bacteria 4070
692 Ga0495635_0068704 3300046663 Bacteria 2430
693 Ga0495659_0002458 3300046664 Bacteria 5983
694 Ga0495657_0001605 3300046675 Bacteria 19438
695 Ga0495657_0019966 3300046675 Bacteria 4826
696 Ga0495657_0026775 3300046675 Bacteria 4080
697 Ga0495599_0005464 3300046678 Bacteria 7600
698 Ga0495599_0013062 3300046678 Bacteria 5127
699 Ga0495599_0050103 3300046678 Bacteria 2617
700 Ga0495599_0053415 3300046678 Bacteria 2531
701 Ga0495623_0012532 3300046679 Bacteria 5485
702 Ga0495623_0018844 3300046679 Bacteria 4456
703 Ga0495623_0023174 3300046679 Bacteria 4007
704 Ga0495646_0048952 3300046680 Bacteria 2566
705 Ga0495658_0011190 3300046683 Bacteria 4505
706 Ga0495669_0017547 3300046684 Bacteria 3072
707 Ga0495613_0005267 3300046689 Bacteria 9714
708 Ga0495613_0014721 3300046689 Bacteria 5805
709 Ga0495624_0008050 3300046690 Bacteria 7383
710 Ga0495624_0058452 3300046690 Bacteria 2421
711 Ga0495600_0002044 3300046809 Bacteria 11367
712 Ga0495600_0003665 3300046809 Bacteria 9069
713 Ga0495600_0076059 3300046809 Bacteria 2192
714 Ga0495581_0005319 3300047315 Bacteria 7447
715 Ga0495581_0016892 3300047315 Bacteria 4241
716 Ga0495581_0086809 3300047315 Bacteria 1814
717 Ga0495604_0000736 3300047317 Bacteria 27505
718 Ga0495604_0022691 3300047317 Bacteria 5011
719 Ga0495604_0072850 3300047317 Bacteria 2595
720 Ga0495636_0016157 3300047318 Bacteria 2979
721 Ga0495674_0006123 3300047319 Bacteria 11552
722 Ga0495674_0047949 3300047319 Bacteria 3784
723 Ga0495674_0117468 3300047319 Bacteria 2250
724 Ga0495674_0168743 3300047319 Bacteria 1827
725 Ga0495672_0082865 3300047320 Bacteria 1783
726 Ga0495676_0021782 3300047321 Bacteria 5589
727 Ga0495676_0044034 3300047321 Bacteria 3647
728 Ga0495680_0000041 3300047322 Bacteria 99386
729 Ga0495680_0082475 3300047322 Bacteria 2426
730 Ga0495675_0000349 3300047444 Bacteria 32511
731 Ga0495675_0001165 3300047444 Bacteria 15958
732 Ga0495675_0001405 3300047444 Bacteria 14584
733 Ga0495675_0049625 3300047444 Bacteria 2667
734 Ga0495684_0000521 3300047471 Bacteria 31227
735 Ga0495684_0001787 3300047471 Bacteria 17259
736 Ga0495684_0035646 3300047471 Bacteria 3814
737 Ga0495684_0040591 3300047471 Bacteria 3567
738 Ga0495686_0000027 3300047472 Bacteria 382657
739 Ga0495686_0008767 3300047472 Bacteria 7371
740 Ga0495602_0000101 3300048088 Bacteria 81181
741 Ga0495602_0019378 3300048088 Bacteria 6756
742 Ga0495602_0038136 3300048088 Bacteria 4449
743 Ga0495602_0087148 3300048088 Bacteria 2604
744 Ga0495602_0179256 3300048088 Bacteria 1636
745 Ga0495614_0001042 3300048089 Bacteria 11847
746 Ga0496104_0000127 3300048907 Bacteria 70210
747 Ga0496104_0126993 3300048907 Bacteria 2449
748 Ga0496104_0130612 3300048907 Bacteria 2413
749 Ga0496104_0273838 3300048907 Bacteria 1601
750 Ga0496105_0125334 3300048908 Bacteria 2117
751 Ga0496106_0066069 3300048909 Bacteria 2754
752 Ga0496106_0136959 3300048909 Bacteria 1924
753 Ga0496112_0057421 3300048915 Bacteria 3832
754 Ga0496112_0089113 3300048915 Bacteria 3053
755 Ga0496115_0012549 3300048918 Bacteria 6383
756 Ga0496115_0148198 3300048918 Bacteria 1937
757 Ga0496115_0149101 3300048918 Bacteria 1931
758 Ga0496126_0002651 3300048929 Bacteria 23706
759 Ga0496126_0037039 3300048929 Bacteria 4556
760 Ga0501031_0004063 3300049568 Bacteria 9437
761 Ga0501032_0001455 3300049569 Bacteria 18825
762 Ga0501036_0000255 3300049572 Bacteria 36165
763 Ga0501038_0013708 3300049574 Bacteria 7389
764 Ga0501039_0022459 3300049575 Bacteria 4843
765 Ga0501043_0071340 3300049579 Bacteria 2728
766 Ga0501046_0013244 3300049580 Bacteria 6988
767 Ga0501047_0011142 3300049581 Bacteria 8509
768 Ga0501047_0014185 3300049581 Bacteria 7574
769 Ga0501048_0009515 3300049582 Bacteria 7294
770 Ga0501067_0002621 3300049583 Bacteria 9957
771 Ga0501068_0004334 3300049584 Bacteria 7714
772 Ga0501069_0000224 3300049585 Bacteria 25263
773 Ga0501070_0023337 3300049586 Bacteria 5182
774 Ga0501072_0053330 3300049588 Bacteria 3184
775 Ga0501073_0127128 3300049589 Bacteria 1766
776 Ga0501074_0023820 3300049590 Bacteria 4450
777 Ga0501076_0033461 3300049592 Bacteria 4013
778 Ga0501077_0019257 3300049593 Bacteria 4316
779 Ga0501079_0005002 3300049741 Bacteria 9829
780 Ga0501080_0000961 3300049742 Bacteria 23597
781 Ga0501035_0151531 3300049822 Bacteria 2012
782 Ga0501044_0000216 3300049823 Bacteria 73383
783 Ga0501044_0035476 3300049823 Bacteria 5222
784 nmdc:mga0k408_2781_c1 3300050493 Bacteria 9306
785 nmdc:mga06z11_2467_c1 3300050494 Bacteria 7069
786 nmdc:mga05p37_1967_c1 3300050507 Bacteria 23970
787 nmdc:mga05p37_333532_c1 3300050507 Bacteria 1791
788 nmdc:mga09592_38331_c1 3300050508 Bacteria 4023
789 nmdc:mga09592_61815_c1 3300050508 Bacteria 3168
790 nmdc:mga09592_97438_c1 3300050508 Bacteria 2517
791 nmdc:mga0qj67_24639_c1 3300050509 Bacteria 4139
792 nmdc:mga06r32_167709_c1 3300050510 Bacteria 2179
793 nmdc:mga08y16_128789_c1 3300050511 Bacteria 2633
794 nmdc:mga08y16_133358_c1 3300050511 Bacteria 2582
795 nmdc:mga08y16_1357_c1 3300050511 Bacteria 24450
796 nmdc:mga08y16_138199_c1 3300050511 Bacteria 2533
797 nmdc:mga08y16_20326_c1 3300050511 Bacteria 7009
798 nmdc:mga08y16_30012_c1 3300050511 Bacteria 5725
799 nmdc:mga08y16_38313_c1 3300050511 Bacteria 5035
800 nmdc:mga08y16_9411_c1 3300050511 Bacteria 10247
801 nmdc:mga0n895_125489_c1 3300050512 Bacteria 2590
802 nmdc:mga0n895_17754_c1 3300050512 Bacteria 6566
803 nmdc:mga0n895_30674_c1 3300050512 Bacteria 5140
804 nmdc:mga0rr50_30299_c1 3300050513 Bacteria 3829
805 nmdc:mga08x19_2984_c1 3300050514 Bacteria 10168
806 nmdc:mga0a205_172227_c1 3300050515 Bacteria 2060
807 nmdc:mga0a205_18616_c1 3300050515 Bacteria 6533
808 nmdc:mga0a205_18636_c1 3300050515 Bacteria 6530
809 nmdc:mga0a205_28589_c1 3300050515 Bacteria 5331
810 nmdc:mga0a205_83518_c1 3300050515 Bacteria 3085
811 nmdc:mga0a205_91204_c1 3300050515 Bacteria 2944
812 Ga0495601_0006486 3300053077 Bacteria 6844
813 Ga0500651_0000002 3300053093 Bacteria 476609
814 Ga0500595_000014 3300053119 Bacteria 247996
815 Ga0501084_0000854 3300054114 Bacteria 23555
816 Ga0501082_0018177 3300060353 Bacteria 6053
817 Ga0501082_0096290 3300060353 Bacteria 2559
818 Ga0530510_0006805 3300061734 Bacteria 7965
819 Ga0068868_100019780
820 Ga0065715_10093704
821 Ga0070658_10057258
822 Ga0070676_10009362
823 Ga0070676_10051548
824 Ga0070683_100000002
825 Ga0070683_100007932
826 Ga0070683_100078429
827 Ga0070683_100099042
828 Ga0070670_100001949
829 Ga0070666_10017503
830 Ga0070666_10041327
831 Ga0070666_10103624
832 Ga0070680_100026699
833 Ga0070680_100032224
834 Ga0070682_100064443
835 Ga0068868_100001660
836 Ga0068868_100015752
837 Ga0068868_100021745
838 Ga0068868_100066500
839 Ga0068868_100067628
840 Ga0070660_100007894
841 Ga0070660_100115767
842 Ga0070687_100054056
843 Ga0070661_100008885
844 Ga0070661_100019563
845 Ga0070661_100025646
846 Ga0070661_100054741
847 Ga0070668_100011535
848 Ga0070675_100003550
849 Ga0070675_100020001
850 Ga0070675_100020069
851 Ga0070675_100055347
852 Ga0070675_100114608
853 Ga0070671_100000378
854 Ga0070671_100015148
855 Ga0070671_100042917
856 Ga0070674_100012266
857 Ga0070673_100007515
858 Ga0070673_100098684
859 Ga0070688_100038813
860 Ga0070659_100016010
861 Ga0070667_100004263
862 Ga0070667_100015915
863 Ga0070667_100019425
864 Ga0070703_10009229
865 Ga0070709_10000423
866 Ga0070714_100000096
867 Ga0070714_100001908
868 Ga0070714_100102955
869 Ga0070713_100000364
870 Ga0070713_100008685
871 Ga0070713_100011727
872 Ga0070713_100103287
873 Ga0070701_10007710
874 Ga0070711_100103524
875 Ga0070705_100047339
876 Ga0070705_100049561
877 Ga0070694_100012714
878 Ga0070708_100000805
879 Ga0070708_100003971
880 Ga0070708_100007485
881 Ga0070708_100012412
882 Ga0070663_100010931
883 Ga0070663_100062398
884 Ga0070662_100006651
885 Ga0070662_100053402
886 Ga0070662_100056115
887 Ga0070681_10006468
888 Ga0070681_10073881
889 Ga0070681_10092236
890 Ga0070681_10157601
891 Ga0068867_100007704
892 Ga0068867_100022763
893 Ga0070685_10019908
894 Ga0070706_100000278
895 Ga0070706_100021666
896 Ga0070706_100245321
897 Ga0070707_100000221
898 Ga0070698_100023905
899 Ga0070699_100015903
900 Ga0070699_100018350
901 Ga0070679_100003386
902 Ga0070679_100009883
903 Ga0070679_100047135
904 Ga0070679_100068323
905 Ga0070684_100000007
906 Ga0070684_100039558
907 Ga0070684_100044069
908 Ga0070684_100099199
909 Ga0070697_100000993
910 Ga0070697_100001847
911 Ga0070697_100033249
912 Ga0068853_100014788
913 Ga0068853_100022773
914 Ga0070672_100101299
915 Ga0070686_100032737
916 Ga0070695_100010421
917 Ga0070696_100002464
918 Ga0070696_100006664
919 Ga0070693_100000037
920 Ga0070665_100028376
921 Ga0068855_100000642
922 Ga0068855_100002278
923 Ga0068855_100013554
924 Ga0068855_100022851
925 Ga0068855_100085072
926 Ga0068855_100158826
927 Ga0068855_100235951
928 Ga0070664_100001989
929 Ga0070664_100104305
930 Ga0070664_100204667
931 Ga0068857_100001478
932 Ga0068857_100009230
933 Ga0068857_100040887
934 Ga0068857_100134234
935 Ga0068854_100029876
936 Ga0068856_100003152
937 Ga0068856_100014834
938 Ga0068856_100014853
939 Ga0068856_100016878
940 Ga0068856_100042132
941 Ga0068856_100043286
942 Ga0068852_100000415
943 Ga0068852_100073456
944 Ga0068852_100081737
945 Ga0068852_100206405
946 Ga0068859_100006813
947 Ga0068859_100010766
948 Ga0068859_100033639
949 Ga0068859_100077042
950 Ga0068859_100100435
951 Ga0068859_100120349
952 Ga0068864_100001669
953 Ga0068864_100003645
954 Ga0068864_100004251
955 Ga0068864_100135900
956 Ga0068866_10021754
957 Ga0068866_10038702
958 Ga0068851_10006846
959 Ga0068851_10008567
960 Ga0068851_10015529
961 Ga0068863_100004389
962 Ga0068863_100030408
963 Ga0068863_100064567
964 Ga0068863_100067932
965 Ga0068863_100138445
966 Ga0068858_100003482
967 Ga0068858_100004396
968 Ga0068858_100007847
969 Ga0068858_100014966
970 Ga0068858_100026791
971 Ga0068858_100031600
972 Ga0068858_100083674
973 Ga0068860_100002369
974 Ga0068860_100011406
975 Ga0068860_100023431
976 Ga0068860_100049370
977 Ga0068860_100072062
978 Ga0081455_10000246
979 Ga0081455_10013820
980 Ga0081455_10047850
981 Ga0081538_10000663
982 Ga0081538_10001749
983 Ga0081538_10006844
984 Ga0081540_1005801
985 Ga0081540_1016962
986 Ga0070717_10002621
987 Ga0070717_10045959
988 Ga0070717_10193400
989 Ga0075365_10021836
990 Ga0075364_10005747
991 Ga0070712_100002672
992 Ga0070712_100010032
993 Ga0070712_100137108
994 Ga0075367_10009184
995 Ga0075366_10001249
996 Ga0097621_100004652
997 Ga0097621_100015449
998 Ga0097621_100020172
999 Ga0097621_100024268
1000 Ga0097621_100031066
1001 Ga0097621_100036253
1002 Ga0097621_100052500
1003 Ga0097621_100111216
1004 Ga0068871_100014111
1005 Ga0068871_100026889
1006 Ga0068871_100030778
1007 Ga0068871_100039111
1008 Ga0068871_100058314
1009 Ga0068871_100078857
1010 Ga0075428_100003081
1011 Ga0075428_100132027
1012 Ga0075428_100357777
1013 Ga0075431_100005846
1014 Ga0075431_100109414
1015 Ga0075433_10015741
1016 Ga0075433_10082186
1017 Ga0075433_10089230
1018 Ga0075433_10209197
1019 Ga0075434_100003909
1020 Ga0075434_100005331
1021 Ga0075434_100008203
1022 Ga0075434_100033223
1023 Ga0075429_100024549
1024 Ga0068865_100007218
1025 Ga0068865_100011388
1026 Ga0068865_100019789
1027 Ga0068865_100020714
1028 Ga0097620_100006814
1029 Ga0097620_100010766
1030 Ga0097620_100033641
1031 Ga0097620_100077030
1032 Ga0097620_100100428
1033 Ga0097620_100120348
1034 Ga0075435_100009419
1035 Ga0099795_10031829
1036 Ga0105240_10000734
1037 Ga0105240_10001326
1038 Ga0105240_10001395
1039 Ga0105240_10025014
1040 Ga0105240_10030445
1041 Ga0105240_10032052
1042 Ga0105240_10081283
1043 Ga0105240_10098075
1044 Ga0111539_10004140
1045 Ga0111539_10009382
1046 Ga0111539_10012378
1047 Ga0111539_10029920
1048 Ga0111539_10035040
1049 Ga0111539_10219191
1050 Ga0105245_10007394
1051 Ga0105245_10028226
1052 Ga0105245_10029145
1053 Ga0105245_10036728
1054 Ga0105245_10055244
1055 Ga0105245_10073069
1056 Ga0105245_10126779
1057 Ga0114129_10000777
1058 Ga0114129_10008706
1059 Ga0114129_10058156
1060 Ga0114129_10147701
1061 Ga0114129_10225080
1062 Ga0114129_10501756
1063 Ga0105243_10019881
1064 Ga0105241_10032077
1065 Ga0105241_10043258
1066 Ga0105241_10049056
1067 Ga0105242_10056943
1068 Ga0105248_10000094
1069 Ga0105248_10000806
1070 Ga0105248_10001021
1071 Ga0105248_10003639
1072 Ga0105248_10013851
1073 Ga0105248_10020967
1074 Ga0105248_10056649
1075 Ga0105248_10064389
1076 Ga0105248_10138686
1077 Ga0105248_10261284
1078 Ga0105237_10022562
1079 Ga0105237_10031468
1080 Ga0105237_10076730
1081 Ga0105237_10231164
1082 Ga0105238_10000635
1083 Ga0105238_10017459
1084 Ga0105238_10060106
1085 Ga0105238_10064670
1086 Ga0105238_10067857
1087 Ga0105249_10032997
1088 Ga0105249_10055655
1089 Ga0105239_10002713
1090 Ga0105239_10029098
1091 Ga0105239_10030580
1092 Ga0105239_10069943
1093 Ga0105239_10105811
1094 Ga0105246_10016520
1095 Ga0157370_10000137
1096 Ga0157370_10058522
1097 Ga0157370_10179396
1098 Ga0157369_10001369
1099 Ga0157369_10001777
1100 Ga0157369_10023951
1101 Ga0157369_10097222
1102 Ga0157374_10000659
1103 Ga0157374_10007218
1104 Ga0157374_10011444
1105 Ga0157374_10014732
1106 Ga0157374_10015360
1107 Ga0157374_10021536
1108 Ga0157374_10041913
1109 Ga0157374_10112524
1110 Ga0157378_10000217
1111 Ga0157378_10000368
1112 Ga0157378_10009309
1113 Ga0157378_10105385
1114 Ga0157378_10142141
1115 Ga0163162_10003509
1116 Ga0163162_10010248
1117 Ga0163162_10013499
1118 Ga0163162_10044186
1119 Ga0163162_10050679
1120 Ga0163162_10194436
1121 Ga0163162_10253473
1122 Ga0163162_10328964
1123 Ga0157372_10000134
1124 Ga0157372_10000424
1125 Ga0157372_10005022
1126 Ga0157372_10022198
1127 Ga0157372_10109955
1128 Ga0157372_10249923
1129 Ga0157375_10001430
1130 Ga0157375_10051835
1131 Ga0157375_10060584
1132 Ga0157375_10122408
1133 Ga0157375_10129329
1134 Ga0157375_10287886
1135 Ga0163163_10000729
1136 Ga0163163_10007573
1137 Ga0163163_10026318
1138 Ga0163163_10051412
1139 Ga0163163_10075764
1140 Ga0163163_10205888
1141 Ga0157380_10023314
1142 Ga0157377_10039805
1143 Ga0157379_10022635
1144 Ga0157379_10045112
1145 Ga0157376_10021045
1146 Ga0157376_10032863
1147 Ga0157376_10036571
1148 Ga0157376_10066786
1149 Ga0157376_10067881
1150 Ga0157376_10094775
1151 Ga0182007_10005535
1152 Ga0163161_10018153
1153 Ga0213872_10001564
1154 Ga0213872_10034060
1155 Ga0213876_10036843
1156 Ga0213875_10000004
1157 Ga0213875_10000313
1158 Ga0213875_10010292
1159 Ga0213875_10010911
1160 Ga0213871_10003941
1161 Ga0224569_100108
1162 Ga0228598_1001374
1163 Ga0207656_10008171
1164 Ga0207692_10027104
1165 Ga0207642_10034805
1166 Ga0207680_10008418
1167 Ga0207680_10017582
1168 Ga0207680_10041434
1169 Ga0207699_10000209
1170 Ga0207699_10126074
1171 Ga0207643_10032617
1172 Ga0207684_10011624
1173 Ga0207684_10027366
1174 Ga0207684_10029639
1175 Ga0207684_10040107
1176 Ga0207684_10055510
1177 Ga0207654_10056884
1178 Ga0207654_10082870
1179 Ga0207707_10021854
1180 Ga0207707_10037500
1181 Ga0207695_10000379
1182 Ga0207695_10003457
1183 Ga0207695_10017528
1184 Ga0207695_10025208
1185 Ga0207695_10026384
1186 Ga0207695_10027004
1187 Ga0207695_10030031
1188 Ga0207695_10052463
1189 Ga0207695_10134305
1190 Ga0207695_10275964
1191 Ga0207671_10143354
1192 Ga0207671_10190968
1193 Ga0207693_10000026
1194 Ga0207693_10062889
1195 Ga0207693_10085307
1196 Ga0207693_10120672
1197 Ga0207663_10030366
1198 Ga0207663_10050554
1199 Ga0207663_10116911
1200 Ga0207662_10013090
1201 Ga0207657_10002375
1202 Ga0207657_10168175
1203 Ga0207652_10016109
1204 Ga0207652_10019567
1205 Ga0207652_10185568
1206 Ga0207652_10285851
1207 Ga0207646_10000037
1208 Ga0207646_10015090
1209 Ga0207646_10026227
1210 Ga0207646_10116923
1211 Ga0207646_10126089
1212 Ga0207694_10000580
1213 Ga0207694_10021413
1214 Ga0207694_10032572
1215 Ga0207694_10096202
1216 Ga0207694_10097298
1217 Ga0207694_10117124
1218 Ga0207650_10020427
1219 Ga0207659_10000323
1220 Ga0207687_10006068
1221 Ga0207687_10030888
1222 Ga0207687_10036583
1223 Ga0207687_10096892
1224 Ga0207700_10000306
1225 Ga0207700_10032295
1226 Ga0207700_10098503
1227 Ga0207664_10000087
1228 Ga0207664_10012309
1229 Ga0207664_10041011
1230 Ga0207664_10127559
1231 Ga0207644_10000680
1232 Ga0207644_10022432
1233 Ga0207644_10029090
1234 Ga0207690_10054616
1235 Ga0207706_10011869
1236 Ga0207706_10060961
1237 Ga0207670_10028880
1238 Ga0207665_10007676
1239 Ga0207665_10017617
1240 Ga0207665_10038334
1241 Ga0207665_10137176
1242 Ga0207691_10002288
1243 Ga0207691_10002504
1244 Ga0207691_10005514
1245 Ga0207711_10000086
1246 Ga0207711_10000700
1247 Ga0207711_10001388
1248 Ga0207711_10010324
1249 Ga0207711_10031160
1250 Ga0207711_10046036
1251 Ga0207711_10066709
1252 Ga0207711_10122552
1253 Ga0207689_10021270
1254 Ga0207661_10000003
1255 Ga0207661_10033901
1256 Ga0207661_10146655
1257 Ga0207679_10015286
1258 Ga0207679_10049078
1259 Ga0207679_10079496
1260 Ga0207679_10136949
1261 Ga0207667_10002416
1262 Ga0207667_10004201
1263 Ga0207667_10019621
1264 Ga0207667_10042670
1265 Ga0207667_10109697
1266 Ga0207667_10117717
1267 Ga0207667_10162015
1268 Ga0207651_10018593
1269 Ga0207640_10009549
1270 Ga0207640_10068528
1271 Ga0207658_10013308
1272 Ga0207658_10027029
1273 Ga0207677_10008947
1274 Ga0207677_10084994
1275 Ga0207703_10001176
1276 Ga0207703_10042274
1277 Ga0207703_10152881
1278 Ga0207639_10002985
1279 Ga0207639_10012613
1280 Ga0207702_10016913
1281 Ga0207702_10033923
1282 Ga0207702_10045554
1283 Ga0207702_10060335
1284 Ga0207702_10076439
1285 Ga0207702_10113976
1286 Ga0207641_10008247
1287 Ga0207641_10024896
1288 Ga0207641_10039613
1289 Ga0207641_10131929
1290 Ga0207641_10223320
1291 Ga0207641_10243380
1292 Ga0207648_10051935
1293 Ga0207676_10001580
1294 Ga0207676_10007865
1295 Ga0207676_10023619
1296 Ga0207676_10120621
1297 Ga0207674_10045779
1298 Ga0207683_10031448
1299 Ga0207683_10199904
1300 Ga0207698_10000039
1301 Ga0207698_10146550
1302 Ga0209179_1000419
1303 Ga0209588_1008548
1304 Ga0207428_10000328
1305 Ga0207428_10014125
1306 Ga0207428_10017744
1307 Ga0207428_10049822
1308 Ga0207428_10126900
1309 Ga0265354_1001157
1310 Ga0265356_1000458
1311 Ga0268266_10007530
1312 Ga0268266_10018388
1313 Ga0268266_10019116
1314 Ga0268266_10032090
1315 Ga0268265_10036808
1316 Ga0268264_10002388
1317 Ga0268264_10003579
1318 Ga0268264_10009249
1319 Ga0268264_10047817
1320 Ga0268264_10183319
1321 Ga0265319_1000426
1322 Ga0265318_10000466
1323 Ga0265318_10002124
1324 Ga0265323_10001872
1325 Ga0265336_10002446
1326 Ga0265336_10003601
1327 Ga0265338_10007828
1328 Ga0265338_10045724
1329 Ga0265338_10132983
1330 Ga0265762_1003998
1331 Ga0265760_10000014
1332 Ga0265330_10000107
1333 Ga0265330_10006445
1334 Ga0265332_10006044
1335 Ga0265332_10022224
1336 Ga0265328_10000456
1337 Ga0265328_10003578
1338 Ga0265320_10000126
1339 Ga0265320_10006467
1340 Ga0265320_10040964
1341 Ga0265325_10000066
1342 Ga0265325_10000701
1343 Ga0265325_10001419
1344 Ga0265325_10005096
1345 Ga0265325_10010234
1346 Ga0265325_10010895
1347 Ga0265329_10000274
1348 Ga0265340_10001016
1349 Ga0265340_10001113
1350 Ga0265340_10006158
1351 Ga0265340_10007209
1352 Ga0265340_10039049
1353 Ga0265339_10000029
1354 Ga0265339_10000555
1355 Ga0265339_10000921
1356 Ga0265339_10001016
1357 Ga0265339_10003294
1358 Ga0265339_10036200
1359 Ga0265331_10000025
1360 Ga0265331_10009321
1361 Ga0265331_10019068
1362 Ga0265316_10000447
1363 Ga0265316_10000784
1364 Ga0265316_10003190
1365 Ga0265316_10008523
1366 Ga0265316_10010718
1367 Ga0265316_10012698
1368 Ga0265316_10052881
1369 Ga0265316_10101414
1370 Ga0265313_10001112
1371 Ga0265313_10001195
1372 Ga0265313_10001537
1373 Ga0265313_10012844
1374 Ga0265313_10023461
1375 Ga0265314_10000195
1376 Ga0265314_10001212
1377 Ga0265314_10001907
1378 Ga0265314_10029621
1379 Ga0265314_10081880
1380 Ga0265342_10000078
1381 Ga0265342_10000307
1382 Ga0265342_10000362
1383 Ga0265342_10001748
1384 Ga0265342_10008829
1385 Ga0265342_10032177
1386 Ga0265342_10040530
1387 Ga0265342_10081202
1388 Ga0265342_10089954
1389 Ga0307510_10027922
1390 Ga0373926_0018032
1391 Ga0373936_0005113
1392 Ga0373956_0027979
1393 Ga0373943_0000594
1394 Ga0373935_0002647
1395 Ga0373927_0000747
1396 Ga0373927_0000934
1397 Ga0373927_0013916
1398 Ga0373927_0020079
1399 Ga0373927_0095626
1400 Ga0373933_0000129
1401 Ga0373933_0029156
1402 Ga0373933_0039134
1403 Ga0373947_0000971
1404 Ga0373947_0007329
1405 Ga0373947_0020980
1406 Ga0373947_0037861
1407 Ga0373937_0000015
1408 Ga0373937_0010379
1409 Ga0373937_0063269
1410 Ga0373937_0083455
1411 Ga0373937_0110752
1412 Ga0373937_0166954
1413 Ga0373925_0015527
1414 Ga0373925_0019549
1415 Ga0373925_0028771
1416 Ga0373925_0118237
1417 Ga0395905_0057134
1418 Ga0436364_0177309
1419 Ga0436364_0288437
1420 Ga0436364_0748068
1421 Ga0436364_0880534
1422 Ga0436364_0895125
1423 Ga0436364_1448794
1424 Ga0436364_1499157
1425 Ga0436364_1535143
1426 Ga0436365_0343849
1427 Ga0436365_0612444
1428 Ga0436365_1466946
1429 Ga0436360_1307109
1430 Ga0436360_1314441
1431 Ga0436361_0350897
1432 Ga0436361_0379682
1433 Ga0436361_0464047
1434 Ga0436363_0100069
1435 Ga0451577_0044266
1436 Ga0453683_0042654
1437 Ga0466963_0117463
1438 Ga0453684_0000397
1439 Ga0451576_0013704
1440 Ga0451576_0100191
1441 Ga0466967_0135452
1442 Ga0495592_0004333
1443 Ga0495592_0007581
1444 Ga0495592_0079214
1445 Ga0495603_0047299
1446 Ga0495629_0011385
1447 Ga0495629_0044354
1448 Ga0495629_0063849
1449 Ga0495629_0082179
1450 Ga0495651_0000269
1451 Ga0495651_0006179
1452 Ga0495651_0006705
1453 Ga0495651_0029939
1454 Ga0495651_0080881
1455 Ga0495653_0007181
1456 Ga0495653_0010352
1457 Ga0495650_0000010
1458 Ga0495580_0001289
1459 Ga0495580_0004497
1460 Ga0495580_0004544
1461 Ga0495580_0005237
1462 Ga0495580_0009412
1463 Ga0495580_0017276
1464 Ga0495580_0025378
1465 Ga0495580_0026686
1466 Ga0495580_0046103
1467 Ga0495580_0048974
1468 Ga0495582_0000706
1469 Ga0495582_0002662
1470 Ga0495582_0008306
1471 Ga0495582_0017131
1472 Ga0495639_0011597
1473 Ga0495662_0007670
1474 Ga0495662_0053847
1475 Ga0495664_0007875
1476 Ga0495664_0016909
1477 Ga0495594_0032020
1478 Ga0495606_0038902
1479 Ga0495608_0038397
1480 Ga0495628_0001626
1481 Ga0495628_0021843
1482 Ga0495628_0048485
1483 Ga0495630_0065793
1484 Ga0495644_0000350
1485 Ga0495652_0002034
1486 Ga0495652_0071196
1487 Ga0495652_0079728
1488 Ga0495665_0000288
1489 Ga0495665_0048691
1490 Ga0495640_0033523
1491 Ga0495586_0046721
1492 Ga0495587_0000081
1493 Ga0495587_0010143
1494 Ga0495587_0065985
1495 Ga0495587_0093025
1496 Ga0495645_0005411
1497 Ga0495645_0047065
1498 Ga0495645_0063109
1499 Ga0495667_0000465
1500 Ga0495667_0000598
1501 Ga0495667_0004027
1502 Ga0495667_0004030
1503 Ga0495667_0032624
1504 Ga0495668_0022228
1505 Ga0495634_0004373
1506 Ga0495634_0027186
1507 Ga0495634_0065842
1508 Ga0495625_0035758
1509 Ga0495635_0026072
1510 Ga0495635_0068704
1511 Ga0495659_0002458
1512 Ga0495657_0001605
1513 Ga0495657_0019966
1514 Ga0495657_0026775
1515 Ga0495599_0005464
1516 Ga0495599_0013062
1517 Ga0495599_0050103
1518 Ga0495599_0053415
1519 Ga0495623_0012532
1520 Ga0495623_0018844
1521 Ga0495623_0023174
1522 Ga0495646_0048952
1523 Ga0495658_0011190
1524 Ga0495669_0017547
1525 Ga0495613_0005267
1526 Ga0495613_0014721
1527 Ga0495624_0008050
1528 Ga0495624_0058452
1529 Ga0495600_0002044
1530 Ga0495600_0003665
1531 Ga0495600_0076059
1532 Ga0495581_0005319
1533 Ga0495581_0016892
1534 Ga0495581_0086809
1535 Ga0495604_0000736
1536 Ga0495604_0022691
1537 Ga0495604_0072850
1538 Ga0495636_0016157
1539 Ga0495674_0006123
1540 Ga0495674_0047949
1541 Ga0495674_0117468
1542 Ga0495674_0168743
1543 Ga0495672_0082865
1544 Ga0495676_0021782
1545 Ga0495676_0044034
1546 Ga0495680_0000041
1547 Ga0495680_0082475
1548 Ga0495675_0000349
1549 Ga0495675_0001165
1550 Ga0495675_0001405
1551 Ga0495675_0049625
1552 Ga0495684_0000521
1553 Ga0495684_0001787
1554 Ga0495684_0035646
1555 Ga0495684_0040591
1556 Ga0495686_0000027
1557 Ga0495686_0008767
1558 Ga0495602_0000101
1559 Ga0495602_0019378
1560 Ga0495602_0038136
1561 Ga0495602_0087148
1562 Ga0495602_0179256
1563 Ga0495614_0001042
1564 Ga0496104_0000127
1565 Ga0496104_0126993
1566 Ga0496104_0130612
1567 Ga0496104_0273838
1568 Ga0496105_0125334
1569 Ga0496106_0066069
1570 Ga0496106_0136959
1571 Ga0496112_0057421
1572 Ga0496112_0089113
1573 Ga0496115_0012549
1574 Ga0496115_0148198
1575 Ga0496115_0149101
1576 Ga0496126_0002651
1577 Ga0496126_0037039
1578 Ga0501031_0004063
1579 Ga0501032_0001455
1580 Ga0501036_0000255
1581 Ga0501038_0013708
1582 Ga0501039_0022459
1583 Ga0501043_0071340
1584 Ga0501046_0013244
1585 Ga0501047_0011142
1586 Ga0501047_0014185
1587 Ga0501048_0009515
1588 Ga0501067_0002621
1589 Ga0501068_0004334
1590 Ga0501069_0000224
1591 Ga0501070_0023337
1592 Ga0501072_0053330
1593 Ga0501073_0127128
1594 Ga0501074_0023820
1595 Ga0501076_0033461
1596 Ga0501077_0019257
1597 Ga0501079_0005002
1598 Ga0501080_0000961
1599 Ga0501035_0151531
1600 Ga0501044_0000216
1601 Ga0501044_0035476
1602 nmdc:mga0k408_2781_c1
1603 nmdc:mga06z11_2467_c1
1604 nmdc:mga05p37_1967_c1
1605 nmdc:mga05p37_333532_c1
1606 nmdc:mga09592_38331_c1
1607 nmdc:mga09592_61815_c1
1608 nmdc:mga09592_97438_c1
1609 nmdc:mga0qj67_24639_c1
1610 nmdc:mga06r32_167709_c1
1611 nmdc:mga08y16_128789_c1
1612 nmdc:mga08y16_133358_c1
1613 nmdc:mga08y16_1357_c1
1614 nmdc:mga08y16_138199_c1
1615 nmdc:mga08y16_20326_c1
1616 nmdc:mga08y16_30012_c1
1617 nmdc:mga08y16_38313_c1
1618 nmdc:mga08y16_9411_c1
1619 nmdc:mga0n895_125489_c1
1620 nmdc:mga0n895_17754_c1
1621 nmdc:mga0n895_30674_c1
1622 nmdc:mga0rr50_30299_c1
1623 nmdc:mga08x19_2984_c1
1624 nmdc:mga0a205_172227_c1
1625 nmdc:mga0a205_18616_c1
1626 nmdc:mga0a205_18636_c1
1627 nmdc:mga0a205_28589_c1
1628 nmdc:mga0a205_83518_c1
1629 nmdc:mga0a205_91204_c1
1630 Ga0495601_0006486
1631 Ga0500651_0000002
1632 Ga0500595_000014
1633 Ga0501084_0000854
1634 Ga0501082_0018177
1635 Ga0501082_0096290
1636 Ga0530510_0006805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

9

492

0.99

PF00571

CBS

CBS domain

87

143

0.92

PF00571

CBS

CBS domain

149

206

0.91

PF01070

FMN_dh

FMN-dependent dehydrogenase

181

368

0.81

PF01645

Glu_synthase

Conserved region in glutamate synthase

249

364

0.77

PF03060

NMO

Nitronate monooxygenase

221

421

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vrd-assembly2.cif.gz_B crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9671 6 462
1vrd-assembly1.cif.gz_A crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9645 6 462
6kcf-assembly1.cif.gz_D-2 structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 0.9642 8 465
6kcf-assembly1.cif.gz_C-2 structure of inosine 5'-monophosphate dehydrogenase from candidatus liberibacter asiaticus str. psy62 0.9642 8 465
1vrd-assembly2.cif.gz_B crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9641 6 462
ID Description Score Start End Superfamily
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.956 4 462 3.20.20.70
5x8oA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9521 6 464 3.20.20.70
4dqwB02 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9514 95 203 3.10.580.10
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9406 4 462 3.20.20.70
5x8oA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9309 6 464 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A351UUM3-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.9895 201 294 GO:0003938
GO:0006183
AF-A0A2V9FMH8-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.9725 92 234 GO:0003938
GO:0006183
AF-A0A3D3AS44-F1-model_v4 deleted 0.9719 205 370
AF-A0A7S2MLS1-F1-model_v4 IMP dehydrogenase/GMP reductase domain-containing protein 0.9652 195 299 GO:0003938
GO:0005737
GO:0006183
AF-A0A3R9WHI1-F1-model_v4 deleted 0.9636 191 320

Map