F482125

General Info

Members Datasets Scaffolds Average Seq Length
818 449 1636 219

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100157974|Ga0068862_1001579741
Length 247
Sequence MERTAVGRTRHPRLHDRHWISKSAGIAIVNGVHDMGGMDGFGKVEPEPNEPMFHTEWEARVLAMVRAMGAAGAFNIDTSRFYREMLPPHVYLASSYYRKWFLGLEDMLVDKGFIAAEEVAAGHAMQPPKPLKHGKFALVDVERVMVRGKFGRPAPAAPKFKAGDRVRAKNIHPATHTRLPRYVRGHVGVVERDHGCHVFPDTAAMEAGENPQWLYTVVFESAELWGPDADPTVKISVDAFEPYLEAV

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
83 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
176 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
177 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
206 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
379 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
380 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
381 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
382 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
383 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
384 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
385 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
386 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
387 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
388 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
389 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
390 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
391 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
392 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
393 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
394 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
395 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
398 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
399 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
400 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
401 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
411 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
412 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
413 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
414 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
415 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
416 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
417 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
418 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
419 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
420 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
421 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
422 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
423 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
424 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
425 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
426 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
427 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
428 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
429 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
430 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
431 2904699407
432 2906610324
433 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
434 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
435 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
436 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
437 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
438 2922425934
439 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
440 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
441 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
442 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
443 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
444 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
445 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
446 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
447 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
448 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
449 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.09
Metatranscriptomes 0.49
Isolates 4.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.18
Nodule 3.91
Rhizoplane 4.65
Rhizosphere 68.83
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100157974 3300005844 Bacteria 2022
2 rootH2_10076015 3300003320 Bacteria 1231
3 Ga0055542_1006016 3300003762 Bacteria 2648
4 Ga0070676_10218423 3300005328 Bacteria 1258
5 Ga0070683_100296116 3300005329 Bacteria 1539
6 Ga0070670_100089893 3300005331 Bacteria 2640
7 Ga0070670_100166994 3300005331 Bacteria 1908
8 Ga0068869_100098704 3300005334 Bacteria 2206
9 Ga0068869_100484951 3300005334 Bacteria 1030
10 Ga0070666_10340540 3300005335 Bacteria 1072
11 Ga0070680_100061352 3300005336 Bacteria 3078
12 Ga0070682_100754754 3300005337 Bacteria 786
13 Ga0070660_100041315 3300005339 Bacteria 3514
14 Ga0070660_100633548 3300005339 Bacteria 895
15 Ga0070689_100240507 3300005340 Bacteria 1491
16 Ga0070687_100272142 3300005343 Bacteria 1062
17 Ga0070668_100145080 3300005347 Bacteria 1915
18 Ga0070669_100170228 3300005353 Bacteria 1697
19 Ga0070669_100509585 3300005353 Bacteria 999
20 Ga0070671_100106369 3300005355 Bacteria 2355
21 Ga0070671_100188945 3300005355 Bacteria 1746
22 Ga0070674_100065598 3300005356 Bacteria 2548
23 Ga0070674_100154195 3300005356 Bacteria 1736
24 Ga0070674_100169634 3300005356 Bacteria 1662
25 Ga0070659_100637870 3300005366 Bacteria 918
26 Ga0070659_100706938 3300005366 Bacteria 872
27 Ga0070667_100217304 3300005367 Bacteria 1700
28 Ga0070709_10014997 3300005434 Bacteria 4398
29 Ga0070709_10040822 3300005434 Bacteria 2855
30 Ga0070709_10046110 3300005434 Bacteria 2709
31 Ga0070714_100064491 3300005435 Bacteria 3153
32 Ga0070714_100090193 3300005435 Bacteria 2684
33 Ga0070714_100195539 3300005435 Bacteria 1848
34 Ga0070713_100023071 3300005436 Bacteria 4820
35 Ga0070713_100079441 3300005436 Bacteria 2794
36 Ga0070713_100420194 3300005436 Bacteria 1251
37 Ga0070713_100428263 3300005436 Bacteria 1240
38 Ga0070713_100632964 3300005436 Bacteria 1018
39 Ga0070713_100882993 3300005436 Bacteria 859
40 Ga0070710_10000719 3300005437 Bacteria 15786
41 Ga0070710_10136397 3300005437 Bacteria 1500
42 Ga0070701_10188289 3300005438 Bacteria 1213
43 Ga0070711_100005516 3300005439 Bacteria 7573
44 Ga0070711_100005598 3300005439 Bacteria 7519
45 Ga0070700_100034582 3300005441 Bacteria 3053
46 Ga0070694_100250475 3300005444 Bacteria 1340
47 Ga0070694_100581591 3300005444 Bacteria 900
48 Ga0070708_100081752 3300005445 Bacteria 2925
49 Ga0070663_100008568 3300005455 Bacteria 6300
50 Ga0070663_100098071 3300005455 Bacteria 2183
51 Ga0070663_100281889 3300005455 Bacteria 1324
52 Ga0070662_100172927 3300005457 Bacteria 1697
53 Ga0070681_10070438 3300005458 Bacteria 3462
54 Ga0068867_100015478 3300005459 Bacteria 5410
55 Ga0070685_10082592 3300005466 Bacteria 1929
56 Ga0070698_100198060 3300005471 Bacteria 1945
57 Ga0070698_100212834 3300005471 Bacteria 1867
58 Ga0070699_100049973 3300005518 Bacteria 3619
59 Ga0070679_100023003 3300005530 Bacteria 6096
60 Ga0070679_100314386 3300005530 Bacteria 1516
61 Ga0070679_100733087 3300005530 Bacteria 931
62 Ga0070684_100021420 3300005535 Bacteria 5379
63 Ga0070684_100039811 3300005535 Bacteria 4045
64 Ga0070697_100034413 3300005536 Bacteria 4085
65 Ga0070697_100538129 3300005536 Bacteria 1024
66 Ga0068853_100070494 3300005539 Bacteria 3043
67 Ga0068853_100422140 3300005539 Bacteria 1251
68 Ga0068853_100429611 3300005539 Bacteria 1240
69 Ga0070672_100023017 3300005543 Bacteria 4587
70 Ga0070672_100415452 3300005543 Bacteria 1155
71 Ga0070686_100183597 3300005544 Bacteria 1488
72 Ga0070695_100463791 3300005545 Bacteria 973
73 Ga0070696_100181143 3300005546 Bacteria 1563
74 Ga0070693_100099247 3300005547 Bacteria 1771
75 Ga0070665_100004313 3300005548 Bacteria 14949
76 Ga0070665_100085944 3300005548 Bacteria 3151
77 Ga0070665_100441579 3300005548 Bacteria 1310
78 Ga0068855_100074693 3300005563 Bacteria 3936
79 Ga0068855_100095746 3300005563 Bacteria 3421
80 Ga0068857_100033813 3300005577 Bacteria 4522
81 Ga0068857_100241298 3300005577 Bacteria 1655
82 Ga0068857_100365679 3300005577 Bacteria 1338
83 Ga0068857_100878774 3300005577 Bacteria 859
84 Ga0068854_100348232 3300005578 Bacteria 1212
85 Ga0068856_100038009 3300005614 Bacteria 4724
86 Ga0068856_100248991 3300005614 Bacteria 1792
87 Ga0070702_100057467 3300005615 Bacteria 2251
88 Ga0070702_100505071 3300005615 Bacteria 889
89 Ga0068852_100870921 3300005616 Bacteria 917
90 Ga0068859_100150199 3300005617 Bacteria 2405
91 Ga0068864_100022753 3300005618 Bacteria 5256
92 Ga0068866_10018371 3300005718 Bacteria 3162
93 Ga0068866_10066810 3300005718 Bacteria 1886
94 Ga0068866_10268389 3300005718 Bacteria 1052
95 Ga0068861_100046124 3300005719 Bacteria 3284
96 Ga0068863_100636916 3300005841 Bacteria 1057
97 Ga0068858_100108729 3300005842 Bacteria 2588
98 Ga0068858_100877869 3300005842 Bacteria 876
99 Ga0068860_100155482 3300005843 Bacteria 2204
100 Ga0068862_100432842 3300005844 Bacteria 1237
101 Ga0081455_10075918 3300005937 Bacteria 2771
102 Ga0081540_1003549 3300005983 Bacteria 12287
103 Ga0081540_1005852 3300005983 Bacteria 9093
104 Ga0081540_1055888 3300005983 Bacteria 1920
105 Ga0081539_10000080 3300005985 Bacteria 222745
106 Ga0081539_10004945 3300005985 Bacteria 14165
107 Ga0070717_10015214 3300006028 Bacteria 5937
108 Ga0070717_10069526 3300006028 Bacteria 2932
109 Ga0070717_10239746 3300006028 Bacteria 1599
110 Ga0070717_10333212 3300006028 Bacteria 1354
111 Ga0070717_10377875 3300006028 Bacteria 1270
112 Ga0075365_10035263 3300006038 Bacteria 3235
113 Ga0075365_10044807 3300006038 Bacteria 2900
114 Ga0075365_10074316 3300006038 Unclassified 2292
115 Ga0075365_10123017 3300006038 Bacteria 1791
116 Ga0075365_10175145 3300006038 Bacteria 1498
117 Ga0075365_10205234 3300006038 Bacteria 1381
118 Ga0075365_10608802 3300006038 Bacteria 772
119 Ga0075368_10036222 3300006042 Bacteria 1927
120 Ga0075368_10039256 3300006042 Bacteria 1855
121 Ga0075368_10102999 3300006042 Bacteria 1173
122 Ga0075363_100000857 3300006048 Bacteria 10628
123 Ga0075363_100001412 3300006048 Bacteria 9091
124 Ga0075363_100019080 3300006048 Bacteria 3424
125 Ga0075363_100028323 3300006048 Bacteria 2880
126 Ga0075363_100213566 3300006048 Bacteria 1104
127 Ga0075364_10113322 3300006051 Bacteria 1811
128 Ga0075364_10147991 3300006051 Bacteria 1582
129 Ga0075364_10158960 3300006051 Bacteria 1525
130 Ga0075364_10234358 3300006051 Bacteria 1247
131 Ga0075364_10347855 3300006051 Bacteria 1010
132 Ga0070715_10278708 3300006163 Bacteria 885
133 Ga0070716_100005361 3300006173 Bacteria 6203
134 Ga0070716_100034275 3300006173 Bacteria 2782
135 Ga0070716_100092118 3300006173 Bacteria 1837
136 Ga0070716_100114698 3300006173 Bacteria 1676
137 Ga0070716_100260367 3300006173 Bacteria 1186
138 Ga0070712_100010082 3300006175 Bacteria 5953
139 Ga0075362_10008259 3300006177 Bacteria 3976
140 Ga0075362_10144480 3300006177 Bacteria 1138
141 Ga0075362_10151521 3300006177 Bacteria 1112
142 Ga0075362_10222216 3300006177 Unclassified 923
143 Ga0075362_10232966 3300006177 Bacteria 902
144 Ga0075367_10093749 3300006178 Bacteria 1829
145 Ga0075367_10127856 3300006178 Bacteria 1569
146 Ga0075367_10156398 3300006178 Bacteria 1416
147 Ga0075367_10210676 3300006178 Unclassified 1215
148 Ga0075367_10239991 3300006178 Bacteria 1136
149 Ga0075369_10053682 3300006186 Bacteria 1749
150 Ga0075369_10085957 3300006186 Bacteria 1399
151 Ga0075369_10092749 3300006186 Bacteria 1349
152 Ga0075369_10137322 3300006186 Bacteria 1113
153 Ga0075366_10000395 3300006195 Bacteria 20281
154 Ga0075366_10047379 3300006195 Plasmid 2548
155 Ga0075366_10048755 3300006195 Bacteria 2512
156 Ga0075366_10179498 3300006195 Bacteria 1286
157 Ga0075366_10339205 3300006195 Bacteria 921
158 Ga0097621_100102466 3300006237 Bacteria 2410
159 Ga0075370_10030843 3300006353 Bacteria 2992
160 Ga0075428_100478622 3300006844 Bacteria 1333
161 Ga0075433_10430829 3300006852 Bacteria 1163
162 Ga0075434_100080217 3300006871 Bacteria 3259
163 Ga0075434_100547675 3300006871 Bacteria 1177
164 Ga0068865_100289609 3300006881 Bacteria 1307
165 Ga0075436_100305500 3300006914 Bacteria 1141
166 Ga0075436_100452667 3300006914 Bacteria 935
167 Ga0097620_100150198 3300006931 Bacteria 2405
168 Ga0099824_1011629 3300006942 Bacteria 9880
169 Ga0099822_1000949 3300006943 Bacteria 31391
170 Ga0075435_100051318 3300007076 Bacteria 3322
171 Ga0099794_10005736 3300007265 Bacteria 5004
172 Ga0099794_10126763 3300007265 Bacteria 1287
173 Ga0099795_10015254 3300007788 Bacteria 2402
174 Ga0099795_10144120 3300007788 Bacteria 971
175 Ga0099795_10146058 3300007788 Bacteria 965
176 Ga0105240_10011857 3300009093 Bacteria 12101
177 Ga0105240_10088795 3300009093 Bacteria 3782
178 Ga0105240_10592127 3300009093 Bacteria 1222
179 Ga0111539_10096406 3300009094 Bacteria 3474
180 Ga0111539_10662840 3300009094 Bacteria 1215
181 Ga0105245_10049278 3300009098 Bacteria 3771
182 Ga0105245_10091678 3300009098 Bacteria 2797
183 Ga0105245_10463719 3300009098 Bacteria 1277
184 Ga0105245_10706136 3300009098 Bacteria 1042
185 Ga0114129_10148400 3300009147 Bacteria 3211
186 Ga0114129_11633049 3300009147 Bacteria 788
187 Ga0105243_10827095 3300009148 Bacteria 915
188 Ga0105241_10066654 3300009174 Bacteria 2784
189 Ga0105248_10044100 3300009177 Bacteria 5002
190 Ga0105248_10784156 3300009177 Bacteria 1076
191 Ga0105237_10430709 3300009545 Bacteria 1325
192 Ga0105238_10160641 3300009551 Bacteria 2223
193 Ga0105249_10194106 3300009553 Bacteria 1983
194 Ga0105249_10651790 3300009553 Bacteria 1111
195 Ga0099796_10047202 3300010159 Bacteria 1481
196 Ga0105239_10238043 3300010375 Bacteria 2043
197 Ga0105239_10327435 3300010375 Bacteria 1728
198 Ga0157373_10038216 3300013100 Bacteria 3441
199 Ga0157370_10016953 3300013104 Bacteria 7364
200 Ga0157369_10005882 3300013105 Bacteria 14252
201 Ga0157369_10274217 3300013105 Bacteria 1757
202 Ga0157374_10111864 3300013296 Bacteria 2627
203 Ga0163162_10283551 3300013306 Bacteria 1788
204 Ga0157375_10282907 3300013308 Bacteria 1822
205 Ga0157375_10719323 3300013308 Bacteria 1151
206 Ga0163163_10290836 3300014325 Bacteria 1686
207 Ga0163163_10311487 3300014325 Bacteria 1627
208 Ga0163163_10661067 3300014325 Bacteria 1108
209 Ga0163163_11136458 3300014325 Bacteria 844
210 Ga0157380_10701963 3300014326 Bacteria 1017
211 Ga0157380_10793269 3300014326 Bacteria 963
212 Ga0157380_11179883 3300014326 Bacteria 808
213 Ga0157379_10116830 3300014968 Bacteria 2399
214 Ga0157379_10138693 3300014968 Bacteria 2192
215 Ga0157379_10455227 3300014968 Bacteria 1182
216 Ga0157376_10045991 3300014969 Bacteria 3597
217 Ga0157376_10083178 3300014969 Bacteria 2752
218 Ga0157376_10564367 3300014969 Bacteria 1128
219 Ga0163161_10034729 3300017792 Bacteria 3607
220 Ga0163161_10161909 3300017792 Bacteria 1706
221 Ga0163161_10275230 3300017792 Bacteria 1319
222 Ga0163161_10501570 3300017792 Bacteria 988
223 Ga0206356_10868155 3300020070 Bacteria 1056
224 Ga0206353_10329655 3300020082 Bacteria 1665
225 Ga0213876_10058680 3300021384 Bacteria 2031
226 Ga0213875_10000012 3300021388 Bacteria 312017
227 Ga0224712_10084737 3300022467 Bacteria 1316
228 Ga0209677_100482 3300025253 Bacteria 22696
229 Ga0209148_1000263 3300025254 Bacteria 82544
230 Ga0209233_1001276 3300025261 Bacteria 10091
231 Ga0209455_1000262 3300025272 Bacteria 60590
232 Ga0209455_1003361 3300025272 Bacteria 5714
233 Ga0209455_1003722 3300025272 Bacteria 5274
234 Ga0209564_1019149 3300025295 Bacteria 2573
235 Ga0209758_1027776 3300025297 Bacteria 2410
236 Ga0207682_10001464 3300025893 Bacteria 10899
237 Ga0207692_10005609 3300025898 Bacteria 5036
238 Ga0207692_10025067 3300025898 Bacteria 2781
239 Ga0207692_10053358 3300025898 Bacteria 2059
240 Ga0207642_10051501 3300025899 Bacteria 1863
241 Ga0207642_10220618 3300025899 Bacteria 1059
242 Ga0207710_10105571 3300025900 Bacteria 1333
243 Ga0207688_10063288 3300025901 Bacteria 2087
244 Ga0207688_10121134 3300025901 Bacteria 1527
245 Ga0207680_10228259 3300025903 Bacteria 1279
246 Ga0207699_10013687 3300025906 Bacteria 4160
247 Ga0207699_10213412 3300025906 Bacteria 1314
248 Ga0207699_10321744 3300025906 Bacteria 1085
249 Ga0207645_10221419 3300025907 Bacteria 1247
250 Ga0207645_10263463 3300025907 Bacteria 1142
251 Ga0207643_10023724 3300025908 Bacteria 3384
252 Ga0207707_10031316 3300025912 Bacteria 4654
253 Ga0207707_10043801 3300025912 Bacteria 3902
254 Ga0207707_10234506 3300025912 Bacteria 1596
255 Ga0207707_10259359 3300025912 Bacteria 1508
256 Ga0207695_10019824 3300025913 Bacteria 7730
257 Ga0207695_10196348 3300025913 Bacteria 1934
258 Ga0207671_10037370 3300025914 Bacteria 3601
259 Ga0207671_10263880 3300025914 Bacteria 1356
260 Ga0207671_10716011 3300025914 Bacteria 796
261 Ga0207693_10003782 3300025915 Bacteria 12888
262 Ga0207693_10074933 3300025915 Bacteria 2650
263 Ga0207693_10191026 3300025915 Bacteria 1611
264 Ga0207693_10397699 3300025915 Bacteria 1077
265 Ga0207663_10000453 3300025916 Bacteria 17832
266 Ga0207663_10004390 3300025916 Bacteria 7002
267 Ga0207663_10082687 3300025916 Bacteria 2107
268 Ga0207663_10199844 3300025916 Bacteria 1441
269 Ga0207660_10311516 3300025917 Bacteria 1255
270 Ga0207662_10017388 3300025918 Bacteria 4067
271 Ga0207662_10086852 3300025918 Bacteria 1917
272 Ga0207657_10005543 3300025919 Bacteria 13180
273 Ga0207649_10050030 3300025920 Bacteria 2584
274 Ga0207652_10029677 3300025921 Bacteria 4575
275 Ga0207652_10085816 3300025921 Bacteria 2759
276 Ga0207681_10205725 3300025923 Bacteria 1514
277 Ga0207694_10194580 3300025924 Bacteria 1648
278 Ga0207694_10246626 3300025924 Bacteria 1460
279 Ga0207650_10165621 3300025925 Bacteria 1754
280 Ga0207650_10637655 3300025925 Bacteria 898
281 Ga0207687_10082586 3300025927 Bacteria 2325
282 Ga0207700_10014019 3300025928 Bacteria 5240
283 Ga0207700_10030154 3300025928 Bacteria 3837
284 Ga0207700_10034731 3300025928 Bacteria 3623
285 Ga0207700_10523589 3300025928 Bacteria 1051
286 Ga0207664_10031526 3300025929 Bacteria 4056
287 Ga0207664_10158833 3300025929 Bacteria 1927
288 Ga0207664_10392636 3300025929 Bacteria 1233
289 Ga0207664_10417282 3300025929 Bacteria 1195
290 Ga0207644_10067731 3300025931 Bacteria 2603
291 Ga0207644_10140064 3300025931 Bacteria 1862
292 Ga0207644_10201862 3300025931 Bacteria 1569
293 Ga0207690_10312218 3300025932 Bacteria 1233
294 Ga0207706_10086952 3300025933 Bacteria 2748
295 Ga0207706_10099286 3300025933 Bacteria 2561
296 Ga0207709_10041095 3300025935 Bacteria 2773
297 Ga0207670_10477219 3300025936 Bacteria 1009
298 Ga0207669_10012191 3300025937 Bacteria 4219
299 Ga0207669_10840005 3300025937 Bacteria 764
300 Ga0207704_10421923 3300025938 Bacteria 1058
301 Ga0207665_10000724 3300025939 Bacteria 22366
302 Ga0207665_10003173 3300025939 Bacteria 11015
303 Ga0207665_10056079 3300025939 Bacteria 2660
304 Ga0207665_10136022 3300025939 Bacteria 1749
305 Ga0207665_10294665 3300025939 Bacteria 1211
306 Ga0207665_10501016 3300025939 Bacteria 938
307 Ga0207665_10644051 3300025939 Bacteria 830
308 Ga0207691_10042135 3300025940 Bacteria 4209
309 Ga0207691_10258425 3300025940 Bacteria 1501
310 Ga0207689_10021327 3300025942 Bacteria 5447
311 Ga0207689_10136196 3300025942 Bacteria 2022
312 Ga0207661_10049430 3300025944 Bacteria 3347
313 Ga0207661_10470274 3300025944 Bacteria 1147
314 Ga0207679_10242520 3300025945 Bacteria 1528
315 Ga0207712_10049944 3300025961 Bacteria 2918
316 Ga0207668_10300659 3300025972 Bacteria 1324
317 Ga0207668_10300963 3300025972 Bacteria 1323
318 Ga0207640_10213556 3300025981 Bacteria 1472
319 Ga0207658_10562117 3300025986 Bacteria 1022
320 Ga0207703_10020295 3300026035 Bacteria 5196
321 Ga0207703_10172657 3300026035 Bacteria 1903
322 Ga0207639_10076451 3300026041 Bacteria 2636
323 Ga0207639_10152666 3300026041 Bacteria 1936
324 Ga0207639_10443454 3300026041 Bacteria 1177
325 Ga0207678_10017116 3300026067 Bacteria 6365
326 Ga0207678_10056581 3300026067 Bacteria 3376
327 Ga0207708_10132349 3300026075 Bacteria 1951
328 Ga0207708_10247704 3300026075 Bacteria 1435
329 Ga0207702_10003187 3300026078 Bacteria 15165
330 Ga0207702_10095974 3300026078 Bacteria 2607
331 Ga0207641_10523011 3300026088 Bacteria 1154
332 Ga0207648_10013660 3300026089 Bacteria 7539
333 Ga0207648_10020006 3300026089 Bacteria 6038
334 Ga0207648_10229603 3300026089 Bacteria 1651
335 Ga0207676_10005646 3300026095 Bacteria 8856
336 Ga0207676_10146224 3300026095 Bacteria 2030
337 Ga0207674_10059417 3300026116 Bacteria 3869
338 Ga0207674_10220649 3300026116 Bacteria 1844
339 Ga0207674_10642121 3300026116 Bacteria 1025
340 Ga0207675_100062108 3300026118 Bacteria 3488
341 Ga0207675_100664793 3300026118 Bacteria 1049
342 Ga0207683_10010073 3300026121 Bacteria 8064
343 Ga0207683_10022911 3300026121 Bacteria 5367
344 Ga0207698_10189086 3300026142 Bacteria 1832
345 Ga0207698_10252145 3300026142 Bacteria 1616
346 Ga0209589_1000003 3300027357 Bacteria 629130
347 Ga0209489_100003 3300027361 Bacteria 663105
348 Ga0209700_100003 3300027363 Bacteria 663105
349 Ga0209981_1004107 3300027378 Bacteria 1898
350 Ga0209984_1008400 3300027424 Bacteria 1300
351 Ga0210000_1005188 3300027462 Bacteria 1887
352 Ga0209999_1001396 3300027543 Bacteria 4140
353 Ga0209983_1013455 3300027665 Bacteria 1682
354 Ga0209588_1054156 3300027671 Bacteria 1297
355 Ga0209971_1023614 3300027682 Bacteria 1467
356 Ga0209974_10007791 3300027876 Bacteria 3682
357 Ga0207428_10480303 3300027907 Bacteria 904
358 Ga0268266_10005823 3300028379 Bacteria 11405
359 Ga0268266_10013089 3300028379 Bacteria 7153
360 Ga0268266_10136043 3300028379 Bacteria 2201
361 Ga0268266_10292962 3300028379 Bacteria 1516
362 Ga0268264_10179036 3300028381 Bacteria 1924
363 Ga0268264_10288713 3300028381 Bacteria 1540
364 Ga0307517_10000053 3300028786 Bacteria 155723
365 Ga0307517_10254788 3300028786 Bacteria 1025
366 Ga0307515_10172878 3300028794 Bacteria 2144
367 Ga0307515_10536420 3300028794 Bacteria 780
368 Ga0265325_10044236 3300031241 Bacteria 2320
369 Ga0265340_10030899 3300031247 Bacteria 2682
370 Ga0265339_10016659 3300031249 Bacteria 4374
371 Ga0265339_10088631 3300031249 Bacteria 1625
372 Ga0265331_10028279 3300031250 Bacteria 2805
373 Ga0265316_10217016 3300031344 Bacteria 1413
374 Ga0265316_10233075 3300031344 Bacteria 1355
375 Ga0307513_10108813 3300031456 Bacteria 2770
376 Ga0307513_10136315 3300031456 Bacteria 2390
377 Ga0307513_10203968 3300031456 Bacteria 1815
378 Ga0307509_10047750 3300031507 Bacteria 4603
379 Ga0307508_10050635 3300031616 Bacteria 3695
380 Ga0265314_10011848 3300031711 Bacteria 7164
381 Ga0265314_10028730 3300031711 Bacteria 4142
382 Ga0265342_10021476 3300031712 Bacteria 4120
383 Ga0265342_10053626 3300031712 Bacteria 2399
384 Ga0307405_10281962 3300031731 Bacteria 1251
385 Ga0307405_10380607 3300031731 Bacteria 1098
386 Ga0307406_10173704 3300031901 Bacteria 1562
387 Ga0307406_10452083 3300031901 Bacteria 1031
388 Ga0307411_10639857 3300032005 Bacteria 919
389 Ga0307415_100097181 3300032126 Bacteria 2149
390 Ga0307415_100226943 3300032126 Bacteria 1501
391 Ga0307510_10035900 3300033180 Bacteria 5526
392 Ga0315911_1000001 3300033442 Bacteria 1088602
393 Ga0316215_1004414 3300033544 Bacteria 1349
394 Ga0373934_0222232 3300035086 Bacteria 779
395 Ga0373944_0039913 3300035089 Bacteria 1447
396 Ga0373923_0006085 3300035111 Bacteria 4146
397 Ga0373923_0009457 3300035111 Bacteria 3518
398 Ga0373936_0003582 3300035113 Bacteria 5849
399 Ga0373945_0029162 3300035116 Bacteria 1937
400 Ga0373953_0173261 3300035117 Bacteria 929
401 Ga0373954_0023399 3300035118 Bacteria 2808
402 Ga0373943_0209265 3300035170 Bacteria 1082
403 Ga0373955_0035043 3300035172 Bacteria 2655
404 Ga0373955_0088693 3300035172 Bacteria 1759
405 Ga0373924_0040875 3300035410 Bacteria 1899
406 Ga0373927_0072694 3300035695 Bacteria 2226
407 Ga0373927_0096712 3300035695 Bacteria 1919
408 Ga0373927_0244471 3300035695 Bacteria 1179
409 Ga0373927_0273273 3300035695 Bacteria 1111
410 Ga0373927_0507618 3300035695 Bacteria 797
411 Ga0373933_0203406 3300035724 Bacteria 1268
412 Ga0373947_0016882 3300035725 Bacteria 4194
413 Ga0373947_0021843 3300035725 Bacteria 3708
414 Ga0373947_0142152 3300035725 Bacteria 1540
415 Ga0373937_0052926 3300036401 Bacteria 3724
416 Ga0373937_0772932 3300036401 Bacteria 908
417 Ga0372808_013295 3300036459 Bacteria 1172
418 Ga0373925_0042684 3300037068 Bacteria 3365
419 Ga0373925_0073227 3300037068 Bacteria 2593
420 Ga0373925_0377760 3300037068 Bacteria 1153
421 Ga0373925_0575710 3300037068 Bacteria 927
422 Ga0395899_0264209 3300037312 Bacteria 1176
423 Ga0395900_0021204 3300037418 Bacteria 6643
424 Ga0395898_0041898 3300037466 Bacteria 4520
425 Ga0395898_0108054 3300037466 Bacteria 2668
426 Ga0395898_0190092 3300037466 Bacteria 1962
427 Ga0395905_0602470 3300037471 Bacteria 1000
428 Ga0395905_0790158 3300037471 Bacteria 852
429 Ga0436364_0553890 3300037853 Bacteria 33608
430 Ga0436364_1182827 3300037853 Bacteria 1943
431 Ga0395901_0026797 3300038443 Bacteria 5918
432 Ga0395901_0203414 3300038443 Bacteria 2075
433 Ga0436365_0311489 3300039437 Bacteria 756
434 Ga0436365_0705278 3300039437 Bacteria 1500
435 Ga0436365_0983494 3300039437 Bacteria 1272
436 Ga0436365_1036097 3300039437 Bacteria 4502
437 Ga0436365_1883528 3300039437 Bacteria 1711
438 Ga0436360_1376244 3300039438 Bacteria 1096
439 Ga0436361_0725531 3300039447 Bacteria 1783
440 Ga0436361_0771252 3300039447 Bacteria 3789
441 Ga0436363_0838211 3300039450 Bacteria 1583
442 Ga0439459_0015121 3300042438 Bacteria 1411
443 Ga0466969_0211805 3300044656 Bacteria 882
444 Ga0466966_0137609 3300044684 Bacteria 1493
445 Ga0466957_0177072 3300044842 Bacteria 1391
446 Ga0466967_0553658 3300045976 Bacteria 1132
447 Ga0495617_003916 3300046452 Bacteria 5487
448 Ga0495603_0051759 3300046455 Bacteria 2439
449 Ga0495603_0054526 3300046455 Bacteria 2369
450 Ga0495603_0115356 3300046455 Bacteria 1566
451 Ga0495590_0103148 3300046457 Bacteria 1014
452 Ga0495629_0051829 3300046459 Bacteria 2872
453 Ga0495629_0056543 3300046459 Bacteria 2743
454 Ga0495629_0091841 3300046459 Bacteria 2119
455 Ga0495638_0019222 3300046460 Bacteria 4521
456 Ga0495638_0052894 3300046460 Bacteria 2528
457 Ga0495638_0061589 3300046460 Bacteria 2318
458 Ga0495641_0087145 3300046461 Bacteria 1397
459 Ga0495651_0033637 3300046462 Bacteria 3998
460 Ga0495651_0067221 3300046462 Bacteria 2734
461 Ga0495651_0068037 3300046462 Bacteria 2715
462 Ga0495653_0086572 3300046463 Bacteria 2303
463 Ga0495653_0218512 3300046463 Bacteria 1282
464 Ga0495580_0066957 3300046472 Bacteria 2513
465 Ga0495580_0145636 3300046472 Bacteria 1642
466 Ga0495605_0067404 3300046474 Bacteria 1698
467 Ga0495639_0016126 3300046475 Bacteria 3241
468 Ga0495664_0036962 3300046477 Bacteria 2881
469 Ga0495664_0058635 3300046477 Bacteria 2290
470 Ga0495585_0044904 3300046492 Bacteria 2467
471 Ga0495594_0085892 3300046499 Bacteria 1760
472 Ga0495594_0181153 3300046499 Bacteria 1199
473 Ga0495596_0033908 3300046500 Bacteria 2030
474 Ga0495606_0002525 3300046507 Bacteria 21061
475 Ga0495606_0071605 3300046507 Bacteria 2182
476 Ga0495608_0081096 3300046511 Bacteria 2108
477 Ga0495608_0131609 3300046511 Bacteria 1600
478 Ga0495616_0063583 3300046513 Bacteria 1803
479 Ga0495616_0109173 3300046513 Bacteria 1287
480 Ga0495618_0071751 3300046514 Bacteria 2203
481 Ga0495618_0209145 3300046514 Bacteria 1233
482 Ga0495630_0060518 3300046517 Bacteria 2842
483 Ga0495630_0068005 3300046517 Bacteria 2678
484 Ga0495631_0034806 3300046518 Bacteria 2256
485 Ga0495631_0141539 3300046518 Bacteria 1033
486 Ga0495631_0251081 3300046518 Bacteria 754
487 Ga0495643_0270869 3300046522 Bacteria 785
488 Ga0495648_0005048 3300046524 Bacteria 11084
489 Ga0495648_0032770 3300046524 Bacteria 3404
490 Ga0495663_0015429 3300046525 Bacteria 2153
491 Ga0495652_0124731 3300046529 Bacteria 2048
492 Ga0495654_0008348 3300046530 Bacteria 5726
493 Ga0495654_0086196 3300046530 Bacteria 1464
494 Ga0495665_0008224 3300046531 Bacteria 5657
495 Ga0495665_0192300 3300046531 Bacteria 1059
496 Ga0495586_0437125 3300046535 Bacteria 754
497 Ga0495587_0049969 3300046536 Bacteria 2474
498 Ga0495609_0055884 3300046538 Bacteria 1750
499 Ga0495621_0017202 3300046539 Bacteria 2333
500 Ga0495645_0070955 3300046543 Bacteria 2513
501 Ga0495645_0073494 3300046543 Bacteria 2463
502 Ga0495645_0178951 3300046543 Bacteria 1454
503 Ga0495622_0023358 3300046557 Bacteria 2882
504 Ga0495667_0166671 3300046559 Bacteria 1416
505 Ga0495667_0228305 3300046559 Bacteria 1187
506 Ga0495667_0241127 3300046559 Bacteria 1151
507 Ga0495656_0010368 3300046615 Bacteria 3387
508 Ga0495656_0060017 3300046615 Bacteria 1656
509 Ga0495668_0020113 3300046616 Bacteria 3840
510 Ga0495668_0203059 3300046616 Bacteria 1085
511 Ga0495668_0272650 3300046616 Bacteria 927
512 Ga0495668_0440665 3300046616 Bacteria 717
513 Ga0495634_0207195 3300046642 Bacteria 1215
514 Ga0495625_0177540 3300046660 Bacteria 1418
515 Ga0495625_0250052 3300046660 Bacteria 1151
516 Ga0495635_0014444 3300046663 Bacteria 5524
517 Ga0495635_0321007 3300046663 Bacteria 1036
518 Ga0495659_0106251 3300046664 Bacteria 1092
519 Ga0495661_0054343 3300046665 Bacteria 2404
520 Ga0495588_0079625 3300046674 Bacteria 1710
521 Ga0495657_0185379 3300046675 Bacteria 1274
522 Ga0495599_0055815 3300046678 Bacteria 2472
523 Ga0495623_0170952 3300046679 Bacteria 1269
524 Ga0495623_0184382 3300046679 Bacteria 1210
525 Ga0495646_0034935 3300046680 Bacteria 3119
526 Ga0495647_0047169 3300046681 Bacteria 1662
527 Ga0495658_0013531 3300046683 Bacteria 4154
528 Ga0495669_0013819 3300046684 Bacteria 3446
529 Ga0495624_0131629 3300046690 Bacteria 1533
530 Ga0495624_0206334 3300046690 Bacteria 1193
531 Ga0495670_0001196 3300046691 Bacteria 12601
532 Ga0495670_0178381 3300046691 Bacteria 1121
533 Ga0495589_0046558 3300046794 Bacteria 2152
534 Ga0495600_0165454 3300046809 Bacteria 1429
535 Ga0495581_0230894 3300047315 Bacteria 1082
536 Ga0495604_0037770 3300047317 Bacteria 3801
537 Ga0495604_0392252 3300047317 Bacteria 915
538 Ga0495674_0020210 3300047319 Bacteria 6167
539 Ga0495674_0301564 3300047319 Bacteria 1308
540 Ga0495674_0364741 3300047319 Bacteria 1171
541 Ga0495672_0043987 3300047320 Bacteria 2681
542 Ga0495672_0120121 3300047320 Bacteria 1398
543 Ga0495676_0250266 3300047321 Bacteria 1209
544 Ga0495680_0168631 3300047322 Bacteria 1586
545 Ga0495675_0014847 3300047444 Bacteria 4925
546 Ga0495675_0307475 3300047444 Bacteria 940
547 Ga0495677_0039196 3300047445 Bacteria 1732
548 Ga0495684_0002390 3300047471 Bacteria 15006
549 Ga0495684_0056123 3300047471 Bacteria 3003
550 Ga0495684_0180303 3300047471 Bacteria 1566
551 Ga0495593_0031583 3300047673 Bacteria 2892
552 Ga0495593_0051191 3300047673 Bacteria 2186
553 Ga0495602_0146322 3300048088 Bacteria 1864
554 Ga0495615_0038933 3300048090 Bacteria 1177
555 Ga0495626_0134938 3300048091 Bacteria 1051
556 Ga0496100_0023500 3300048903 Bacteria 3746
557 Ga0496101_0027031 3300048904 Bacteria 3992
558 Ga0496101_0113865 3300048904 Bacteria 2039
559 Ga0496101_0174399 3300048904 Bacteria 1653
560 Ga0496102_0071229 3300048905 Bacteria 3192
561 Ga0496102_0092337 3300048905 Bacteria 2803
562 Ga0496102_0177314 3300048905 Bacteria 2007
563 Ga0496102_0291848 3300048905 Bacteria 1537
564 Ga0496102_0550750 3300048905 Bacteria 1076
565 Ga0496102_0748973 3300048905 Bacteria 900
566 Ga0496102_0848150 3300048905 Bacteria 836
567 Ga0496103_0371815 3300048906 Bacteria 919
568 Ga0496106_0024811 3300048909 Bacteria 4458
569 Ga0496106_0126932 3300048909 Bacteria 1998
570 Ga0496106_0132600 3300048909 Bacteria 1954
571 Ga0496106_0152890 3300048909 Bacteria 1821
572 Ga0496106_0173957 3300048909 Bacteria 1708
573 Ga0496107_0022356 3300048910 Bacteria 4469
574 Ga0496107_0029798 3300048910 Bacteria 3886
575 Ga0496107_0346365 3300048910 Bacteria 1106
576 Ga0496107_0355698 3300048910 Bacteria 1090
577 Ga0496108_0027140 3300048911 Bacteria 4724
578 Ga0496108_0083271 3300048911 Bacteria 2713
579 Ga0496108_0746354 3300048911 Bacteria 847
580 Ga0496109_0035385 3300048912 Bacteria 4504
581 Ga0496109_0100854 3300048912 Bacteria 2679
582 Ga0496109_0620667 3300048912 Bacteria 1018
583 Ga0496109_0853011 3300048912 Bacteria 849
584 Ga0496110_0252757 3300048913 Bacteria 1604
585 Ga0496112_0166789 3300048915 Bacteria 2168
586 Ga0496112_0223971 3300048915 Bacteria 1836
587 Ga0496113_0104297 3300048916 Bacteria 2200
588 Ga0496114_0149296 3300048917 Bacteria 2027
589 Ga0496114_0762243 3300048917 Bacteria 845
590 Ga0496115_0154658 3300048918 Bacteria 1894
591 Ga0496115_0292677 3300048918 Bacteria 1335
592 Ga0496116_0055851 3300048919 Bacteria 2591
593 Ga0496117_0065330 3300048920 Bacteria 2474
594 Ga0496118_0078834 3300048921 Bacteria 2328
595 Ga0496118_0080407 3300048921 Bacteria 2294
596 Ga0496118_0190453 3300048921 Bacteria 1227
597 Ga0496118_0246541 3300048921 Bacteria 1018
598 Ga0496119_0032051 3300048922 Bacteria 3510
599 Ga0496119_0090363 3300048922 Bacteria 1742
600 Ga0496120_0151111 3300048923 Bacteria 1167
601 Ga0496121_0032695 3300048924 Bacteria 4723
602 Ga0496121_0042321 3300048924 Bacteria 3964
603 Ga0496121_0049129 3300048924 Bacteria 3581
604 Ga0496121_0050241 3300048924 Bacteria 3525
605 Ga0496121_0085855 3300048924 Bacteria 2476
606 Ga0496121_0109084 3300048924 Bacteria 2116
607 Ga0496121_0133801 3300048924 Bacteria 1850
608 Ga0496121_0181225 3300048924 Bacteria 1520
609 Ga0496122_0032976 3300048925 Bacteria 4268
610 Ga0496122_0162249 3300048925 Bacteria 1361
611 Ga0496123_0015802 3300048926 Bacteria 6167
612 Ga0496124_0329862 3300048927 Bacteria 1089
613 Ga0496125_0000193 3300048928 Bacteria 130315
614 Ga0496125_0001951 3300048928 Bacteria 28177
615 Ga0496125_0004313 3300048928 Bacteria 16511
616 Ga0496125_0007113 3300048928 Bacteria 11943
617 Ga0496125_0105863 3300048928 Bacteria 2055
618 Ga0496125_0133625 3300048928 Bacteria 1740
619 Ga0496126_0011403 3300048929 Bacteria 9205
620 Ga0496126_0014868 3300048929 Bacteria 7852
621 Ga0496126_0016239 3300048929 Bacteria 7455
622 Ga0496126_0157546 3300048929 Bacteria 1943
623 Ga0496126_0164511 3300048929 Bacteria 1894
624 Ga0496126_0196462 3300048929 Bacteria 1706
625 Ga0496126_0368824 3300048929 Bacteria 1171
626 Ga0496126_0389590 3300048929 Bacteria 1132
627 Ga0501031_0009842 3300049568 Bacteria 6226
628 Ga0501031_0041296 3300049568 Bacteria 3012
629 Ga0501032_0000054 3300049569 Bacteria 100621
630 Ga0501033_0000025 3300049570 Bacteria 173634
631 Ga0501033_0094671 3300049570 Bacteria 2184
632 Ga0501034_0000177 3300049571 Bacteria 118966
633 Ga0501036_0000025 3300049572 Bacteria 106029
634 Ga0501036_0111982 3300049572 Bacteria 2306
635 Ga0501037_0000169 3300049573 Bacteria 61447
636 Ga0501038_0000029 3300049574 Bacteria 132861
637 Ga0501039_0001169 3300049575 Bacteria 19303
638 Ga0501039_0036848 3300049575 Bacteria 3774
639 Ga0501039_0071587 3300049575 Bacteria 2694
640 Ga0501040_0458444 3300049576 Bacteria 918
641 Ga0501041_0183487 3300049577 Bacteria 1310
642 Ga0501042_0018160 3300049578 Bacteria 4867
643 Ga0501042_0052159 3300049578 Bacteria 2917
644 Ga0501042_0172225 3300049578 Bacteria 1562
645 Ga0501043_0000176 3300049579 Bacteria 57036
646 Ga0501046_0000556 3300049580 Bacteria 37044
647 Ga0501046_0076335 3300049580 Bacteria 2596
648 Ga0501046_0093877 3300049580 Bacteria 2306
649 Ga0501047_0000061 3300049581 Bacteria 137341
650 Ga0501047_0067326 3300049581 Bacteria 3451
651 Ga0501047_0160825 3300049581 Bacteria 2117
652 Ga0501048_0000277 3300049582 Bacteria 34591
653 Ga0501048_0145985 3300049582 Bacteria 1673
654 Ga0501067_0000726 3300049583 Bacteria 17726
655 Ga0501068_0001909 3300049584 Bacteria 11084
656 Ga0501068_0526450 3300049584 Bacteria 768
657 Ga0501069_0149567 3300049585 Bacteria 1341
658 Ga0501069_0247051 3300049585 Bacteria 1041
659 Ga0501070_0007106 3300049586 Bacteria 9519
660 Ga0501070_0024345 3300049586 Bacteria 5078
661 Ga0501070_0089836 3300049586 Bacteria 2542
662 Ga0501071_0086404 3300049587 Bacteria 2301
663 Ga0501071_0192927 3300049587 Bacteria 1528
664 Ga0501072_0004578 3300049588 Bacteria 10527
665 Ga0501072_0192657 3300049588 Bacteria 1626
666 Ga0501073_0000156 3300049589 Bacteria 45165
667 Ga0501074_0000605 3300049590 Bacteria 22286
668 Ga0501075_0014324 3300049591 Bacteria 5682
669 Ga0501076_0069366 3300049592 Bacteria 2817
670 Ga0501076_0143784 3300049592 Bacteria 1939
671 Ga0501076_0295335 3300049592 Bacteria 1328
672 Ga0501076_0297349 3300049592 Bacteria 1323
673 Ga0501076_0482497 3300049592 Bacteria 1021
674 Ga0501077_0181128 3300049593 Bacteria 1339
675 Ga0501079_0014710 3300049741 Bacteria 5963
676 Ga0501079_0074440 3300049741 Bacteria 2625
677 Ga0501079_0130830 3300049741 Bacteria 1953
678 Ga0501079_0650208 3300049741 Bacteria 830
679 Ga0501080_0014702 3300049742 Bacteria 7206
680 Ga0501080_0166411 3300049742 Bacteria 2034
681 Ga0501080_0565699 3300049742 Bacteria 1012
682 Ga0501081_0172075 3300049743 Bacteria 1564
683 Ga0501083_0001694 3300049744 Bacteria 15017
684 Ga0501035_0001729 3300049822 Bacteria 22058
685 Ga0501044_0000028 3300049823 Bacteria 179203
686 Ga0501044_0395938 3300049823 Bacteria 1294
687 Ga0501044_0524339 3300049823 Bacteria 1084
688 Ga0501045_0007158 3300049824 Bacteria 7740
689 nmdc:mga03683_121523_c1 3300050489 Bacteria 1161
690 nmdc:mga03683_197064_c1 3300050489 Unclassified 923
691 nmdc:mga03683_83394_c1 3300050489 Bacteria 1384
692 nmdc:mga03n38_32731_c1 3300050490 Bacteria 2205
693 nmdc:mga03n38_404_c1 3300050490 Bacteria 10692
694 nmdc:mga00v17_223020_c1 3300050491 Bacteria 1221
695 nmdc:mga00v17_245934_c1 3300050491 Bacteria 1160
696 nmdc:mga00v17_90789_c1 3300050491 Bacteria 1918
697 nmdc:mga0yw44_222553_c1 3300050492 Unclassified 1251
698 nmdc:mga0yw44_22793_c1 3300050492 Bacteria 3517
699 nmdc:mga0yw44_265040_c1 3300050492 Bacteria 1146
700 nmdc:mga0yw44_306529_c1 3300050492 Bacteria 1065
701 nmdc:mga0yw44_330974_c1 3300050492 Bacteria 1024
702 nmdc:mga0yw44_47969_c1 3300050492 Bacteria 2574
703 nmdc:mga0yw44_565281_c1 3300050492 Bacteria 772
704 nmdc:mga0k408_169344_c1 3300050493 Bacteria 1302
705 nmdc:mga0k408_250448_c1 3300050493 Bacteria 1058
706 nmdc:mga06z11_402750_c1 3300050494 Bacteria 824
707 nmdc:mga06z11_7555_c1 3300050494 Bacteria 4482
708 nmdc:mga06z11_95067_c1 3300050494 Unclassified 1625
709 nmdc:mga06z11_97015_c1 3300050494 Bacteria 1611
710 nmdc:mga07m45_10981_c1 3300050496 Bacteria 4746
711 nmdc:mga07m45_126421_c1 3300050496 Bacteria 1478
712 nmdc:mga07m45_79355_c1 3300050496 Bacteria 1873
713 nmdc:mga07m45_81011_c1 3300050496 Bacteria 1854
714 nmdc:mga05p37_316492_c1 3300050507 Bacteria 1848
715 nmdc:mga08y16_112482_c1 3300050511 Bacteria 2834
716 nmdc:mga08y16_740102_c1 3300050511 Bacteria 980
717 nmdc:mga08y16_89055_c1 3300050511 Bacteria 3216
718 nmdc:mga0n895_290751_c1 3300050512 Bacteria 1657
719 nmdc:mga0n895_522323_c1 3300050512 Bacteria 1195
720 nmdc:mga0a205_609786_c1 3300050515 Bacteria 944
721 nmdc:mga0sz30_160298_c1 3300050516 Bacteria 996
722 nmdc:mga0sz30_68131_c1 3300050516 Bacteria 1529
723 Ga0495601_0093591 3300053077 Bacteria 1936
724 Ga0495601_0102445 3300053077 Bacteria 1850
725 Ga0495601_0120435 3300053077 Bacteria 1704
726 Ga0495601_0159499 3300053077 Bacteria 1474
727 Ga0495601_0335973 3300053077 Bacteria 983
728 Ga0495612_0025173 3300053078 Bacteria 2390
729 Ga0495612_0068936 3300053078 Bacteria 1472
730 Ga0495612_0104254 3300053078 Bacteria 1209
731 Ga0500610_0157056 3300053079 Bacteria 1135
732 Ga0495595_0014681 3300053084 Bacteria 3327
733 Ga0495619_0133206 3300053085 Bacteria 1708
734 Ga0500644_0016601 3300053088 Bacteria 2122
735 Ga0500581_009902 3300053089 Bacteria 4641
736 Ga0500646_0007937 3300053090 Bacteria 2713
737 Ga0500646_0115030 3300053090 Bacteria 859
738 Ga0500651_0013204 3300053093 Bacteria 5025
739 Ga0500651_0083718 3300053093 Bacteria 1973
740 Ga0500566_0003149 3300053094 Bacteria 9863
741 Ga0500566_0003239 3300053094 Bacteria 9733
742 Ga0500641_0009505 3300053096 Bacteria 3497
743 Ga0500641_0012470 3300053096 Bacteria 3105
744 Ga0500641_0024204 3300053096 Bacteria 2340
745 Ga0500641_0057206 3300053096 Bacteria 1617
746 Ga0500650_0000457 3300053098 Bacteria 10189
747 Ga0500654_095735 3300053099 Bacteria 1295
748 Ga0500554_086564 3300053102 Bacteria 1037
749 Ga0500556_0000004 3300053104 Bacteria 666287
750 Ga0500562_035843 3300053108 Bacteria 1314
751 Ga0500562_080116 3300053108 Bacteria 883
752 Ga0500569_075886 3300053109 Bacteria 1066
753 Ga0500595_000288 3300053119 Bacteria 33340
754 Ga0500595_037450 3300053119 Bacteria 1582
755 Ga0500607_073079 3300053121 Bacteria 1766
756 Ga0500608_000601 3300053122 Bacteria 13257
757 Ga0500618_043835 3300053125 Bacteria 1022
758 Ga0500642_0000010 3300053130 Bacteria 272552
759 Ga0500652_000063 3300053131 Bacteria 46678
760 Ga0500559_0000771 3300053136 Bacteria 21011
761 Ga0500568_0000568 3300053139 Bacteria 27062
762 Ga0500577_0081110 3300053142 Bacteria 1294
763 Ga0500586_015813 3300053145 Bacteria 2275
764 Ga0500603_098707 3300053150 Bacteria 865
765 Ga0500604_0016452 3300053151 Bacteria 2037
766 Ga0500616_0000014 3300053153 Bacteria 637918
767 Ga0500622_0000266 3300053156 Bacteria 53524
768 Ga0500627_0099788 3300053158 Bacteria 1303
769 Ga0500636_0002893 3300053177 Bacteria 9605
770 Ga0500636_0018555 3300053177 Bacteria 4113
771 Ga0500637_0000257 3300053178 Bacteria 19771
772 Ga0501084_0004368 3300054114 Bacteria 11522
773 Ga0501084_0153767 3300054114 Bacteria 1940
774 Ga0500661_000491 3300055283 Bacteria 7332
775 Ga0501082_0000013 3300060353 Bacteria 119623
776 Ga0501082_0050924 3300060353 Bacteria 3570
777 Ga0501082_0318770 3300060353 Bacteria 1354
778 Ga0501082_0395032 3300060353 Bacteria 1207
779 Ga0530510_0030815 3300061734 Bacteria 3854
780 2513654335 2513237096 Bacteria 8722461
781 2513675590 2513237098 Bacteria 9902361
782 2513706241 2513237102 Bacteria 7703324
783 2513863732 2513237137 Bacteria 9558895
784 2513894313 2513237141 Bacteria 8496279
785 2513915486 2513237145 Bacteria 8979722
786 2517892816 2517572143 Bacteria 9484767
787 2524464264 2524023210 Bacteria 9029266
788 2524538037 2524023228 Bacteria 10118060
789 2603859185 2602042107 Bacteria 6226103
790 2671117505 2667528175 Bacteria 7532676
791 2728750661 2728368998 Bacteria 8720350
792 2793068222 2791355197 Bacteria 8420563
793 2857527764 2857524615 Bacteria 6615449
794 2874616123 2874612657 Bacteria 8252029
795 2885381210 2885374607 Bacteria 8927485
796 2885385542 2885383462 Bacteria 9473874
797 2903750511 2903748898 Bacteria 9972761
798 2903769155 2903768456 Bacteria 9749579
799 2904696125 2904690495 Bacteria 9412302
800 2904702944
801 2906618195
802 2906642503 2906635258 Bacteria 8601019
803 2906664271 2906660503 Bacteria 8595048
804 2908743209 2908739725 Bacteria 8628932
805 2908760759 2908756301 Bacteria 8864324
806 2919079460 2919073203 Bacteria 6531949
807 2922429863
808 2935633514 2935630451 Bacteria 8169952
809 2941510405 2941507105 Bacteria 8166816
810 2941517858 2941515067 Bacteria 8166720
811 2941525874 2941523033 Bacteria 8169134
812 3005479789 3005474847 Bacteria 9259049
813 8006940920 8006933436 Bacteria 10410654
814 8006980887 8006973647 Bacteria 10679141
815 8019557222 8019555841 Bacteria 9642137
816 8019568081 8019565922 Bacteria 9639779
817 8056688125 8056681323 Bacteria 8472857
818 8056693777 8056689827 Bacteria 6712655
819 Ga0068862_100157974
820 rootH2_10076015
821 Ga0055542_1006016
822 Ga0070676_10218423
823 Ga0070683_100296116
824 Ga0070670_100089893
825 Ga0070670_100166994
826 Ga0068869_100098704
827 Ga0068869_100484951
828 Ga0070666_10340540
829 Ga0070680_100061352
830 Ga0070682_100754754
831 Ga0070660_100041315
832 Ga0070660_100633548
833 Ga0070689_100240507
834 Ga0070687_100272142
835 Ga0070668_100145080
836 Ga0070669_100170228
837 Ga0070669_100509585
838 Ga0070671_100106369
839 Ga0070671_100188945
840 Ga0070674_100065598
841 Ga0070674_100154195
842 Ga0070674_100169634
843 Ga0070659_100637870
844 Ga0070659_100706938
845 Ga0070667_100217304
846 Ga0070709_10014997
847 Ga0070709_10040822
848 Ga0070709_10046110
849 Ga0070714_100064491
850 Ga0070714_100090193
851 Ga0070714_100195539
852 Ga0070713_100023071
853 Ga0070713_100079441
854 Ga0070713_100420194
855 Ga0070713_100428263
856 Ga0070713_100632964
857 Ga0070713_100882993
858 Ga0070710_10000719
859 Ga0070710_10136397
860 Ga0070701_10188289
861 Ga0070711_100005516
862 Ga0070711_100005598
863 Ga0070700_100034582
864 Ga0070694_100250475
865 Ga0070694_100581591
866 Ga0070708_100081752
867 Ga0070663_100008568
868 Ga0070663_100098071
869 Ga0070663_100281889
870 Ga0070662_100172927
871 Ga0070681_10070438
872 Ga0068867_100015478
873 Ga0070685_10082592
874 Ga0070698_100198060
875 Ga0070698_100212834
876 Ga0070699_100049973
877 Ga0070679_100023003
878 Ga0070679_100314386
879 Ga0070679_100733087
880 Ga0070684_100021420
881 Ga0070684_100039811
882 Ga0070697_100034413
883 Ga0070697_100538129
884 Ga0068853_100070494
885 Ga0068853_100422140
886 Ga0068853_100429611
887 Ga0070672_100023017
888 Ga0070672_100415452
889 Ga0070686_100183597
890 Ga0070695_100463791
891 Ga0070696_100181143
892 Ga0070693_100099247
893 Ga0070665_100004313
894 Ga0070665_100085944
895 Ga0070665_100441579
896 Ga0068855_100074693
897 Ga0068855_100095746
898 Ga0068857_100033813
899 Ga0068857_100241298
900 Ga0068857_100365679
901 Ga0068857_100878774
902 Ga0068854_100348232
903 Ga0068856_100038009
904 Ga0068856_100248991
905 Ga0070702_100057467
906 Ga0070702_100505071
907 Ga0068852_100870921
908 Ga0068859_100150199
909 Ga0068864_100022753
910 Ga0068866_10018371
911 Ga0068866_10066810
912 Ga0068866_10268389
913 Ga0068861_100046124
914 Ga0068863_100636916
915 Ga0068858_100108729
916 Ga0068858_100877869
917 Ga0068860_100155482
918 Ga0068862_100432842
919 Ga0081455_10075918
920 Ga0081540_1003549
921 Ga0081540_1005852
922 Ga0081540_1055888
923 Ga0081539_10000080
924 Ga0081539_10004945
925 Ga0070717_10015214
926 Ga0070717_10069526
927 Ga0070717_10239746
928 Ga0070717_10333212
929 Ga0070717_10377875
930 Ga0075365_10035263
931 Ga0075365_10044807
932 Ga0075365_10074316
933 Ga0075365_10123017
934 Ga0075365_10175145
935 Ga0075365_10205234
936 Ga0075365_10608802
937 Ga0075368_10036222
938 Ga0075368_10039256
939 Ga0075368_10102999
940 Ga0075363_100000857
941 Ga0075363_100001412
942 Ga0075363_100019080
943 Ga0075363_100028323
944 Ga0075363_100213566
945 Ga0075364_10113322
946 Ga0075364_10147991
947 Ga0075364_10158960
948 Ga0075364_10234358
949 Ga0075364_10347855
950 Ga0070715_10278708
951 Ga0070716_100005361
952 Ga0070716_100034275
953 Ga0070716_100092118
954 Ga0070716_100114698
955 Ga0070716_100260367
956 Ga0070712_100010082
957 Ga0075362_10008259
958 Ga0075362_10144480
959 Ga0075362_10151521
960 Ga0075362_10222216
961 Ga0075362_10232966
962 Ga0075367_10093749
963 Ga0075367_10127856
964 Ga0075367_10156398
965 Ga0075367_10210676
966 Ga0075367_10239991
967 Ga0075369_10053682
968 Ga0075369_10085957
969 Ga0075369_10092749
970 Ga0075369_10137322
971 Ga0075366_10000395
972 Ga0075366_10047379
973 Ga0075366_10048755
974 Ga0075366_10179498
975 Ga0075366_10339205
976 Ga0097621_100102466
977 Ga0075370_10030843
978 Ga0075428_100478622
979 Ga0075433_10430829
980 Ga0075434_100080217
981 Ga0075434_100547675
982 Ga0068865_100289609
983 Ga0075436_100305500
984 Ga0075436_100452667
985 Ga0097620_100150198
986 Ga0099824_1011629
987 Ga0099822_1000949
988 Ga0075435_100051318
989 Ga0099794_10005736
990 Ga0099794_10126763
991 Ga0099795_10015254
992 Ga0099795_10144120
993 Ga0099795_10146058
994 Ga0105240_10011857
995 Ga0105240_10088795
996 Ga0105240_10592127
997 Ga0111539_10096406
998 Ga0111539_10662840
999 Ga0105245_10049278
1000 Ga0105245_10091678
1001 Ga0105245_10463719
1002 Ga0105245_10706136
1003 Ga0114129_10148400
1004 Ga0114129_11633049
1005 Ga0105243_10827095
1006 Ga0105241_10066654
1007 Ga0105248_10044100
1008 Ga0105248_10784156
1009 Ga0105237_10430709
1010 Ga0105238_10160641
1011 Ga0105249_10194106
1012 Ga0105249_10651790
1013 Ga0099796_10047202
1014 Ga0105239_10238043
1015 Ga0105239_10327435
1016 Ga0157373_10038216
1017 Ga0157370_10016953
1018 Ga0157369_10005882
1019 Ga0157369_10274217
1020 Ga0157374_10111864
1021 Ga0163162_10283551
1022 Ga0157375_10282907
1023 Ga0157375_10719323
1024 Ga0163163_10290836
1025 Ga0163163_10311487
1026 Ga0163163_10661067
1027 Ga0163163_11136458
1028 Ga0157380_10701963
1029 Ga0157380_10793269
1030 Ga0157380_11179883
1031 Ga0157379_10116830
1032 Ga0157379_10138693
1033 Ga0157379_10455227
1034 Ga0157376_10045991
1035 Ga0157376_10083178
1036 Ga0157376_10564367
1037 Ga0163161_10034729
1038 Ga0163161_10161909
1039 Ga0163161_10275230
1040 Ga0163161_10501570
1041 Ga0206356_10868155
1042 Ga0206353_10329655
1043 Ga0213876_10058680
1044 Ga0213875_10000012
1045 Ga0224712_10084737
1046 Ga0209677_100482
1047 Ga0209148_1000263
1048 Ga0209233_1001276
1049 Ga0209455_1000262
1050 Ga0209455_1003361
1051 Ga0209455_1003722
1052 Ga0209564_1019149
1053 Ga0209758_1027776
1054 Ga0207682_10001464
1055 Ga0207692_10005609
1056 Ga0207692_10025067
1057 Ga0207692_10053358
1058 Ga0207642_10051501
1059 Ga0207642_10220618
1060 Ga0207710_10105571
1061 Ga0207688_10063288
1062 Ga0207688_10121134
1063 Ga0207680_10228259
1064 Ga0207699_10013687
1065 Ga0207699_10213412
1066 Ga0207699_10321744
1067 Ga0207645_10221419
1068 Ga0207645_10263463
1069 Ga0207643_10023724
1070 Ga0207707_10031316
1071 Ga0207707_10043801
1072 Ga0207707_10234506
1073 Ga0207707_10259359
1074 Ga0207695_10019824
1075 Ga0207695_10196348
1076 Ga0207671_10037370
1077 Ga0207671_10263880
1078 Ga0207671_10716011
1079 Ga0207693_10003782
1080 Ga0207693_10074933
1081 Ga0207693_10191026
1082 Ga0207693_10397699
1083 Ga0207663_10000453
1084 Ga0207663_10004390
1085 Ga0207663_10082687
1086 Ga0207663_10199844
1087 Ga0207660_10311516
1088 Ga0207662_10017388
1089 Ga0207662_10086852
1090 Ga0207657_10005543
1091 Ga0207649_10050030
1092 Ga0207652_10029677
1093 Ga0207652_10085816
1094 Ga0207681_10205725
1095 Ga0207694_10194580
1096 Ga0207694_10246626
1097 Ga0207650_10165621
1098 Ga0207650_10637655
1099 Ga0207687_10082586
1100 Ga0207700_10014019
1101 Ga0207700_10030154
1102 Ga0207700_10034731
1103 Ga0207700_10523589
1104 Ga0207664_10031526
1105 Ga0207664_10158833
1106 Ga0207664_10392636
1107 Ga0207664_10417282
1108 Ga0207644_10067731
1109 Ga0207644_10140064
1110 Ga0207644_10201862
1111 Ga0207690_10312218
1112 Ga0207706_10086952
1113 Ga0207706_10099286
1114 Ga0207709_10041095
1115 Ga0207670_10477219
1116 Ga0207669_10012191
1117 Ga0207669_10840005
1118 Ga0207704_10421923
1119 Ga0207665_10000724
1120 Ga0207665_10003173
1121 Ga0207665_10056079
1122 Ga0207665_10136022
1123 Ga0207665_10294665
1124 Ga0207665_10501016
1125 Ga0207665_10644051
1126 Ga0207691_10042135
1127 Ga0207691_10258425
1128 Ga0207689_10021327
1129 Ga0207689_10136196
1130 Ga0207661_10049430
1131 Ga0207661_10470274
1132 Ga0207679_10242520
1133 Ga0207712_10049944
1134 Ga0207668_10300659
1135 Ga0207668_10300963
1136 Ga0207640_10213556
1137 Ga0207658_10562117
1138 Ga0207703_10020295
1139 Ga0207703_10172657
1140 Ga0207639_10076451
1141 Ga0207639_10152666
1142 Ga0207639_10443454
1143 Ga0207678_10017116
1144 Ga0207678_10056581
1145 Ga0207708_10132349
1146 Ga0207708_10247704
1147 Ga0207702_10003187
1148 Ga0207702_10095974
1149 Ga0207641_10523011
1150 Ga0207648_10013660
1151 Ga0207648_10020006
1152 Ga0207648_10229603
1153 Ga0207676_10005646
1154 Ga0207676_10146224
1155 Ga0207674_10059417
1156 Ga0207674_10220649
1157 Ga0207674_10642121
1158 Ga0207675_100062108
1159 Ga0207675_100664793
1160 Ga0207683_10010073
1161 Ga0207683_10022911
1162 Ga0207698_10189086
1163 Ga0207698_10252145
1164 Ga0209589_1000003
1165 Ga0209489_100003
1166 Ga0209700_100003
1167 Ga0209981_1004107
1168 Ga0209984_1008400
1169 Ga0210000_1005188
1170 Ga0209999_1001396
1171 Ga0209983_1013455
1172 Ga0209588_1054156
1173 Ga0209971_1023614
1174 Ga0209974_10007791
1175 Ga0207428_10480303
1176 Ga0268266_10005823
1177 Ga0268266_10013089
1178 Ga0268266_10136043
1179 Ga0268266_10292962
1180 Ga0268264_10179036
1181 Ga0268264_10288713
1182 Ga0307517_10000053
1183 Ga0307517_10254788
1184 Ga0307515_10172878
1185 Ga0307515_10536420
1186 Ga0265325_10044236
1187 Ga0265340_10030899
1188 Ga0265339_10016659
1189 Ga0265339_10088631
1190 Ga0265331_10028279
1191 Ga0265316_10217016
1192 Ga0265316_10233075
1193 Ga0307513_10108813
1194 Ga0307513_10136315
1195 Ga0307513_10203968
1196 Ga0307509_10047750
1197 Ga0307508_10050635
1198 Ga0265314_10011848
1199 Ga0265314_10028730
1200 Ga0265342_10021476
1201 Ga0265342_10053626
1202 Ga0307405_10281962
1203 Ga0307405_10380607
1204 Ga0307406_10173704
1205 Ga0307406_10452083
1206 Ga0307411_10639857
1207 Ga0307415_100097181
1208 Ga0307415_100226943
1209 Ga0307510_10035900
1210 Ga0315911_1000001
1211 Ga0316215_1004414
1212 Ga0373934_0222232
1213 Ga0373944_0039913
1214 Ga0373923_0006085
1215 Ga0373923_0009457
1216 Ga0373936_0003582
1217 Ga0373945_0029162
1218 Ga0373953_0173261
1219 Ga0373954_0023399
1220 Ga0373943_0209265
1221 Ga0373955_0035043
1222 Ga0373955_0088693
1223 Ga0373924_0040875
1224 Ga0373927_0072694
1225 Ga0373927_0096712
1226 Ga0373927_0244471
1227 Ga0373927_0273273
1228 Ga0373927_0507618
1229 Ga0373933_0203406
1230 Ga0373947_0016882
1231 Ga0373947_0021843
1232 Ga0373947_0142152
1233 Ga0373937_0052926
1234 Ga0373937_0772932
1235 Ga0372808_013295
1236 Ga0373925_0042684
1237 Ga0373925_0073227
1238 Ga0373925_0377760
1239 Ga0373925_0575710
1240 Ga0395899_0264209
1241 Ga0395900_0021204
1242 Ga0395898_0041898
1243 Ga0395898_0108054
1244 Ga0395898_0190092
1245 Ga0395905_0602470
1246 Ga0395905_0790158
1247 Ga0436364_0553890
1248 Ga0436364_1182827
1249 Ga0395901_0026797
1250 Ga0395901_0203414
1251 Ga0436365_0311489
1252 Ga0436365_0705278
1253 Ga0436365_0983494
1254 Ga0436365_1036097
1255 Ga0436365_1883528
1256 Ga0436360_1376244
1257 Ga0436361_0725531
1258 Ga0436361_0771252
1259 Ga0436363_0838211
1260 Ga0439459_0015121
1261 Ga0466969_0211805
1262 Ga0466966_0137609
1263 Ga0466957_0177072
1264 Ga0466967_0553658
1265 Ga0495617_003916
1266 Ga0495603_0051759
1267 Ga0495603_0054526
1268 Ga0495603_0115356
1269 Ga0495590_0103148
1270 Ga0495629_0051829
1271 Ga0495629_0056543
1272 Ga0495629_0091841
1273 Ga0495638_0019222
1274 Ga0495638_0052894
1275 Ga0495638_0061589
1276 Ga0495641_0087145
1277 Ga0495651_0033637
1278 Ga0495651_0067221
1279 Ga0495651_0068037
1280 Ga0495653_0086572
1281 Ga0495653_0218512
1282 Ga0495580_0066957
1283 Ga0495580_0145636
1284 Ga0495605_0067404
1285 Ga0495639_0016126
1286 Ga0495664_0036962
1287 Ga0495664_0058635
1288 Ga0495585_0044904
1289 Ga0495594_0085892
1290 Ga0495594_0181153
1291 Ga0495596_0033908
1292 Ga0495606_0002525
1293 Ga0495606_0071605
1294 Ga0495608_0081096
1295 Ga0495608_0131609
1296 Ga0495616_0063583
1297 Ga0495616_0109173
1298 Ga0495618_0071751
1299 Ga0495618_0209145
1300 Ga0495630_0060518
1301 Ga0495630_0068005
1302 Ga0495631_0034806
1303 Ga0495631_0141539
1304 Ga0495631_0251081
1305 Ga0495643_0270869
1306 Ga0495648_0005048
1307 Ga0495648_0032770
1308 Ga0495663_0015429
1309 Ga0495652_0124731
1310 Ga0495654_0008348
1311 Ga0495654_0086196
1312 Ga0495665_0008224
1313 Ga0495665_0192300
1314 Ga0495586_0437125
1315 Ga0495587_0049969
1316 Ga0495609_0055884
1317 Ga0495621_0017202
1318 Ga0495645_0070955
1319 Ga0495645_0073494
1320 Ga0495645_0178951
1321 Ga0495622_0023358
1322 Ga0495667_0166671
1323 Ga0495667_0228305
1324 Ga0495667_0241127
1325 Ga0495656_0010368
1326 Ga0495656_0060017
1327 Ga0495668_0020113
1328 Ga0495668_0203059
1329 Ga0495668_0272650
1330 Ga0495668_0440665
1331 Ga0495634_0207195
1332 Ga0495625_0177540
1333 Ga0495625_0250052
1334 Ga0495635_0014444
1335 Ga0495635_0321007
1336 Ga0495659_0106251
1337 Ga0495661_0054343
1338 Ga0495588_0079625
1339 Ga0495657_0185379
1340 Ga0495599_0055815
1341 Ga0495623_0170952
1342 Ga0495623_0184382
1343 Ga0495646_0034935
1344 Ga0495647_0047169
1345 Ga0495658_0013531
1346 Ga0495669_0013819
1347 Ga0495624_0131629
1348 Ga0495624_0206334
1349 Ga0495670_0001196
1350 Ga0495670_0178381
1351 Ga0495589_0046558
1352 Ga0495600_0165454
1353 Ga0495581_0230894
1354 Ga0495604_0037770
1355 Ga0495604_0392252
1356 Ga0495674_0020210
1357 Ga0495674_0301564
1358 Ga0495674_0364741
1359 Ga0495672_0043987
1360 Ga0495672_0120121
1361 Ga0495676_0250266
1362 Ga0495680_0168631
1363 Ga0495675_0014847
1364 Ga0495675_0307475
1365 Ga0495677_0039196
1366 Ga0495684_0002390
1367 Ga0495684_0056123
1368 Ga0495684_0180303
1369 Ga0495593_0031583
1370 Ga0495593_0051191
1371 Ga0495602_0146322
1372 Ga0495615_0038933
1373 Ga0495626_0134938
1374 Ga0496100_0023500
1375 Ga0496101_0027031
1376 Ga0496101_0113865
1377 Ga0496101_0174399
1378 Ga0496102_0071229
1379 Ga0496102_0092337
1380 Ga0496102_0177314
1381 Ga0496102_0291848
1382 Ga0496102_0550750
1383 Ga0496102_0748973
1384 Ga0496102_0848150
1385 Ga0496103_0371815
1386 Ga0496106_0024811
1387 Ga0496106_0126932
1388 Ga0496106_0132600
1389 Ga0496106_0152890
1390 Ga0496106_0173957
1391 Ga0496107_0022356
1392 Ga0496107_0029798
1393 Ga0496107_0346365
1394 Ga0496107_0355698
1395 Ga0496108_0027140
1396 Ga0496108_0083271
1397 Ga0496108_0746354
1398 Ga0496109_0035385
1399 Ga0496109_0100854
1400 Ga0496109_0620667
1401 Ga0496109_0853011
1402 Ga0496110_0252757
1403 Ga0496112_0166789
1404 Ga0496112_0223971
1405 Ga0496113_0104297
1406 Ga0496114_0149296
1407 Ga0496114_0762243
1408 Ga0496115_0154658
1409 Ga0496115_0292677
1410 Ga0496116_0055851
1411 Ga0496117_0065330
1412 Ga0496118_0078834
1413 Ga0496118_0080407
1414 Ga0496118_0190453
1415 Ga0496118_0246541
1416 Ga0496119_0032051
1417 Ga0496119_0090363
1418 Ga0496120_0151111
1419 Ga0496121_0032695
1420 Ga0496121_0042321
1421 Ga0496121_0049129
1422 Ga0496121_0050241
1423 Ga0496121_0085855
1424 Ga0496121_0109084
1425 Ga0496121_0133801
1426 Ga0496121_0181225
1427 Ga0496122_0032976
1428 Ga0496122_0162249
1429 Ga0496123_0015802
1430 Ga0496124_0329862
1431 Ga0496125_0000193
1432 Ga0496125_0001951
1433 Ga0496125_0004313
1434 Ga0496125_0007113
1435 Ga0496125_0105863
1436 Ga0496125_0133625
1437 Ga0496126_0011403
1438 Ga0496126_0014868
1439 Ga0496126_0016239
1440 Ga0496126_0157546
1441 Ga0496126_0164511
1442 Ga0496126_0196462
1443 Ga0496126_0368824
1444 Ga0496126_0389590
1445 Ga0501031_0009842
1446 Ga0501031_0041296
1447 Ga0501032_0000054
1448 Ga0501033_0000025
1449 Ga0501033_0094671
1450 Ga0501034_0000177
1451 Ga0501036_0000025
1452 Ga0501036_0111982
1453 Ga0501037_0000169
1454 Ga0501038_0000029
1455 Ga0501039_0001169
1456 Ga0501039_0036848
1457 Ga0501039_0071587
1458 Ga0501040_0458444
1459 Ga0501041_0183487
1460 Ga0501042_0018160
1461 Ga0501042_0052159
1462 Ga0501042_0172225
1463 Ga0501043_0000176
1464 Ga0501046_0000556
1465 Ga0501046_0076335
1466 Ga0501046_0093877
1467 Ga0501047_0000061
1468 Ga0501047_0067326
1469 Ga0501047_0160825
1470 Ga0501048_0000277
1471 Ga0501048_0145985
1472 Ga0501067_0000726
1473 Ga0501068_0001909
1474 Ga0501068_0526450
1475 Ga0501069_0149567
1476 Ga0501069_0247051
1477 Ga0501070_0007106
1478 Ga0501070_0024345
1479 Ga0501070_0089836
1480 Ga0501071_0086404
1481 Ga0501071_0192927
1482 Ga0501072_0004578
1483 Ga0501072_0192657
1484 Ga0501073_0000156
1485 Ga0501074_0000605
1486 Ga0501075_0014324
1487 Ga0501076_0069366
1488 Ga0501076_0143784
1489 Ga0501076_0295335
1490 Ga0501076_0297349
1491 Ga0501076_0482497
1492 Ga0501077_0181128
1493 Ga0501079_0014710
1494 Ga0501079_0074440
1495 Ga0501079_0130830
1496 Ga0501079_0650208
1497 Ga0501080_0014702
1498 Ga0501080_0166411
1499 Ga0501080_0565699
1500 Ga0501081_0172075
1501 Ga0501083_0001694
1502 Ga0501035_0001729
1503 Ga0501044_0000028
1504 Ga0501044_0395938
1505 Ga0501044_0524339
1506 Ga0501045_0007158
1507 nmdc:mga03683_121523_c1
1508 nmdc:mga03683_197064_c1
1509 nmdc:mga03683_83394_c1
1510 nmdc:mga03n38_32731_c1
1511 nmdc:mga03n38_404_c1
1512 nmdc:mga00v17_223020_c1
1513 nmdc:mga00v17_245934_c1
1514 nmdc:mga00v17_90789_c1
1515 nmdc:mga0yw44_222553_c1
1516 nmdc:mga0yw44_22793_c1
1517 nmdc:mga0yw44_265040_c1
1518 nmdc:mga0yw44_306529_c1
1519 nmdc:mga0yw44_330974_c1
1520 nmdc:mga0yw44_47969_c1
1521 nmdc:mga0yw44_565281_c1
1522 nmdc:mga0k408_169344_c1
1523 nmdc:mga0k408_250448_c1
1524 nmdc:mga06z11_402750_c1
1525 nmdc:mga06z11_7555_c1
1526 nmdc:mga06z11_95067_c1
1527 nmdc:mga06z11_97015_c1
1528 nmdc:mga07m45_10981_c1
1529 nmdc:mga07m45_126421_c1
1530 nmdc:mga07m45_79355_c1
1531 nmdc:mga07m45_81011_c1
1532 nmdc:mga05p37_316492_c1
1533 nmdc:mga08y16_112482_c1
1534 nmdc:mga08y16_740102_c1
1535 nmdc:mga08y16_89055_c1
1536 nmdc:mga0n895_290751_c1
1537 nmdc:mga0n895_522323_c1
1538 nmdc:mga0a205_609786_c1
1539 nmdc:mga0sz30_160298_c1
1540 nmdc:mga0sz30_68131_c1
1541 Ga0495601_0093591
1542 Ga0495601_0102445
1543 Ga0495601_0120435
1544 Ga0495601_0159499
1545 Ga0495601_0335973
1546 Ga0495612_0025173
1547 Ga0495612_0068936
1548 Ga0495612_0104254
1549 Ga0500610_0157056
1550 Ga0495595_0014681
1551 Ga0495619_0133206
1552 Ga0500644_0016601
1553 Ga0500581_009902
1554 Ga0500646_0007937
1555 Ga0500646_0115030
1556 Ga0500651_0013204
1557 Ga0500651_0083718
1558 Ga0500566_0003149
1559 Ga0500566_0003239
1560 Ga0500641_0009505
1561 Ga0500641_0012470
1562 Ga0500641_0024204
1563 Ga0500641_0057206
1564 Ga0500650_0000457
1565 Ga0500654_095735
1566 Ga0500554_086564
1567 Ga0500556_0000004
1568 Ga0500562_035843
1569 Ga0500562_080116
1570 Ga0500569_075886
1571 Ga0500595_000288
1572 Ga0500595_037450
1573 Ga0500607_073079
1574 Ga0500608_000601
1575 Ga0500618_043835
1576 Ga0500642_0000010
1577 Ga0500652_000063
1578 Ga0500559_0000771
1579 Ga0500568_0000568
1580 Ga0500577_0081110
1581 Ga0500586_015813
1582 Ga0500603_098707
1583 Ga0500604_0016452
1584 Ga0500616_0000014
1585 Ga0500622_0000266
1586 Ga0500627_0099788
1587 Ga0500636_0002893
1588 Ga0500636_0018555
1589 Ga0500637_0000257
1590 Ga0501084_0004368
1591 Ga0501084_0153767
1592 Ga0500661_000491
1593 Ga0501082_0000013
1594 Ga0501082_0050924
1595 Ga0501082_0318770
1596 Ga0501082_0395032
1597 Ga0530510_0030815
1598 2513654335
1599 2513675590
1600 2513706241
1601 2513863732
1602 2513894313
1603 2513915486
1604 2517892816
1605 2524464264
1606 2524538037
1607 2603859185
1608 2671117505
1609 2728750661
1610 2793068222
1611 2857527764
1612 2874616123
1613 2885381210
1614 2885385542
1615 2903750511
1616 2903769155
1617 2904696125
1618 2904702944
1619 2906618195
1620 2906642503
1621 2906664271
1622 2908743209
1623 2908760759
1624 2919079460
1625 2922429863
1626 2935633514
1627 2941510405
1628 2941517858
1629 2941525874
1630 3005479789
1631 8006940920
1632 8006980887
1633 8019557222
1634 8019568081
1635 8056688125
1636 8056693777

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02211

NHase_beta_C

Nitrile hydratase beta subunit, C-terminal

149

246

0.98

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

29

144

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6th6-assembly1.cif.gz_BU cryo-em structure of t. kodakarensis 70s ribosome 0.8143 130 219
6hum-assembly1.cif.gz_S structure of the photosynthetic complex i from thermosynechococcus elongatus 0.8096 132 219
8i9p-assembly1.cif.gz_LT cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state mak16 0.7986 130 219
4v6u-assembly1.cif.gz_BR promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.7966 130 219
2dd4-assembly1.cif.gz_G thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme 0.7942 107 219
ID Description Score Start End Superfamily
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9573 124 219 2.30.30.50
4ob3B02 Mainly Beta;Roll;SH3 type barrels.; 0.9567 123 218 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9526 123 219 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9378 124 219 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9338 123 219 2.30.30.50
ID Description Score Start End GO Terms
AF-A0A527ZDG4-F1-model_v4 Nitrile hydratase subunit beta 0.9772 153 219
AF-A0A7C5KQH9-F1-model_v4 Nitrile hydratase subunit beta 0.9758 133 217
AF-A0A2A4ZLD0-F1-model_v4 deleted 0.9744 135 219
AF-A0A436LRJ0-F1-model_v4 deleted 0.9691 124 219
AF-A0A523CYD7-F1-model_v4 Nitrile hydratase subunit beta 0.9677 142 219

Map