F482128

General Info

Members Datasets Scaffolds Average Seq Length
818 267 1636 218

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_11277719|Ga0157372_112777191
Length 238
Sequence VAPRPGPRAVPLHLNRPAATANPRYAAIAWPWAILILAVALVGQELLLQWLGAQPALTEAVYRVFVMTLGVASLALILLPPRRAAYALGFLVCAALMGWAFWLQYGEGLEPCPLCMFQRVCVTLVGLVFLIAAIQNPGRRGAAFYAVLTLIIAGAGAGFAARQIWLQALPKDQVPACGMGLSYMMETLPFTAVITKVLEGSGECAEKGWVFLGLSIAGWTFVFFASMIVAAIALVRRN

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.03
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_11277719 3300013307 Bacteria 847
2 MBSR1b_contig_7533592 2162886012 Bacteria 823
3 JGI24752J21851_1001377 3300001976 Bacteria 3283
4 Ga0065715_10365726 3300005293 Bacteria 928
5 Ga0065707_10399275 3300005295 Unclassified 855
6 Ga0070658_10016270 3300005327 Bacteria 5952
7 Ga0070658_10017045 3300005327 Bacteria 5813
8 Ga0070658_10372187 3300005327 Bacteria 1225
9 Ga0070676_10000182 3300005328 Bacteria 25951
10 Ga0070676_10002074 3300005328 Bacteria 10197
11 Ga0070676_10195465 3300005328 Bacteria 1323
12 Ga0070683_100016286 3300005329 Bacteria 6554
13 Ga0070683_100034928 3300005329 Bacteria 4595
14 Ga0070683_100087651 3300005329 Bacteria 2920
15 Ga0070683_100224800 3300005329 Bacteria 1784
16 Ga0070670_100009688 3300005331 Bacteria 8225
17 Ga0070670_100017962 3300005331 Bacteria 6071
18 Ga0070670_100036657 3300005331 Bacteria 4220
19 Ga0070670_100385135 3300005331 Bacteria 1236
20 Ga0070677_10000256 3300005333 Bacteria 18377
21 Ga0070677_10020813 3300005333 Bacteria 2396
22 Ga0070677_10069081 3300005333 Bacteria 1481
23 Ga0068869_100004324 3300005334 Bacteria 8820
24 Ga0068869_100005961 3300005334 Bacteria 7705
25 Ga0068869_100038352 3300005334 Bacteria 3414
26 Ga0068869_100061458 3300005334 Bacteria 2756
27 Ga0070666_10002668 3300005335 Bacteria 10756
28 Ga0070666_10003882 3300005335 Bacteria 9078
29 Ga0070666_10035199 3300005335 Bacteria 3320
30 Ga0070666_10061053 3300005335 Bacteria 2552
31 Ga0070666_10113109 3300005335 Unclassified 1878
32 Ga0070666_10129578 3300005335 Bacteria 1752
33 Ga0070680_100002253 3300005336 Bacteria 14249
34 Ga0070680_100120492 3300005336 Bacteria 2190
35 Ga0068868_100006724 3300005338 Bacteria 8162
36 Ga0068868_100012434 3300005338 Bacteria 6223
37 Ga0068868_100049715 3300005338 Bacteria 3291
38 Ga0070660_100003821 3300005339 Bacteria 10397
39 Ga0070660_100004427 3300005339 Bacteria 9703
40 Ga0070660_100006267 3300005339 Bacteria 8240
41 Ga0070660_100051071 3300005339 Bacteria 3183
42 Ga0070660_100311137 3300005339 Bacteria 1292
43 Ga0070660_100664624 3300005339 Unclassified 873
44 Ga0070689_100004517 3300005340 Bacteria 9424
45 Ga0070689_100005820 3300005340 Bacteria 8462
46 Ga0070689_100246079 3300005340 Bacteria 1474
47 Ga0070689_100644721 3300005340 Bacteria 921
48 Ga0070691_10146086 3300005341 Unclassified 1209
49 Ga0070691_10255867 3300005341 Bacteria 941
50 Ga0070687_100013968 3300005343 Bacteria 3596
51 Ga0070661_100002158 3300005344 Bacteria 13561
52 Ga0070661_100021794 3300005344 Bacteria 4583
53 Ga0070661_100033306 3300005344 Bacteria 3731
54 Ga0070661_100054334 3300005344 Bacteria 2933
55 Ga0070661_100134484 3300005344 Bacteria 1859
56 Ga0070661_100163088 3300005344 Bacteria 1689
57 Ga0070661_100432654 3300005344 Bacteria 1044
58 Ga0070692_10008867 3300005345 Bacteria 4507
59 Ga0070692_10015834 3300005345 Bacteria 3575
60 Ga0070668_100000885 3300005347 Bacteria 20829
61 Ga0070668_100013360 3300005347 Bacteria 6127
62 Ga0070668_100043291 3300005347 Bacteria 3453
63 Ga0070668_100087540 3300005347 Bacteria 2451
64 Ga0070668_100135341 3300005347 Bacteria 1981
65 Ga0070668_100174187 3300005347 Unclassified 1753
66 Ga0070668_100781199 3300005347 Unclassified 847
67 Ga0070668_101119648 3300005347 Bacteria 711
68 Ga0070669_100015256 3300005353 Bacteria 5473
69 Ga0070669_100042129 3300005353 Bacteria 3321
70 Ga0070669_100135590 3300005353 Unclassified 1893
71 Ga0070669_100224847 3300005353 Bacteria 1485
72 Ga0070675_100004518 3300005354 Bacteria 10627
73 Ga0070675_100010381 3300005354 Bacteria 7274
74 Ga0070675_100158792 3300005354 Bacteria 1943
75 Ga0070675_100504255 3300005354 Bacteria 1091
76 Ga0070671_100001003 3300005355 Bacteria 20771
77 Ga0070671_100004767 3300005355 Bacteria 10777
78 Ga0070671_100006314 3300005355 Bacteria 9454
79 Ga0070671_100008226 3300005355 Bacteria 8348
80 Ga0070671_100048487 3300005355 Bacteria 3532
81 Ga0070671_100273818 3300005355 Bacteria 1435
82 Ga0070674_100000292 3300005356 Bacteria 24601
83 Ga0070674_100019678 3300005356 Bacteria 4293
84 Ga0070674_100030679 3300005356 Bacteria 3555
85 Ga0070674_100058758 3300005356 Bacteria 2675
86 Ga0070674_100130009 3300005356 Bacteria 1876
87 Ga0070674_100387778 3300005356 Bacteria 1138
88 Ga0070673_100000524 3300005364 Bacteria 20589
89 Ga0070673_100003231 3300005364 Bacteria 10112
90 Ga0070673_100024227 3300005364 Bacteria 4447
91 Ga0070673_100417710 3300005364 Bacteria 1202
92 Ga0070688_100005749 3300005365 Bacteria 6555
93 Ga0070688_100124958 3300005365 Bacteria 1728
94 Ga0070688_100881963 3300005365 Bacteria 704
95 Ga0070659_100003785 3300005366 Bacteria 10800
96 Ga0070659_100007972 3300005366 Bacteria 7719
97 Ga0070659_100020663 3300005366 Bacteria 5005
98 Ga0070659_100042473 3300005366 Bacteria 3554
99 Ga0070659_100062709 3300005366 Bacteria 2939
100 Ga0070659_100146740 3300005366 Bacteria 1922
101 Ga0070659_100336812 3300005366 Bacteria 1263
102 Ga0070659_100628100 3300005366 Unclassified 925
103 Ga0070667_100001822 3300005367 Bacteria 18999
104 Ga0070667_100002304 3300005367 Bacteria 16773
105 Ga0070667_100011281 3300005367 Bacteria 7392
106 Ga0070667_100050832 3300005367 Bacteria 3493
107 Ga0070667_100066055 3300005367 Bacteria 3073
108 Ga0070667_100125547 3300005367 Bacteria 2236
109 Ga0070667_100128090 3300005367 Bacteria 2214
110 Ga0070667_100187306 3300005367 Bacteria 1832
111 Ga0070667_100437850 3300005367 Bacteria 1193
112 Ga0070667_100624739 3300005367 Bacteria 993
113 Ga0070667_100852884 3300005367 Bacteria 847
114 Ga0070709_10014355 3300005434 Bacteria 4479
115 Ga0070709_10277855 3300005434 Bacteria 1216
116 Ga0070714_100007422 3300005435 Bacteria 8530
117 Ga0070714_100112735 3300005435 Bacteria 2410
118 Ga0070714_100414548 3300005435 Bacteria 1275
119 Ga0070714_100440327 3300005435 Unclassified 1237
120 Ga0070714_100765934 3300005435 Bacteria 934
121 Ga0070713_100000650 3300005436 Bacteria 22227
122 Ga0070713_100158633 3300005436 Bacteria 2018
123 Ga0070710_10001177 3300005437 Bacteria 12347
124 Ga0070710_10063136 3300005437 Bacteria 2115
125 Ga0070701_10053280 3300005438 Bacteria 2105
126 Ga0070701_10504624 3300005438 Bacteria 786
127 Ga0070711_100000748 3300005439 Bacteria 16979
128 Ga0070711_100023345 3300005439 Unclassified 4020
129 Ga0070711_100043323 3300005439 Bacteria 3048
130 Ga0070711_100061869 3300005439 Bacteria 2607
131 Ga0070711_100474161 3300005439 Bacteria 1028
132 Ga0070705_100167421 3300005440 Bacteria 1475
133 Ga0070700_100059488 3300005441 Bacteria 2405
134 Ga0070700_100782812 3300005441 Bacteria 766
135 Ga0070708_100000884 3300005445 Bacteria 22658
136 Ga0070708_100137933 3300005445 Bacteria 2261
137 Ga0070708_100230215 3300005445 Bacteria 1739
138 Ga0070663_100019764 3300005455 Bacteria 4448
139 Ga0070663_100034046 3300005455 Bacteria 3525
140 Ga0070663_100379636 3300005455 Bacteria 1151
141 Ga0070678_100000527 3300005456 Bacteria 18574
142 Ga0070678_100001110 3300005456 Bacteria 14117
143 Ga0070678_100001363 3300005456 Bacteria 12983
144 Ga0070678_100146088 3300005456 Bacteria 1899
145 Ga0070678_100340222 3300005456 Bacteria 1287
146 Ga0070662_100002346 3300005457 Bacteria 11646
147 Ga0070662_100056089 3300005457 Bacteria 2860
148 Ga0070662_100060041 3300005457 Bacteria 2771
149 Ga0070681_10005791 3300005458 Bacteria 11956
150 Ga0070681_10093836 3300005458 Bacteria 2950
151 Ga0070681_10171472 3300005458 Bacteria 2091
152 Ga0070681_10971498 3300005458 Bacteria 769
153 Ga0068867_100002163 3300005459 Bacteria 13790
154 Ga0068867_100006353 3300005459 Bacteria 8353
155 Ga0068867_100033255 3300005459 Bacteria 3732
156 Ga0068867_100103675 3300005459 Bacteria 2176
157 Ga0068867_100281412 3300005459 Bacteria 1364
158 Ga0068867_100285970 3300005459 Bacteria 1354
159 Ga0068867_100951539 3300005459 Bacteria 776
160 Ga0070685_10000865 3300005466 Bacteria 16457
161 Ga0070685_10000952 3300005466 Bacteria 15547
162 Ga0070685_10234317 3300005466 Bacteria 1209
163 Ga0070706_100063375 3300005467 Bacteria 3416
164 Ga0070706_100064209 3300005467 Bacteria 3393
165 Ga0070707_100081132 3300005468 Bacteria 3131
166 Ga0070698_100260900 3300005471 Bacteria 1665
167 Ga0070699_100038154 3300005518 Bacteria 4160
168 Ga0070679_100021898 3300005530 Bacteria 6244
169 Ga0070679_100071567 3300005530 Bacteria 3458
170 Ga0070679_100204080 3300005530 Bacteria 1941
171 Ga0070679_100376456 3300005530 Bacteria 1366
172 Ga0070679_100880368 3300005530 Bacteria 839
173 Ga0070684_100024797 3300005535 Bacteria 5034
174 Ga0070684_100047299 3300005535 Bacteria 3729
175 Ga0070697_100063502 3300005536 Bacteria 3015
176 Ga0070697_100233742 3300005536 Bacteria 1568
177 Ga0068853_100000989 3300005539 Bacteria 19988
178 Ga0068853_100057547 3300005539 Bacteria 3355
179 Ga0068853_100142687 3300005539 Bacteria 2151
180 Ga0068853_100258875 3300005539 Bacteria 1599
181 Ga0068853_100293284 3300005539 Bacteria 1502
182 Ga0068853_100575382 3300005539 Bacteria 1068
183 Ga0068853_100825993 3300005539 Bacteria 888
184 Ga0070672_100004272 3300005543 Bacteria 9342
185 Ga0070672_100006249 3300005543 Bacteria 7983
186 Ga0070672_100023464 3300005543 Bacteria 4548
187 Ga0070672_100052026 3300005543 Bacteria 3196
188 Ga0070672_100187487 3300005543 Bacteria 1726
189 Ga0070686_100037312 3300005544 Bacteria 3013
190 Ga0070695_100038174 3300005545 Bacteria 3029
191 Ga0070695_100109092 3300005545 Bacteria 1875
192 Ga0070696_100008446 3300005546 Bacteria 6892
193 Ga0070696_100030426 3300005546 Bacteria 3696
194 Ga0070696_100189372 3300005546 Bacteria 1531
195 Ga0070696_100215821 3300005546 Bacteria 1438
196 Ga0070693_100046354 3300005547 Bacteria 2468
197 Ga0070693_100086837 3300005547 Bacteria 1877
198 Ga0070693_100190347 3300005547 Bacteria 1326
199 Ga0070693_100198393 3300005547 Bacteria 1302
200 Ga0070665_100004216 3300005548 Bacteria 15128
201 Ga0070665_100022381 3300005548 Bacteria 6361
202 Ga0070665_100029872 3300005548 Bacteria 5485
203 Ga0070665_100034095 3300005548 Bacteria 5119
204 Ga0070665_100478056 3300005548 Bacteria 1256
205 Ga0070704_100295775 3300005549 Bacteria 1347
206 Ga0068855_100001532 3300005563 Bacteria 29008
207 Ga0068855_100125302 3300005563 Bacteria 2937
208 Ga0068855_100164319 3300005563 Bacteria 2517
209 Ga0068855_100210456 3300005563 Bacteria 2185
210 Ga0068855_100248005 3300005563 Bacteria 1987
211 Ga0068855_100251556 3300005563 Bacteria 1971
212 Ga0068855_100330083 3300005563 Bacteria 1684
213 Ga0070664_100003765 3300005564 Bacteria 12234
214 Ga0070664_100005287 3300005564 Bacteria 10359
215 Ga0070664_100018085 3300005564 Bacteria 5786
216 Ga0070664_100028519 3300005564 Bacteria 4644
217 Ga0070664_100034419 3300005564 Bacteria 4250
218 Ga0070664_100046456 3300005564 Bacteria 3667
219 Ga0070664_100096938 3300005564 Bacteria 2560
220 Ga0070664_100120623 3300005564 Bacteria 2296
221 Ga0070664_100158596 3300005564 Bacteria 2000
222 Ga0070664_100216846 3300005564 Bacteria 1711
223 Ga0068857_100017460 3300005577 Bacteria 6289
224 Ga0068857_100027709 3300005577 Bacteria 4997
225 Ga0068857_100494298 3300005577 Bacteria 1147
226 Ga0068854_100005844 3300005578 Bacteria 7791
227 Ga0068854_100012043 3300005578 Bacteria 5653
228 Ga0068854_100013913 3300005578 Bacteria 5293
229 Ga0068854_100018797 3300005578 Bacteria 4645
230 Ga0068854_100091929 3300005578 Bacteria 2259
231 Ga0068854_100103555 3300005578 Bacteria 2137
232 Ga0068854_100286782 3300005578 Bacteria 1327
233 Ga0068854_100317874 3300005578 Bacteria 1264
234 Ga0068854_100345160 3300005578 Bacteria 1217
235 Ga0068856_100019105 3300005614 Bacteria 6652
236 Ga0068856_100027014 3300005614 Bacteria 5599
237 Ga0068856_100052652 3300005614 Bacteria 4015
238 Ga0068856_100069397 3300005614 Bacteria 3485
239 Ga0068856_100503361 3300005614 Unclassified 1232
240 Ga0070702_100007725 3300005615 Bacteria 5165
241 Ga0070702_100016571 3300005615 Bacteria 3783
242 Ga0070702_100266046 3300005615 Bacteria 1170
243 Ga0070702_100526588 3300005615 Bacteria 873
244 Ga0068852_100006108 3300005616 Bacteria 8684
245 Ga0068852_100008461 3300005616 Bacteria 7584
246 Ga0068852_100008486 3300005616 Bacteria 7574
247 Ga0068852_100011191 3300005616 Bacteria 6741
248 Ga0068852_100011273 3300005616 Bacteria 6721
249 Ga0068852_100195787 3300005616 Bacteria 1910
250 Ga0068852_100376719 3300005616 Bacteria 1391
251 Ga0068852_100932860 3300005616 Bacteria 886
252 Ga0068859_100000419 3300005617 Bacteria 42439
253 Ga0068859_100011245 3300005617 Bacteria 9004
254 Ga0068859_100163352 3300005617 Bacteria 2306
255 Ga0068859_101127675 3300005617 Bacteria 863
256 Ga0068864_100000779 3300005618 Bacteria 26780
257 Ga0068864_100005090 3300005618 Bacteria 10770
258 Ga0068864_100008062 3300005618 Bacteria 8687
259 Ga0068864_100022340 3300005618 Bacteria 5305
260 Ga0068864_100043190 3300005618 Bacteria 3859
261 Ga0068861_100059576 3300005719 Bacteria 2924
262 Ga0068861_100093914 3300005719 Bacteria 2372
263 Ga0068861_100112532 3300005719 Bacteria 2183
264 Ga0068861_100486543 3300005719 Bacteria 1113
265 Ga0068861_100694549 3300005719 Bacteria 945
266 Ga0068861_100820457 3300005719 Bacteria 874
267 Ga0068851_10007627 3300005834 Bacteria 4976
268 Ga0068851_10016458 3300005834 Bacteria 3538
269 Ga0068851_10044525 3300005834 Bacteria 2240
270 Ga0068851_10128251 3300005834 Bacteria 1369
271 Ga0068851_10182248 3300005834 Bacteria 1164
272 Ga0068870_10003462 3300005840 Bacteria 6688
273 Ga0068870_10027760 3300005840 Bacteria 2835
274 Ga0068870_10058023 3300005840 Bacteria 2071
275 Ga0068870_10126453 3300005840 Bacteria 1479
276 Ga0068863_100009157 3300005841 Bacteria 9661
277 Ga0068863_100011979 3300005841 Bacteria 8380
278 Ga0068863_100072004 3300005841 Bacteria 3270
279 Ga0068858_100005230 3300005842 Bacteria 12716
280 Ga0068858_100007540 3300005842 Bacteria 10516
281 Ga0068858_100013995 3300005842 Bacteria 7570
282 Ga0068858_100017717 3300005842 Bacteria 6673
283 Ga0068860_100004580 3300005843 Bacteria 14114
284 Ga0068860_100008263 3300005843 Bacteria 10357
285 Ga0068860_100034492 3300005843 Bacteria 4854
286 Ga0068860_100035235 3300005843 Bacteria 4802
287 Ga0068860_100716288 3300005843 Bacteria 1011
288 Ga0068860_100938688 3300005843 Bacteria 882
289 Ga0068862_100038853 3300005844 Bacteria 4039
290 Ga0068862_100069099 3300005844 Bacteria 3048
291 Ga0068862_100071760 3300005844 Bacteria 2990
292 Ga0068862_100249593 3300005844 Bacteria 1617
293 Ga0068862_100751660 3300005844 Bacteria 949
294 Ga0070717_10210783 3300006028 Bacteria 1705
295 Ga0070715_10003303 3300006163 Bacteria 5103
296 Ga0070716_100042628 3300006173 Bacteria 2534
297 Ga0070716_100050658 3300006173 Bacteria 2358
298 Ga0070712_100003929 3300006175 Bacteria 9153
299 Ga0070712_100064444 3300006175 Bacteria 2599
300 Ga0097621_100013686 3300006237 Bacteria 6058
301 Ga0097621_100054942 3300006237 Bacteria 3250
302 Ga0097621_100079123 3300006237 Bacteria 2732
303 Ga0097621_100544155 3300006237 Unclassified 1056
304 Ga0068871_100016106 3300006358 Bacteria 5617
305 Ga0068871_100035362 3300006358 Bacteria 3969
306 Ga0068871_100060417 3300006358 Bacteria 3092
307 Ga0068871_100109528 3300006358 Bacteria 2322
308 Ga0075430_100809528 3300006846 Bacteria 772
309 Ga0075433_10054044 3300006852 Bacteria 3503
310 Ga0075434_100126195 3300006871 Bacteria 2576
311 Ga0068865_100007356 3300006881 Bacteria 6772
312 Ga0068865_100047408 3300006881 Bacteria 2952
313 Ga0068865_100098502 3300006881 Bacteria 2136
314 Ga0068865_100128078 3300006881 Bacteria 1898
315 Ga0068865_100322149 3300006881 Bacteria 1244
316 Ga0075436_100159173 3300006914 Bacteria 1591
317 Ga0097620_100000419 3300006931 Bacteria 42439
318 Ga0097620_100011246 3300006931 Bacteria 9004
319 Ga0097620_100163367 3300006931 Bacteria 2306
320 Ga0097620_101127671 3300006931 Bacteria 863
321 Ga0075435_100192159 3300007076 Bacteria 1728
322 Ga0105240_10018858 3300009093 Bacteria 9237
323 Ga0105240_10024246 3300009093 Bacteria 8004
324 Ga0105240_10137802 3300009093 Bacteria 2921
325 Ga0105245_10002120 3300009098 Bacteria 17969
326 Ga0105245_10004840 3300009098 Bacteria 11863
327 Ga0105245_10020842 3300009098 Bacteria 5746
328 Ga0105245_10143629 3300009098 Bacteria 2250
329 Ga0105245_10993299 3300009098 Bacteria 883
330 Ga0105247_10015413 3300009101 Bacteria 4579
331 Ga0114129_10161397 3300009147 Bacteria 3061
332 Ga0114129_10822040 3300009147 Bacteria 1183
333 Ga0105243_10197954 3300009148 Bacteria 1760
334 Ga0105243_10385442 3300009148 Unclassified 1298
335 Ga0105241_10016284 3300009174 Bacteria 5448
336 Ga0105241_10028853 3300009174 Bacteria 4134
337 Ga0105241_10093395 3300009174 Bacteria 2377
338 Ga0105241_10542798 3300009174 Bacteria 1043
339 Ga0105242_10392222 3300009176 Bacteria 1293
340 Ga0105248_10004450 3300009177 Bacteria 15511
341 Ga0105248_10008034 3300009177 Bacteria 11587
342 Ga0105248_10022953 3300009177 Bacteria 6928
343 Ga0105248_10066935 3300009177 Bacteria 4033
344 Ga0105248_10217128 3300009177 Unclassified 2154
345 Ga0105248_10284357 3300009177 Bacteria 1862
346 Ga0105248_10295522 3300009177 Bacteria 1824
347 Ga0105237_10307903 3300009545 Bacteria 1587
348 Ga0105237_10387695 3300009545 Bacteria 1402
349 Ga0105237_10576538 3300009545 Bacteria 1132
350 Ga0105237_10820442 3300009545 Bacteria 937
351 Ga0105237_11046420 3300009545 Bacteria 823
352 Ga0105238_10005164 3300009551 Bacteria 12906
353 Ga0105238_10034319 3300009551 Bacteria 5162
354 Ga0105238_10546444 3300009551 Bacteria 1162
355 Ga0105238_10605056 3300009551 Bacteria 1104
356 Ga0105238_10891433 3300009551 Bacteria 908
357 Ga0105249_10012299 3300009553 Bacteria 7542
358 Ga0105249_10180987 3300009553 Bacteria 2051
359 Ga0105249_10270736 3300009553 Bacteria 1692
360 Ga0105249_10493109 3300009553 Bacteria 1269
361 Ga0105239_10123207 3300010375 Bacteria 2881
362 Ga0105239_10242261 3300010375 Bacteria 2024
363 Ga0105239_10465532 3300010375 Bacteria 1435
364 Ga0105246_10070464 3300011119 Bacteria 2459
365 Ga0105246_10076189 3300011119 Bacteria 2376
366 Ga0157373_10006263 3300013100 Bacteria 8891
367 Ga0157373_10061678 3300013100 Bacteria 2655
368 Ga0157373_10104330 3300013100 Bacteria 1994
369 Ga0157371_10002999 3300013102 Bacteria 15680
370 Ga0157371_10087892 3300013102 Bacteria 2201
371 Ga0157371_10488692 3300013102 Bacteria 908
372 Ga0157370_10004609 3300013104 Bacteria 15764
373 Ga0157370_10015092 3300013104 Bacteria 7871
374 Ga0157370_10016876 3300013104 Bacteria 7380
375 Ga0157370_10039229 3300013104 Bacteria 4577
376 Ga0157370_10160091 3300013104 Unclassified 2095
377 Ga0157370_10504964 3300013104 Bacteria 1110
378 Ga0157369_10018504 3300013105 Bacteria 7810
379 Ga0157369_10031932 3300013105 Bacteria 5794
380 Ga0157369_10050835 3300013105 Bacteria 4487
381 Ga0157369_10240970 3300013105 Bacteria 1889
382 Ga0157369_10452189 3300013105 Bacteria 1330
383 Ga0157369_10639948 3300013105 Bacteria 1097
384 Ga0157374_10000762 3300013296 Bacteria 28119
385 Ga0157374_10024665 3300013296 Bacteria 5392
386 Ga0157374_10029597 3300013296 Bacteria 4962
387 Ga0157374_10063784 3300013296 Bacteria 3456
388 Ga0157374_10071315 3300013296 Bacteria 3275
389 Ga0157374_10436978 3300013296 Bacteria 1309
390 Ga0157374_11049374 3300013296 Unclassified 835
391 Ga0157378_10005364 3300013297 Bacteria 11248
392 Ga0157378_10061212 3300013297 Bacteria 3358
393 Ga0157378_10262396 3300013297 Bacteria 1658
394 Ga0157378_10353246 3300013297 Bacteria 1436
395 Ga0157378_10606028 3300013297 Bacteria 1107
396 Ga0163162_10002601 3300013306 Bacteria 17104
397 Ga0163162_10009309 3300013306 Bacteria 9552
398 Ga0163162_10032404 3300013306 Bacteria 5191
399 Ga0163162_10036435 3300013306 Bacteria 4903
400 Ga0163162_10120859 3300013306 Bacteria 2724
401 Ga0157372_10001311 3300013307 Bacteria 26932
402 Ga0157372_10003548 3300013307 Bacteria 16807
403 Ga0157372_10207405 3300013307 Bacteria 2271
404 Ga0157372_10336074 3300013307 Unclassified 1759
405 Ga0157372_10366525 3300013307 Unclassified 1679
406 Ga0157372_10477868 3300013307 Bacteria 1453
407 Ga0157372_10663800 3300013307 Bacteria 1214
408 Ga0157372_10719670 3300013307 Bacteria 1161
409 Ga0157372_10847191 3300013307 Bacteria 1061
410 Ga0157372_11194655 3300013307 Bacteria 879
411 Ga0157372_11237568 3300013307 Bacteria 862
412 Ga0157372_11328977 3300013307 Bacteria 829
413 Ga0157375_10002701 3300013308 Bacteria 15345
414 Ga0157375_10132465 3300013308 Bacteria 2613
415 Ga0157375_10355498 3300013308 Bacteria 1631
416 Ga0163163_10000398 3300014325 Bacteria 41134
417 Ga0163163_10004611 3300014325 Bacteria 11769
418 Ga0163163_10012961 3300014325 Bacteria 7616
419 Ga0157380_10060443 3300014326 Bacteria 3028
420 Ga0157380_10455925 3300014326 Bacteria 1229
421 Ga0182008_10144634 3300014497 Bacteria 1191
422 Ga0157377_10003233 3300014745 Bacteria 7355
423 Ga0157377_10015523 3300014745 Bacteria 3899
424 Ga0157379_10000198 3300014968 Bacteria 46528
425 Ga0157379_10001187 3300014968 Bacteria 21213
426 Ga0157379_10002782 3300014968 Bacteria 14750
427 Ga0157379_10021922 3300014968 Bacteria 5660
428 Ga0157379_10069052 3300014968 Bacteria 3160
429 Ga0157376_10009935 3300014969 Bacteria 6941
430 Ga0157376_10042911 3300014969 Bacteria 3709
431 Ga0157376_10054770 3300014969 Bacteria 3326
432 Ga0157376_10162376 3300014969 Bacteria 2027
433 Ga0157376_10187394 3300014969 Bacteria 1895
434 Ga0163161_10007405 3300017792 Bacteria 7583
435 Ga0163161_10330994 3300017792 Unclassified 1206
436 Ga0207666_1001516 3300025271 Bacteria 2739
437 Ga0207697_10000139 3300025315 Bacteria 34991
438 Ga0207656_10005194 3300025321 Bacteria 4580
439 Ga0207656_10025161 3300025321 Bacteria 2414
440 Ga0207656_10130516 3300025321 Bacteria 1177
441 Ga0207682_10000054 3300025893 Bacteria 48876
442 Ga0207682_10001507 3300025893 Bacteria 10736
443 Ga0207682_10008769 3300025893 Bacteria 3999
444 Ga0207692_10013099 3300025898 Bacteria 3588
445 Ga0207692_10050338 3300025898 Bacteria 2106
446 Ga0207642_10090913 3300025899 Unclassified 1507
447 Ga0207710_10015257 3300025900 Bacteria 3244
448 Ga0207688_10000567 3300025901 Bacteria 18129
449 Ga0207680_10003446 3300025903 Bacteria 7462
450 Ga0207680_10003803 3300025903 Bacteria 7111
451 Ga0207680_10120749 3300025903 Bacteria 1713
452 Ga0207680_10142753 3300025903 Bacteria 1589
453 Ga0207680_10143101 3300025903 Bacteria 1587
454 Ga0207685_10252296 3300025905 Bacteria 854
455 Ga0207699_10029400 3300025906 Bacteria 3065
456 Ga0207699_10039824 3300025906 Bacteria 2703
457 Ga0207699_10245193 3300025906 Bacteria 1233
458 Ga0207699_10323127 3300025906 Bacteria 1083
459 Ga0207699_10365647 3300025906 Bacteria 1021
460 Ga0207645_10000917 3300025907 Bacteria 24498
461 Ga0207645_10001442 3300025907 Bacteria 19478
462 Ga0207645_10048876 3300025907 Bacteria 2701
463 Ga0207645_10082786 3300025907 Bacteria 2057
464 Ga0207645_10220762 3300025907 Bacteria 1249
465 Ga0207645_10237661 3300025907 Bacteria 1203
466 Ga0207643_10000618 3300025908 Bacteria 22431
467 Ga0207643_10005780 3300025908 Bacteria 6611
468 Ga0207643_10034094 3300025908 Bacteria 2851
469 Ga0207643_10064804 3300025908 Bacteria 2092
470 Ga0207705_10057643 3300025909 Bacteria 2801
471 Ga0207705_10141843 3300025909 Bacteria 1795
472 Ga0207654_10052241 3300025911 Bacteria 2355
473 Ga0207654_10060067 3300025911 Bacteria 2220
474 Ga0207707_10003761 3300025912 Bacteria 13449
475 Ga0207707_10015006 3300025912 Bacteria 6746
476 Ga0207707_10564412 3300025912 Bacteria 966
477 Ga0207695_10033378 3300025913 Bacteria 5614
478 Ga0207695_10097770 3300025913 Bacteria 2936
479 Ga0207695_10144239 3300025913 Bacteria 2327
480 Ga0207671_10191844 3300025914 Bacteria 1593
481 Ga0207671_10328125 3300025914 Bacteria 1212
482 Ga0207693_10000415 3300025915 Bacteria 38698
483 Ga0207693_10011886 3300025915 Bacteria 7038
484 Ga0207693_10030120 3300025915 Bacteria 4285
485 Ga0207663_10003835 3300025916 Bacteria 7422
486 Ga0207663_10472296 3300025916 Bacteria 970
487 Ga0207660_10137259 3300025917 Bacteria 1867
488 Ga0207660_10174412 3300025917 Bacteria 1666
489 Ga0207660_10200191 3300025917 Unclassified 1559
490 Ga0207662_10000472 3300025918 Bacteria 17955
491 Ga0207657_10000191 3300025919 Bacteria 63991
492 Ga0207657_10000224 3300025919 Bacteria 59151
493 Ga0207657_10005082 3300025919 Bacteria 13794
494 Ga0207657_10008154 3300025919 Bacteria 10676
495 Ga0207657_10024303 3300025919 Bacteria 5617
496 Ga0207649_10005321 3300025920 Bacteria 6969
497 Ga0207649_10030017 3300025920 Bacteria 3215
498 Ga0207649_10034164 3300025920 Bacteria 3044
499 Ga0207652_10015033 3300025921 Bacteria 6278
500 Ga0207652_10056663 3300025921 Bacteria 3374
501 Ga0207652_10109215 3300025921 Bacteria 2452
502 Ga0207652_10173300 3300025921 Bacteria 1936
503 Ga0207652_10479078 3300025921 Bacteria 1121
504 Ga0207646_10074138 3300025922 Bacteria 3040
505 Ga0207681_10124276 3300025923 Bacteria 1897
506 Ga0207694_10004485 3300025924 Bacteria 10895
507 Ga0207694_10105889 3300025924 Bacteria 2233
508 Ga0207694_10777034 3300025924 Bacteria 809
509 Ga0207650_10001048 3300025925 Bacteria 20536
510 Ga0207650_10010682 3300025925 Bacteria 6307
511 Ga0207650_10015834 3300025925 Bacteria 5259
512 Ga0207650_10048555 3300025925 Bacteria 3131
513 Ga0207650_10096583 3300025925 Bacteria 2267
514 Ga0207650_10129005 3300025925 Bacteria 1977
515 Ga0207659_10004438 3300025926 Bacteria 8489
516 Ga0207659_10013622 3300025926 Bacteria 5214
517 Ga0207659_10014251 3300025926 Bacteria 5119
518 Ga0207659_10237354 3300025926 Bacteria 1473
519 Ga0207687_10000489 3300025927 Bacteria 26684
520 Ga0207687_10012573 3300025927 Bacteria 5529
521 Ga0207700_10000189 3300025928 Bacteria 36770
522 Ga0207700_10014225 3300025928 Bacteria 5207
523 Ga0207700_10018069 3300025928 Bacteria 4727
524 Ga0207664_10000623 3300025929 Bacteria 24532
525 Ga0207664_10018953 3300025929 Bacteria 5076
526 Ga0207664_10123270 3300025929 Bacteria 2172
527 Ga0207644_10001841 3300025931 Bacteria 13789
528 Ga0207644_10005705 3300025931 Bacteria 8103
529 Ga0207644_10006622 3300025931 Bacteria 7548
530 Ga0207644_10012630 3300025931 Bacteria 5613
531 Ga0207644_10020339 3300025931 Bacteria 4513
532 Ga0207644_10987414 3300025931 Unclassified 706
533 Ga0207690_10000677 3300025932 Bacteria 21815
534 Ga0207690_10004999 3300025932 Bacteria 7833
535 Ga0207690_10093791 3300025932 Bacteria 2128
536 Ga0207690_10109230 3300025932 Bacteria 1989
537 Ga0207690_10118874 3300025932 Bacteria 1916
538 Ga0207690_10331762 3300025932 Bacteria 1198
539 Ga0207706_10000201 3300025933 Bacteria 65946
540 Ga0207706_10002581 3300025933 Bacteria 17646
541 Ga0207706_10020044 3300025933 Bacteria 6008
542 Ga0207706_10088810 3300025933 Bacteria 2717
543 Ga0207706_10754865 3300025933 Bacteria 829
544 Ga0207686_10021046 3300025934 Bacteria 3736
545 Ga0207670_10039597 3300025936 Bacteria 3088
546 Ga0207669_10013821 3300025937 Bacteria 4027
547 Ga0207669_10019689 3300025937 Bacteria 3521
548 Ga0207669_10227272 3300025937 Bacteria 1374
549 Ga0207669_10360128 3300025937 Bacteria 1127
550 Ga0207669_10966458 3300025937 Bacteria 714
551 Ga0207704_10016876 3300025938 Bacteria 3767
552 Ga0207704_10096393 3300025938 Bacteria 1959
553 Ga0207704_10098442 3300025938 Bacteria 1943
554 Ga0207665_10008776 3300025939 Bacteria 6648
555 Ga0207665_10012454 3300025939 Bacteria 5586
556 Ga0207691_10000443 3300025940 Bacteria 41014
557 Ga0207691_10003295 3300025940 Bacteria 15737
558 Ga0207691_10010065 3300025940 Bacteria 9077
559 Ga0207691_10010423 3300025940 Bacteria 8920
560 Ga0207691_10044691 3300025940 Bacteria 4076
561 Ga0207691_10044842 3300025940 Bacteria 4069
562 Ga0207691_10155107 3300025940 Bacteria 2011
563 Ga0207691_10287504 3300025940 Bacteria 1414
564 Ga0207691_10301053 3300025940 Bacteria 1378
565 Ga0207711_10001182 3300025941 Bacteria 24848
566 Ga0207711_10013224 3300025941 Bacteria 6857
567 Ga0207711_10018617 3300025941 Bacteria 5774
568 Ga0207711_10226741 3300025941 Bacteria 1711
569 Ga0207711_10229134 3300025941 Bacteria 1701
570 Ga0207711_10683475 3300025941 Bacteria 957
571 Ga0207711_10803068 3300025941 Bacteria 876
572 Ga0207711_11140422 3300025941 Bacteria 721
573 Ga0207689_10000213 3300025942 Bacteria 51378
574 Ga0207689_10001696 3300025942 Bacteria 20923
575 Ga0207689_10044317 3300025942 Bacteria 3678
576 Ga0207689_10097742 3300025942 Bacteria 2412
577 Ga0207661_10067030 3300025944 Bacteria 2918
578 Ga0207661_10089166 3300025944 Bacteria 2565
579 Ga0207679_10001228 3300025945 Bacteria 16282
580 Ga0207679_10004189 3300025945 Bacteria 8961
581 Ga0207679_10008133 3300025945 Bacteria 6673
582 Ga0207679_10009620 3300025945 Bacteria 6194
583 Ga0207679_10044280 3300025945 Bacteria 3210
584 Ga0207679_10097763 3300025945 Bacteria 2287
585 Ga0207679_10229785 3300025945 Bacteria 1565
586 Ga0207679_10760132 3300025945 Bacteria 882
587 Ga0207667_10001846 3300025949 Bacteria 26604
588 Ga0207667_10002467 3300025949 Bacteria 23098
589 Ga0207667_10003676 3300025949 Bacteria 18904
590 Ga0207667_10090296 3300025949 Bacteria 3166
591 Ga0207667_10098680 3300025949 Bacteria 3014
592 Ga0207667_10271806 3300025949 Bacteria 1733
593 Ga0207667_10312276 3300025949 Bacteria 1606
594 Ga0207667_10335669 3300025949 Bacteria 1543
595 Ga0207667_10765935 3300025949 Bacteria 964
596 Ga0207651_10000334 3300025960 Bacteria 19953
597 Ga0207651_10019052 3300025960 Bacteria 4102
598 Ga0207651_10224232 3300025960 Bacteria 1521
599 Ga0207712_10119425 3300025961 Bacteria 1992
600 Ga0207712_10130064 3300025961 Bacteria 1917
601 Ga0207668_10032826 3300025972 Bacteria 3435
602 Ga0207640_10043846 3300025981 Bacteria 2862
603 Ga0207640_10062978 3300025981 Bacteria 2463
604 Ga0207640_10067469 3300025981 Bacteria 2394
605 Ga0207640_10085959 3300025981 Bacteria 2164
606 Ga0207640_10118984 3300025981 Bacteria 1888
607 Ga0207640_10328400 3300025981 Bacteria 1221
608 Ga0207640_10669474 3300025981 Bacteria 886
609 Ga0207658_10003625 3300025986 Bacteria 10907
610 Ga0207658_10010127 3300025986 Bacteria 6404
611 Ga0207658_10017457 3300025986 Bacteria 4945
612 Ga0207658_10020692 3300025986 Bacteria 4557
613 Ga0207658_10045491 3300025986 Bacteria 3200
614 Ga0207658_10093479 3300025986 Bacteria 2338
615 Ga0207658_10155326 3300025986 Bacteria 1869
616 Ga0207677_10016943 3300026023 Bacteria 4329
617 Ga0207677_10096285 3300026023 Unclassified 2165
618 Ga0207703_10000333 3300026035 Bacteria 51430
619 Ga0207703_10000742 3300026035 Bacteria 32170
620 Ga0207703_10003903 3300026035 Bacteria 12380
621 Ga0207703_10018853 3300026035 Bacteria 5389
622 Ga0207703_10047707 3300026035 Bacteria 3455
623 Ga0207703_10282234 3300026035 Bacteria 1509
624 Ga0207639_10001732 3300026041 Bacteria 14696
625 Ga0207639_10015548 3300026041 Bacteria 5372
626 Ga0207639_10068202 3300026041 Bacteria 2771
627 Ga0207639_10171880 3300026041 Bacteria 1836
628 Ga0207639_10415172 3300026041 Bacteria 1215
629 Ga0207639_10511179 3300026041 Bacteria 1099
630 Ga0207678_10003642 3300026067 Bacteria 13850
631 Ga0207678_10005218 3300026067 Bacteria 11644
632 Ga0207678_10036792 3300026067 Bacteria 4261
633 Ga0207678_10343525 3300026067 Bacteria 1286
634 Ga0207678_10413783 3300026067 Bacteria 1169
635 Ga0207678_10494128 3300026067 Bacteria 1066
636 Ga0207678_10560423 3300026067 Unclassified 1000
637 Ga0207708_10001015 3300026075 Bacteria 20995
638 Ga0207702_10004953 3300026078 Bacteria 11699
639 Ga0207702_10019891 3300026078 Bacteria 5561
640 Ga0207702_10052077 3300026078 Bacteria 3462
641 Ga0207702_10060185 3300026078 Bacteria 3237
642 Ga0207702_10149903 3300026078 Bacteria 2120
643 Ga0207702_10306353 3300026078 Bacteria 1509
644 Ga0207702_10421191 3300026078 Unclassified 1291
645 Ga0207702_10482492 3300026078 Bacteria 1206
646 Ga0207641_10003505 3300026088 Bacteria 13890
647 Ga0207641_10040748 3300026088 Bacteria 3890
648 Ga0207641_10085412 3300026088 Bacteria 2750
649 Ga0207648_10002211 3300026089 Bacteria 21098
650 Ga0207648_10012155 3300026089 Bacteria 8068
651 Ga0207648_10091622 3300026089 Bacteria 2657
652 Ga0207648_10102095 3300026089 Bacteria 2513
653 Ga0207648_10244007 3300026089 Bacteria 1600
654 Ga0207648_10292593 3300026089 Bacteria 1459
655 Ga0207676_10000524 3300026095 Bacteria 32178
656 Ga0207676_10019653 3300026095 Bacteria 4931
657 Ga0207676_10041925 3300026095 Bacteria 3517
658 Ga0207674_10000242 3300026116 Bacteria 67777
659 Ga0207674_10000448 3300026116 Bacteria 53696
660 Ga0207674_10003532 3300026116 Bacteria 19088
661 Ga0207674_10025693 3300026116 Bacteria 6272
662 Ga0207674_10399820 3300026116 Bacteria 1328
663 Ga0207674_10989794 3300026116 Bacteria 810
664 Ga0207675_100009119 3300026118 Bacteria 9308
665 Ga0207675_100021004 3300026118 Bacteria 6086
666 Ga0207675_100069844 3300026118 Bacteria 3283
667 Ga0207675_100142085 3300026118 Bacteria 2281
668 Ga0207675_100234258 3300026118 Bacteria 1772
669 Ga0207683_10000119 3300026121 Bacteria 64489
670 Ga0207683_10000235 3300026121 Bacteria 49040
671 Ga0207683_10005392 3300026121 Bacteria 10962
672 Ga0207683_10077589 3300026121 Bacteria 2942
673 Ga0207683_10180704 3300026121 Bacteria 1913
674 Ga0207698_10003767 3300026142 Bacteria 9166
675 Ga0207698_10005135 3300026142 Bacteria 8046
676 Ga0207698_10006443 3300026142 Bacteria 7329
677 Ga0207698_10014169 3300026142 Bacteria 5289
678 Ga0207698_10094321 3300026142 Bacteria 2460
679 Ga0207698_10189909 3300026142 Bacteria 1829
680 Ga0207698_10247078 3300026142 Bacteria 1630
681 Ga0209981_1040553 3300027378 Bacteria 695
682 Ga0209983_1005318 3300027665 Bacteria 2670
683 Ga0209971_1003052 3300027682 Bacteria 3999
684 Ga0209974_10003438 3300027876 Bacteria 5715
685 Ga0209974_10008709 3300027876 Bacteria 3458
686 Ga0207428_10427685 3300027907 Bacteria 967
687 Ga0268266_10018783 3300028379 Bacteria 5890
688 Ga0268266_10100548 3300028379 Bacteria 2547
689 Ga0268265_10060342 3300028380 Bacteria 2906
690 Ga0268265_10111839 3300028380 Bacteria 2231
691 Ga0268264_10002847 3300028381 Bacteria 15083
692 Ga0268264_10019454 3300028381 Bacteria 5548
693 Ga0268264_10021102 3300028381 Bacteria 5322
694 Ga0268264_10033672 3300028381 Bacteria 4212
695 Ga0268264_10659039 3300028381 Bacteria 1036
696 Ga0307408_100017561 3300031548 Bacteria 4789
697 Ga0307413_10002693 3300031824 Bacteria 7282
698 Ga0307410_10018299 3300031852 Bacteria 4231
699 Ga0307406_10021205 3300031901 Bacteria 3840
700 Ga0307407_10000984 3300031903 Bacteria 9760
701 Ga0307411_10026781 3300032005 Bacteria 3476
702 Ga0373934_0020069 3300035086 Bacteria 2569
703 Ga0373923_0010338 3300035111 Bacteria 3392
704 Ga0373936_0037827 3300035113 Bacteria 1928
705 Ga0373945_0015995 3300035116 Bacteria 2528
706 Ga0373954_0004576 3300035118 Bacteria 5958
707 Ga0373954_0080496 3300035118 Bacteria 1556
708 Ga0373956_0006866 3300035119 Bacteria 4571
709 Ga0373956_0055675 3300035119 Bacteria 1784
710 Ga0373943_0022193 3300035170 Bacteria 2938
711 Ga0373946_0022721 3300035171 Bacteria 2444
712 Ga0373955_0025579 3300035172 Bacteria 3033
713 Ga0373955_0288421 3300035172 Unclassified 988
714 Ga0373924_0008192 3300035410 Bacteria 3790
715 Ga0373931_0107820 3300035691 Bacteria 1576
716 Ga0373935_0025307 3300035692 Bacteria 3657
717 Ga0373935_0088831 3300035692 Bacteria 2020
718 Ga0373935_0254159 3300035692 Bacteria 1230
719 Ga0373927_0011672 3300035695 Bacteria 5845
720 Ga0373927_0065083 3300035695 Bacteria 2358
721 Ga0373927_0113882 3300035695 Bacteria 1763
722 Ga0373933_0009511 3300035724 Bacteria 5307
723 Ga0373933_0061462 3300035724 Bacteria 2267
724 Ga0373933_0103457 3300035724 Bacteria 1769
725 Ga0373947_0066513 3300035725 Bacteria 2200
726 Ga0373947_0122899 3300035725 Bacteria 1650
727 Ga0373937_0014998 3300036401 Bacteria 6846
728 Ga0373937_0035923 3300036401 Bacteria 4513
729 Ga0373937_0078997 3300036401 Bacteria 3041
730 Ga0373937_0120702 3300036401 Bacteria 2442
731 Ga0373937_0755178 3300036401 Bacteria 920
732 Ga0373937_1042226 3300036401 Bacteria 767
733 Ga0373925_0031449 3300037068 Bacteria 3900
734 Ga0395899_0347543 3300037312 Bacteria 993
735 Ga0395899_0435983 3300037312 Bacteria 861
736 Ga0395900_0103581 3300037418 Bacteria 2923
737 Ga0395900_0650362 3300037418 Bacteria 991
738 Ga0395898_0010869 3300037466 Bacteria 9504
739 Ga0395905_0224272 3300037471 Bacteria 1759
740 Ga0395901_0223672 3300038443 Bacteria 1967
741 Ga0436365_1865193 3300039437 Bacteria 4003
742 Ga0451853_1083216 3300041512 Unclassified 973
743 Ga0451577_0682280 3300042876 Bacteria 931
744 Ga0451577_0713075 3300042876 Bacteria 908
745 Ga0466963_0291894 3300044694 Bacteria 1146
746 Ga0453684_0381381 3300044712 Bacteria 1583
747 Ga0466957_0255876 3300044842 Bacteria 1165
748 Ga0451576_0261238 3300045051 Bacteria 1810
749 Ga0466967_0371144 3300045976 Bacteria 1388
750 Ga0495629_0011056 3300046459 Bacteria 6557
751 Ga0495629_0338240 3300046459 Bacteria 1028
752 Ga0495580_0095508 3300046472 Bacteria 2067
753 Ga0495580_0111530 3300046472 Bacteria 1899
754 Ga0495580_0156457 3300046472 Bacteria 1578
755 Ga0495580_0427786 3300046472 Unclassified 890
756 Ga0495582_0058949 3300046473 Unclassified 2117
757 Ga0495639_0042071 3300046475 Bacteria 2059
758 Ga0495594_0046564 3300046499 Bacteria 2382
759 Ga0495618_0462682 3300046514 Bacteria 769
760 Ga0495628_0030247 3300046516 Bacteria 4386
761 Ga0495665_0018907 3300046531 Bacteria 3702
762 Ga0495587_0013244 3300046536 Bacteria 5185
763 Ga0495598_0027439 3300046537 Bacteria 1571
764 Ga0495621_0001393 3300046539 Bacteria 6260
765 Ga0495621_0018111 3300046539 Bacteria 2284
766 Ga0495645_0068980 3300046543 Bacteria 2552
767 Ga0495645_0115036 3300046543 Bacteria 1900
768 Ga0495667_0255294 3300046559 Bacteria 1115
769 Ga0495635_0032473 3300046663 Bacteria 3621
770 Ga0495659_0026801 3300046664 Bacteria 1984
771 Ga0495657_0123596 3300046675 Bacteria 1628
772 Ga0495599_0295118 3300046678 Bacteria 979
773 Ga0495599_0429581 3300046678 Bacteria 784
774 Ga0495623_0018491 3300046679 Bacteria 4502
775 Ga0495613_0029599 3300046689 Bacteria 4070
776 Ga0495600_0017528 3300046809 Bacteria 4557
777 Ga0495581_0015319 3300047315 Bacteria 4451
778 Ga0495677_0148505 3300047445 Bacteria 902
779 Ga0495684_0036515 3300047471 Bacteria 3766
780 Ga0495593_0077312 3300047673 Bacteria 1724
781 Ga0496101_0064265 3300048904 Bacteria 2673
782 Ga0496102_0001954 3300048905 Bacteria 17772
783 Ga0496102_0638757 3300048905 Bacteria 988
784 Ga0496103_0019191 3300048906 Bacteria 4106
785 Ga0496103_0126379 3300048906 Bacteria 1631
786 Ga0496103_0537382 3300048906 Unclassified 747
787 Ga0496104_0001700 3300048907 Bacteria 19007
788 Ga0496104_0058639 3300048907 Bacteria 3644
789 Ga0496105_0004098 3300048908 Bacteria 10922
790 Ga0496105_0054459 3300048908 Bacteria 3303
791 Ga0496106_0002268 3300048909 Bacteria 14344
792 Ga0496106_0054925 3300048909 Bacteria 3010
793 Ga0496106_0069238 3300048909 Bacteria 2693
794 Ga0496107_0039708 3300048910 Bacteria 3377
795 Ga0496107_0048457 3300048910 Bacteria 3061
796 Ga0496108_0001086 3300048911 Bacteria 21216
797 Ga0496108_0065183 3300048911 Bacteria 3070
798 Ga0496108_0780556 3300048911 Bacteria 825
799 Ga0496109_0005086 3300048912 Bacteria 10983
800 Ga0496109_0116901 3300048912 Bacteria 2482
801 Ga0496109_0138957 3300048912 Bacteria 2271
802 Ga0496110_0007806 3300048913 Bacteria 8574
803 Ga0496110_0326714 3300048913 Bacteria 1397
804 Ga0496110_0409115 3300048913 Bacteria 1237
805 Ga0496111_0358721 3300048914 Bacteria 1079
806 Ga0496112_0005269 3300048915 Bacteria 11147
807 Ga0496112_0027810 3300048915 Bacteria 5455
808 Ga0496112_0058304 3300048915 Bacteria 3802
809 Ga0496112_0426931 3300048915 Bacteria 1264
810 Ga0496114_0067582 3300048917 Bacteria 2998
811 Ga0496114_0115820 3300048917 Bacteria 2300
812 Ga0496114_0834868 3300048917 Bacteria 801
813 Ga0496115_0034737 3300048918 Bacteria 3985
814 nmdc:mga0rr50_191502_c1 3300050513 Bacteria 1676
815 nmdc:mga08x19_42664_c1 3300050514 Bacteria 2892
816 nmdc:mga0a205_309396_c1 3300050515 Bacteria 1452
817 nmdc:mga0a205_60189_c1 3300050515 Bacteria 3668
818 Ga0495601_0077635 3300053077 Bacteria 2127
819 Ga0157372_11277719
820 MBSR1b_contig_7533592
821 JGI24752J21851_1001377
822 Ga0065715_10365726
823 Ga0065707_10399275
824 Ga0070658_10016270
825 Ga0070658_10017045
826 Ga0070658_10372187
827 Ga0070676_10000182
828 Ga0070676_10002074
829 Ga0070676_10195465
830 Ga0070683_100016286
831 Ga0070683_100034928
832 Ga0070683_100087651
833 Ga0070683_100224800
834 Ga0070670_100009688
835 Ga0070670_100017962
836 Ga0070670_100036657
837 Ga0070670_100385135
838 Ga0070677_10000256
839 Ga0070677_10020813
840 Ga0070677_10069081
841 Ga0068869_100004324
842 Ga0068869_100005961
843 Ga0068869_100038352
844 Ga0068869_100061458
845 Ga0070666_10002668
846 Ga0070666_10003882
847 Ga0070666_10035199
848 Ga0070666_10061053
849 Ga0070666_10113109
850 Ga0070666_10129578
851 Ga0070680_100002253
852 Ga0070680_100120492
853 Ga0068868_100006724
854 Ga0068868_100012434
855 Ga0068868_100049715
856 Ga0070660_100003821
857 Ga0070660_100004427
858 Ga0070660_100006267
859 Ga0070660_100051071
860 Ga0070660_100311137
861 Ga0070660_100664624
862 Ga0070689_100004517
863 Ga0070689_100005820
864 Ga0070689_100246079
865 Ga0070689_100644721
866 Ga0070691_10146086
867 Ga0070691_10255867
868 Ga0070687_100013968
869 Ga0070661_100002158
870 Ga0070661_100021794
871 Ga0070661_100033306
872 Ga0070661_100054334
873 Ga0070661_100134484
874 Ga0070661_100163088
875 Ga0070661_100432654
876 Ga0070692_10008867
877 Ga0070692_10015834
878 Ga0070668_100000885
879 Ga0070668_100013360
880 Ga0070668_100043291
881 Ga0070668_100087540
882 Ga0070668_100135341
883 Ga0070668_100174187
884 Ga0070668_100781199
885 Ga0070668_101119648
886 Ga0070669_100015256
887 Ga0070669_100042129
888 Ga0070669_100135590
889 Ga0070669_100224847
890 Ga0070675_100004518
891 Ga0070675_100010381
892 Ga0070675_100158792
893 Ga0070675_100504255
894 Ga0070671_100001003
895 Ga0070671_100004767
896 Ga0070671_100006314
897 Ga0070671_100008226
898 Ga0070671_100048487
899 Ga0070671_100273818
900 Ga0070674_100000292
901 Ga0070674_100019678
902 Ga0070674_100030679
903 Ga0070674_100058758
904 Ga0070674_100130009
905 Ga0070674_100387778
906 Ga0070673_100000524
907 Ga0070673_100003231
908 Ga0070673_100024227
909 Ga0070673_100417710
910 Ga0070688_100005749
911 Ga0070688_100124958
912 Ga0070688_100881963
913 Ga0070659_100003785
914 Ga0070659_100007972
915 Ga0070659_100020663
916 Ga0070659_100042473
917 Ga0070659_100062709
918 Ga0070659_100146740
919 Ga0070659_100336812
920 Ga0070659_100628100
921 Ga0070667_100001822
922 Ga0070667_100002304
923 Ga0070667_100011281
924 Ga0070667_100050832
925 Ga0070667_100066055
926 Ga0070667_100125547
927 Ga0070667_100128090
928 Ga0070667_100187306
929 Ga0070667_100437850
930 Ga0070667_100624739
931 Ga0070667_100852884
932 Ga0070709_10014355
933 Ga0070709_10277855
934 Ga0070714_100007422
935 Ga0070714_100112735
936 Ga0070714_100414548
937 Ga0070714_100440327
938 Ga0070714_100765934
939 Ga0070713_100000650
940 Ga0070713_100158633
941 Ga0070710_10001177
942 Ga0070710_10063136
943 Ga0070701_10053280
944 Ga0070701_10504624
945 Ga0070711_100000748
946 Ga0070711_100023345
947 Ga0070711_100043323
948 Ga0070711_100061869
949 Ga0070711_100474161
950 Ga0070705_100167421
951 Ga0070700_100059488
952 Ga0070700_100782812
953 Ga0070708_100000884
954 Ga0070708_100137933
955 Ga0070708_100230215
956 Ga0070663_100019764
957 Ga0070663_100034046
958 Ga0070663_100379636
959 Ga0070678_100000527
960 Ga0070678_100001110
961 Ga0070678_100001363
962 Ga0070678_100146088
963 Ga0070678_100340222
964 Ga0070662_100002346
965 Ga0070662_100056089
966 Ga0070662_100060041
967 Ga0070681_10005791
968 Ga0070681_10093836
969 Ga0070681_10171472
970 Ga0070681_10971498
971 Ga0068867_100002163
972 Ga0068867_100006353
973 Ga0068867_100033255
974 Ga0068867_100103675
975 Ga0068867_100281412
976 Ga0068867_100285970
977 Ga0068867_100951539
978 Ga0070685_10000865
979 Ga0070685_10000952
980 Ga0070685_10234317
981 Ga0070706_100063375
982 Ga0070706_100064209
983 Ga0070707_100081132
984 Ga0070698_100260900
985 Ga0070699_100038154
986 Ga0070679_100021898
987 Ga0070679_100071567
988 Ga0070679_100204080
989 Ga0070679_100376456
990 Ga0070679_100880368
991 Ga0070684_100024797
992 Ga0070684_100047299
993 Ga0070697_100063502
994 Ga0070697_100233742
995 Ga0068853_100000989
996 Ga0068853_100057547
997 Ga0068853_100142687
998 Ga0068853_100258875
999 Ga0068853_100293284
1000 Ga0068853_100575382
1001 Ga0068853_100825993
1002 Ga0070672_100004272
1003 Ga0070672_100006249
1004 Ga0070672_100023464
1005 Ga0070672_100052026
1006 Ga0070672_100187487
1007 Ga0070686_100037312
1008 Ga0070695_100038174
1009 Ga0070695_100109092
1010 Ga0070696_100008446
1011 Ga0070696_100030426
1012 Ga0070696_100189372
1013 Ga0070696_100215821
1014 Ga0070693_100046354
1015 Ga0070693_100086837
1016 Ga0070693_100190347
1017 Ga0070693_100198393
1018 Ga0070665_100004216
1019 Ga0070665_100022381
1020 Ga0070665_100029872
1021 Ga0070665_100034095
1022 Ga0070665_100478056
1023 Ga0070704_100295775
1024 Ga0068855_100001532
1025 Ga0068855_100125302
1026 Ga0068855_100164319
1027 Ga0068855_100210456
1028 Ga0068855_100248005
1029 Ga0068855_100251556
1030 Ga0068855_100330083
1031 Ga0070664_100003765
1032 Ga0070664_100005287
1033 Ga0070664_100018085
1034 Ga0070664_100028519
1035 Ga0070664_100034419
1036 Ga0070664_100046456
1037 Ga0070664_100096938
1038 Ga0070664_100120623
1039 Ga0070664_100158596
1040 Ga0070664_100216846
1041 Ga0068857_100017460
1042 Ga0068857_100027709
1043 Ga0068857_100494298
1044 Ga0068854_100005844
1045 Ga0068854_100012043
1046 Ga0068854_100013913
1047 Ga0068854_100018797
1048 Ga0068854_100091929
1049 Ga0068854_100103555
1050 Ga0068854_100286782
1051 Ga0068854_100317874
1052 Ga0068854_100345160
1053 Ga0068856_100019105
1054 Ga0068856_100027014
1055 Ga0068856_100052652
1056 Ga0068856_100069397
1057 Ga0068856_100503361
1058 Ga0070702_100007725
1059 Ga0070702_100016571
1060 Ga0070702_100266046
1061 Ga0070702_100526588
1062 Ga0068852_100006108
1063 Ga0068852_100008461
1064 Ga0068852_100008486
1065 Ga0068852_100011191
1066 Ga0068852_100011273
1067 Ga0068852_100195787
1068 Ga0068852_100376719
1069 Ga0068852_100932860
1070 Ga0068859_100000419
1071 Ga0068859_100011245
1072 Ga0068859_100163352
1073 Ga0068859_101127675
1074 Ga0068864_100000779
1075 Ga0068864_100005090
1076 Ga0068864_100008062
1077 Ga0068864_100022340
1078 Ga0068864_100043190
1079 Ga0068861_100059576
1080 Ga0068861_100093914
1081 Ga0068861_100112532
1082 Ga0068861_100486543
1083 Ga0068861_100694549
1084 Ga0068861_100820457
1085 Ga0068851_10007627
1086 Ga0068851_10016458
1087 Ga0068851_10044525
1088 Ga0068851_10128251
1089 Ga0068851_10182248
1090 Ga0068870_10003462
1091 Ga0068870_10027760
1092 Ga0068870_10058023
1093 Ga0068870_10126453
1094 Ga0068863_100009157
1095 Ga0068863_100011979
1096 Ga0068863_100072004
1097 Ga0068858_100005230
1098 Ga0068858_100007540
1099 Ga0068858_100013995
1100 Ga0068858_100017717
1101 Ga0068860_100004580
1102 Ga0068860_100008263
1103 Ga0068860_100034492
1104 Ga0068860_100035235
1105 Ga0068860_100716288
1106 Ga0068860_100938688
1107 Ga0068862_100038853
1108 Ga0068862_100069099
1109 Ga0068862_100071760
1110 Ga0068862_100249593
1111 Ga0068862_100751660
1112 Ga0070717_10210783
1113 Ga0070715_10003303
1114 Ga0070716_100042628
1115 Ga0070716_100050658
1116 Ga0070712_100003929
1117 Ga0070712_100064444
1118 Ga0097621_100013686
1119 Ga0097621_100054942
1120 Ga0097621_100079123
1121 Ga0097621_100544155
1122 Ga0068871_100016106
1123 Ga0068871_100035362
1124 Ga0068871_100060417
1125 Ga0068871_100109528
1126 Ga0075430_100809528
1127 Ga0075433_10054044
1128 Ga0075434_100126195
1129 Ga0068865_100007356
1130 Ga0068865_100047408
1131 Ga0068865_100098502
1132 Ga0068865_100128078
1133 Ga0068865_100322149
1134 Ga0075436_100159173
1135 Ga0097620_100000419
1136 Ga0097620_100011246
1137 Ga0097620_100163367
1138 Ga0097620_101127671
1139 Ga0075435_100192159
1140 Ga0105240_10018858
1141 Ga0105240_10024246
1142 Ga0105240_10137802
1143 Ga0105245_10002120
1144 Ga0105245_10004840
1145 Ga0105245_10020842
1146 Ga0105245_10143629
1147 Ga0105245_10993299
1148 Ga0105247_10015413
1149 Ga0114129_10161397
1150 Ga0114129_10822040
1151 Ga0105243_10197954
1152 Ga0105243_10385442
1153 Ga0105241_10016284
1154 Ga0105241_10028853
1155 Ga0105241_10093395
1156 Ga0105241_10542798
1157 Ga0105242_10392222
1158 Ga0105248_10004450
1159 Ga0105248_10008034
1160 Ga0105248_10022953
1161 Ga0105248_10066935
1162 Ga0105248_10217128
1163 Ga0105248_10284357
1164 Ga0105248_10295522
1165 Ga0105237_10307903
1166 Ga0105237_10387695
1167 Ga0105237_10576538
1168 Ga0105237_10820442
1169 Ga0105237_11046420
1170 Ga0105238_10005164
1171 Ga0105238_10034319
1172 Ga0105238_10546444
1173 Ga0105238_10605056
1174 Ga0105238_10891433
1175 Ga0105249_10012299
1176 Ga0105249_10180987
1177 Ga0105249_10270736
1178 Ga0105249_10493109
1179 Ga0105239_10123207
1180 Ga0105239_10242261
1181 Ga0105239_10465532
1182 Ga0105246_10070464
1183 Ga0105246_10076189
1184 Ga0157373_10006263
1185 Ga0157373_10061678
1186 Ga0157373_10104330
1187 Ga0157371_10002999
1188 Ga0157371_10087892
1189 Ga0157371_10488692
1190 Ga0157370_10004609
1191 Ga0157370_10015092
1192 Ga0157370_10016876
1193 Ga0157370_10039229
1194 Ga0157370_10160091
1195 Ga0157370_10504964
1196 Ga0157369_10018504
1197 Ga0157369_10031932
1198 Ga0157369_10050835
1199 Ga0157369_10240970
1200 Ga0157369_10452189
1201 Ga0157369_10639948
1202 Ga0157374_10000762
1203 Ga0157374_10024665
1204 Ga0157374_10029597
1205 Ga0157374_10063784
1206 Ga0157374_10071315
1207 Ga0157374_10436978
1208 Ga0157374_11049374
1209 Ga0157378_10005364
1210 Ga0157378_10061212
1211 Ga0157378_10262396
1212 Ga0157378_10353246
1213 Ga0157378_10606028
1214 Ga0163162_10002601
1215 Ga0163162_10009309
1216 Ga0163162_10032404
1217 Ga0163162_10036435
1218 Ga0163162_10120859
1219 Ga0157372_10001311
1220 Ga0157372_10003548
1221 Ga0157372_10207405
1222 Ga0157372_10336074
1223 Ga0157372_10366525
1224 Ga0157372_10477868
1225 Ga0157372_10663800
1226 Ga0157372_10719670
1227 Ga0157372_10847191
1228 Ga0157372_11194655
1229 Ga0157372_11237568
1230 Ga0157372_11328977
1231 Ga0157375_10002701
1232 Ga0157375_10132465
1233 Ga0157375_10355498
1234 Ga0163163_10000398
1235 Ga0163163_10004611
1236 Ga0163163_10012961
1237 Ga0157380_10060443
1238 Ga0157380_10455925
1239 Ga0182008_10144634
1240 Ga0157377_10003233
1241 Ga0157377_10015523
1242 Ga0157379_10000198
1243 Ga0157379_10001187
1244 Ga0157379_10002782
1245 Ga0157379_10021922
1246 Ga0157379_10069052
1247 Ga0157376_10009935
1248 Ga0157376_10042911
1249 Ga0157376_10054770
1250 Ga0157376_10162376
1251 Ga0157376_10187394
1252 Ga0163161_10007405
1253 Ga0163161_10330994
1254 Ga0207666_1001516
1255 Ga0207697_10000139
1256 Ga0207656_10005194
1257 Ga0207656_10025161
1258 Ga0207656_10130516
1259 Ga0207682_10000054
1260 Ga0207682_10001507
1261 Ga0207682_10008769
1262 Ga0207692_10013099
1263 Ga0207692_10050338
1264 Ga0207642_10090913
1265 Ga0207710_10015257
1266 Ga0207688_10000567
1267 Ga0207680_10003446
1268 Ga0207680_10003803
1269 Ga0207680_10120749
1270 Ga0207680_10142753
1271 Ga0207680_10143101
1272 Ga0207685_10252296
1273 Ga0207699_10029400
1274 Ga0207699_10039824
1275 Ga0207699_10245193
1276 Ga0207699_10323127
1277 Ga0207699_10365647
1278 Ga0207645_10000917
1279 Ga0207645_10001442
1280 Ga0207645_10048876
1281 Ga0207645_10082786
1282 Ga0207645_10220762
1283 Ga0207645_10237661
1284 Ga0207643_10000618
1285 Ga0207643_10005780
1286 Ga0207643_10034094
1287 Ga0207643_10064804
1288 Ga0207705_10057643
1289 Ga0207705_10141843
1290 Ga0207654_10052241
1291 Ga0207654_10060067
1292 Ga0207707_10003761
1293 Ga0207707_10015006
1294 Ga0207707_10564412
1295 Ga0207695_10033378
1296 Ga0207695_10097770
1297 Ga0207695_10144239
1298 Ga0207671_10191844
1299 Ga0207671_10328125
1300 Ga0207693_10000415
1301 Ga0207693_10011886
1302 Ga0207693_10030120
1303 Ga0207663_10003835
1304 Ga0207663_10472296
1305 Ga0207660_10137259
1306 Ga0207660_10174412
1307 Ga0207660_10200191
1308 Ga0207662_10000472
1309 Ga0207657_10000191
1310 Ga0207657_10000224
1311 Ga0207657_10005082
1312 Ga0207657_10008154
1313 Ga0207657_10024303
1314 Ga0207649_10005321
1315 Ga0207649_10030017
1316 Ga0207649_10034164
1317 Ga0207652_10015033
1318 Ga0207652_10056663
1319 Ga0207652_10109215
1320 Ga0207652_10173300
1321 Ga0207652_10479078
1322 Ga0207646_10074138
1323 Ga0207681_10124276
1324 Ga0207694_10004485
1325 Ga0207694_10105889
1326 Ga0207694_10777034
1327 Ga0207650_10001048
1328 Ga0207650_10010682
1329 Ga0207650_10015834
1330 Ga0207650_10048555
1331 Ga0207650_10096583
1332 Ga0207650_10129005
1333 Ga0207659_10004438
1334 Ga0207659_10013622
1335 Ga0207659_10014251
1336 Ga0207659_10237354
1337 Ga0207687_10000489
1338 Ga0207687_10012573
1339 Ga0207700_10000189
1340 Ga0207700_10014225
1341 Ga0207700_10018069
1342 Ga0207664_10000623
1343 Ga0207664_10018953
1344 Ga0207664_10123270
1345 Ga0207644_10001841
1346 Ga0207644_10005705
1347 Ga0207644_10006622
1348 Ga0207644_10012630
1349 Ga0207644_10020339
1350 Ga0207644_10987414
1351 Ga0207690_10000677
1352 Ga0207690_10004999
1353 Ga0207690_10093791
1354 Ga0207690_10109230
1355 Ga0207690_10118874
1356 Ga0207690_10331762
1357 Ga0207706_10000201
1358 Ga0207706_10002581
1359 Ga0207706_10020044
1360 Ga0207706_10088810
1361 Ga0207706_10754865
1362 Ga0207686_10021046
1363 Ga0207670_10039597
1364 Ga0207669_10013821
1365 Ga0207669_10019689
1366 Ga0207669_10227272
1367 Ga0207669_10360128
1368 Ga0207669_10966458
1369 Ga0207704_10016876
1370 Ga0207704_10096393
1371 Ga0207704_10098442
1372 Ga0207665_10008776
1373 Ga0207665_10012454
1374 Ga0207691_10000443
1375 Ga0207691_10003295
1376 Ga0207691_10010065
1377 Ga0207691_10010423
1378 Ga0207691_10044691
1379 Ga0207691_10044842
1380 Ga0207691_10155107
1381 Ga0207691_10287504
1382 Ga0207691_10301053
1383 Ga0207711_10001182
1384 Ga0207711_10013224
1385 Ga0207711_10018617
1386 Ga0207711_10226741
1387 Ga0207711_10229134
1388 Ga0207711_10683475
1389 Ga0207711_10803068
1390 Ga0207711_11140422
1391 Ga0207689_10000213
1392 Ga0207689_10001696
1393 Ga0207689_10044317
1394 Ga0207689_10097742
1395 Ga0207661_10067030
1396 Ga0207661_10089166
1397 Ga0207679_10001228
1398 Ga0207679_10004189
1399 Ga0207679_10008133
1400 Ga0207679_10009620
1401 Ga0207679_10044280
1402 Ga0207679_10097763
1403 Ga0207679_10229785
1404 Ga0207679_10760132
1405 Ga0207667_10001846
1406 Ga0207667_10002467
1407 Ga0207667_10003676
1408 Ga0207667_10090296
1409 Ga0207667_10098680
1410 Ga0207667_10271806
1411 Ga0207667_10312276
1412 Ga0207667_10335669
1413 Ga0207667_10765935
1414 Ga0207651_10000334
1415 Ga0207651_10019052
1416 Ga0207651_10224232
1417 Ga0207712_10119425
1418 Ga0207712_10130064
1419 Ga0207668_10032826
1420 Ga0207640_10043846
1421 Ga0207640_10062978
1422 Ga0207640_10067469
1423 Ga0207640_10085959
1424 Ga0207640_10118984
1425 Ga0207640_10328400
1426 Ga0207640_10669474
1427 Ga0207658_10003625
1428 Ga0207658_10010127
1429 Ga0207658_10017457
1430 Ga0207658_10020692
1431 Ga0207658_10045491
1432 Ga0207658_10093479
1433 Ga0207658_10155326
1434 Ga0207677_10016943
1435 Ga0207677_10096285
1436 Ga0207703_10000333
1437 Ga0207703_10000742
1438 Ga0207703_10003903
1439 Ga0207703_10018853
1440 Ga0207703_10047707
1441 Ga0207703_10282234
1442 Ga0207639_10001732
1443 Ga0207639_10015548
1444 Ga0207639_10068202
1445 Ga0207639_10171880
1446 Ga0207639_10415172
1447 Ga0207639_10511179
1448 Ga0207678_10003642
1449 Ga0207678_10005218
1450 Ga0207678_10036792
1451 Ga0207678_10343525
1452 Ga0207678_10413783
1453 Ga0207678_10494128
1454 Ga0207678_10560423
1455 Ga0207708_10001015
1456 Ga0207702_10004953
1457 Ga0207702_10019891
1458 Ga0207702_10052077
1459 Ga0207702_10060185
1460 Ga0207702_10149903
1461 Ga0207702_10306353
1462 Ga0207702_10421191
1463 Ga0207702_10482492
1464 Ga0207641_10003505
1465 Ga0207641_10040748
1466 Ga0207641_10085412
1467 Ga0207648_10002211
1468 Ga0207648_10012155
1469 Ga0207648_10091622
1470 Ga0207648_10102095
1471 Ga0207648_10244007
1472 Ga0207648_10292593
1473 Ga0207676_10000524
1474 Ga0207676_10019653
1475 Ga0207676_10041925
1476 Ga0207674_10000242
1477 Ga0207674_10000448
1478 Ga0207674_10003532
1479 Ga0207674_10025693
1480 Ga0207674_10399820
1481 Ga0207674_10989794
1482 Ga0207675_100009119
1483 Ga0207675_100021004
1484 Ga0207675_100069844
1485 Ga0207675_100142085
1486 Ga0207675_100234258
1487 Ga0207683_10000119
1488 Ga0207683_10000235
1489 Ga0207683_10005392
1490 Ga0207683_10077589
1491 Ga0207683_10180704
1492 Ga0207698_10003767
1493 Ga0207698_10005135
1494 Ga0207698_10006443
1495 Ga0207698_10014169
1496 Ga0207698_10094321
1497 Ga0207698_10189909
1498 Ga0207698_10247078
1499 Ga0209981_1040553
1500 Ga0209983_1005318
1501 Ga0209971_1003052
1502 Ga0209974_10003438
1503 Ga0209974_10008709
1504 Ga0207428_10427685
1505 Ga0268266_10018783
1506 Ga0268266_10100548
1507 Ga0268265_10060342
1508 Ga0268265_10111839
1509 Ga0268264_10002847
1510 Ga0268264_10019454
1511 Ga0268264_10021102
1512 Ga0268264_10033672
1513 Ga0268264_10659039
1514 Ga0307408_100017561
1515 Ga0307413_10002693
1516 Ga0307410_10018299
1517 Ga0307406_10021205
1518 Ga0307407_10000984
1519 Ga0307411_10026781
1520 Ga0373934_0020069
1521 Ga0373923_0010338
1522 Ga0373936_0037827
1523 Ga0373945_0015995
1524 Ga0373954_0004576
1525 Ga0373954_0080496
1526 Ga0373956_0006866
1527 Ga0373956_0055675
1528 Ga0373943_0022193
1529 Ga0373946_0022721
1530 Ga0373955_0025579
1531 Ga0373955_0288421
1532 Ga0373924_0008192
1533 Ga0373931_0107820
1534 Ga0373935_0025307
1535 Ga0373935_0088831
1536 Ga0373935_0254159
1537 Ga0373927_0011672
1538 Ga0373927_0065083
1539 Ga0373927_0113882
1540 Ga0373933_0009511
1541 Ga0373933_0061462
1542 Ga0373933_0103457
1543 Ga0373947_0066513
1544 Ga0373947_0122899
1545 Ga0373937_0014998
1546 Ga0373937_0035923
1547 Ga0373937_0078997
1548 Ga0373937_0120702
1549 Ga0373937_0755178
1550 Ga0373937_1042226
1551 Ga0373925_0031449
1552 Ga0395899_0347543
1553 Ga0395899_0435983
1554 Ga0395900_0103581
1555 Ga0395900_0650362
1556 Ga0395898_0010869
1557 Ga0395905_0224272
1558 Ga0395901_0223672
1559 Ga0436365_1865193
1560 Ga0451853_1083216
1561 Ga0451577_0682280
1562 Ga0451577_0713075
1563 Ga0466963_0291894
1564 Ga0453684_0381381
1565 Ga0466957_0255876
1566 Ga0451576_0261238
1567 Ga0466967_0371144
1568 Ga0495629_0011056
1569 Ga0495629_0338240
1570 Ga0495580_0095508
1571 Ga0495580_0111530
1572 Ga0495580_0156457
1573 Ga0495580_0427786
1574 Ga0495582_0058949
1575 Ga0495639_0042071
1576 Ga0495594_0046564
1577 Ga0495618_0462682
1578 Ga0495628_0030247
1579 Ga0495665_0018907
1580 Ga0495587_0013244
1581 Ga0495598_0027439
1582 Ga0495621_0001393
1583 Ga0495621_0018111
1584 Ga0495645_0068980
1585 Ga0495645_0115036
1586 Ga0495667_0255294
1587 Ga0495635_0032473
1588 Ga0495659_0026801
1589 Ga0495657_0123596
1590 Ga0495599_0295118
1591 Ga0495599_0429581
1592 Ga0495623_0018491
1593 Ga0495613_0029599
1594 Ga0495600_0017528
1595 Ga0495581_0015319
1596 Ga0495677_0148505
1597 Ga0495684_0036515
1598 Ga0495593_0077312
1599 Ga0496101_0064265
1600 Ga0496102_0001954
1601 Ga0496102_0638757
1602 Ga0496103_0019191
1603 Ga0496103_0126379
1604 Ga0496103_0537382
1605 Ga0496104_0001700
1606 Ga0496104_0058639
1607 Ga0496105_0004098
1608 Ga0496105_0054459
1609 Ga0496106_0002268
1610 Ga0496106_0054925
1611 Ga0496106_0069238
1612 Ga0496107_0039708
1613 Ga0496107_0048457
1614 Ga0496108_0001086
1615 Ga0496108_0065183
1616 Ga0496108_0780556
1617 Ga0496109_0005086
1618 Ga0496109_0116901
1619 Ga0496109_0138957
1620 Ga0496110_0007806
1621 Ga0496110_0326714
1622 Ga0496110_0409115
1623 Ga0496111_0358721
1624 Ga0496112_0005269
1625 Ga0496112_0027810
1626 Ga0496112_0058304
1627 Ga0496112_0426931
1628 Ga0496114_0067582
1629 Ga0496114_0115820
1630 Ga0496114_0834868
1631 Ga0496115_0034737
1632 nmdc:mga0rr50_191502_c1
1633 nmdc:mga08x19_42664_c1
1634 nmdc:mga0a205_309396_c1
1635 nmdc:mga0a205_60189_c1
1636 Ga0495601_0077635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

82

234

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wvf-assembly1.cif.gz_A e.coli dsbb c104s with ubiquinone 0.7526 62 212
2k74-assembly1.cif.gz_A solution nmr structure of dsbb-ubiquinone complex 0.7091 62 214
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.678 62 212
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.6541 62 212
2k74-assembly1.cif.gz_A solution nmr structure of dsbb-ubiquinone complex 0.589 62 214
ID Description Score Start End Superfamily
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7616 62 210 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.761 62 212 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7334 62 212 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.725 62 210 1.20.1550.10
2k74A00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7091 62 214 1.20.1550.10
ID Description Score Start End GO Terms
AF-A0A383B225-F1-model_v4 Disulfide bond formation protein B 0.969 60 138 GO:0006457
GO:0015035
GO:0016020
AF-A0A355SMU6-F1-model_v4 deleted 0.9505 60 153
AF-J6CZ03-F1-model_v4 deleted 0.9444 62 149
AF-A0A2N6CI90-F1-model_v4 Disulfide bond formation protein B 0.943 58 154 GO:0005886
GO:0006457
GO:0015035
AF-A0A7C7WCB3-F1-model_v4 deleted 0.9427 59 155

Map