F482131
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 818 | 296 | 1636 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300042008|Ga0439450_015579|Ga0439450_015579_14_1174 |
| Length | 386 |
| Sequence | MQHDERYRKSAQGVEAVDAGRSPRIDAVHADILLRKPRMMPWAGPARYNARILRTHSFGTRRMIPASQLHFKSVNYTGQGPGPKVIIMGATHGNEKCGTQAIQRIMAEIDAGTLPIVNGSVTFVPIVNPKAYAQNTRSGDRNLNRDLSPKAEPHDFEDHVANWLCPLLAQHDVLLDLHSFNAAHGEPFLMVGPLDNDGPLEPFKHMRAERALARRLGVRRFVTGWMAAYGGGVQRRSRGNAQELQTVLRYGMGTTEYMRSTGGYALTLECGQHLDPRAPDVAYTAIMNTLAFLKIIDAPEPEPIAFEEMEALQMVVVHDKLDAGDQFTRQWASFDPVAEGEQIGVRADGTPVVAEFAGRILFPDVNAQPNHEWYYLTRPNPAFGRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 50 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 68 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 114 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 119 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 131 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 132 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 133 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 134 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 135 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 142 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 143 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 257 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 265 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 267 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 268 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 269 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 270 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 271 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 272 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 273 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 274 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 275 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 276 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 277 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 278 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 279 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 280 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 281 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 282 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 283 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 284 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 285 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 286 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 287 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 288 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 289 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 290 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 291 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 292 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 293 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 294 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 295 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 296 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.58 |
| Metatranscriptomes | 0 |
| Isolates | 3.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11 |
| Nodule | 0.49 |
| Rhizoplane | 3.3 |
| Rhizosphere | 78.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439450_015579 | 3300042008 | Bacteria | 1559 |
| 2 | JGI25154J39366_1000716 | 3300002738 | Bacteria | 15035 |
| 3 | JGI25158J39367_1006807 | 3300002739 | Unclassified | 1631 |
| 4 | JGI25152J39213_1000005 | 3300002773 | Bacteria | 160019 |
| 5 | JGI25150J39212_1000571 | 3300002774 | Bacteria | 14701 |
| 6 | JGI25150J39212_1001739 | 3300002774 | Bacteria | 5827 |
| 7 | JGI25150J39212_1005726 | 3300002774 | Unclassified | 2629 |
| 8 | JGI25159J45721_1003493 | 3300002987 | Bacteria | 5539 |
| 9 | JGI25159J45721_1004574 | 3300002987 | Unclassified | 4551 |
| 10 | JGI25153J46596_10005856 | 3300003215 | Bacteria | 6369 |
| 11 | rootL2_10030442 | 3300003322 | Bacteria | 3708 |
| 12 | rootL2_10030453 | 3300003322 | Bacteria | 3049 |
| 13 | rootL2_10035258 | 3300003322 | Bacteria | 5432 |
| 14 | rootL2_10117580 | 3300003322 | Bacteria | 2190 |
| 15 | rootH1_10094760 | 3300003323 | Bacteria | 3192 |
| 16 | JGI25161J50226_1000182 | 3300003374 | Bacteria | 42010 |
| 17 | Ga0055529_1000068 | 3300003763 | Bacteria | 163911 |
| 18 | Ga0055526_1000013 | 3300003771 | Bacteria | 233580 |
| 19 | Ga0055526_1000048 | 3300003771 | Bacteria | 120076 |
| 20 | Ga0055526_1000934 | 3300003771 | Bacteria | 21684 |
| 21 | Ga0055526_1005682 | 3300003771 | Bacteria | 7080 |
| 22 | Ga0055526_1009881 | 3300003771 | Unclassified | 4524 |
| 23 | Ga0055537_1000039 | 3300003773 | Bacteria | 92151 |
| 24 | Ga0055537_1002487 | 3300003773 | Bacteria | 6146 |
| 25 | Ga0055537_1013747 | 3300003773 | Unclassified | 1504 |
| 26 | Ga0055537_1018641 | 3300003773 | Unclassified | 1102 |
| 27 | Ga0055524_1000008 | 3300003775 | Bacteria | 297761 |
| 28 | Ga0055524_1000187 | 3300003775 | Bacteria | 68927 |
| 29 | Ga0055524_1004427 | 3300003775 | Bacteria | 6483 |
| 30 | Ga0055524_1007806 | 3300003775 | Unclassified | 4512 |
| 31 | Ga0055524_1014954 | 3300003775 | Unclassified | 2852 |
| 32 | Ga0055534_1000174 | 3300003784 | Bacteria | 47983 |
| 33 | Ga0055534_1001797 | 3300003784 | Bacteria | 8068 |
| 34 | Ga0055534_1011384 | 3300003784 | Unclassified | 1812 |
| 35 | Ga0055528_1000066 | 3300003790 | Bacteria | 84724 |
| 36 | Ga0055530_10010604 | 3300003791 | Unclassified | 3386 |
| 37 | Ga0055531_10005354 | 3300003794 | Bacteria | 7522 |
| 38 | Ga0055543_1000112 | 3300004625 | Bacteria | 69589 |
| 39 | Ga0055543_1004521 | 3300004625 | Bacteria | 3762 |
| 40 | Ga0065165_1000005 | 3300005262 | Bacteria | 370361 |
| 41 | Ga0065165_1001216 | 3300005262 | Bacteria | 29672 |
| 42 | Ga0065165_1013430 | 3300005262 | Bacteria | 3255 |
| 43 | Ga0065715_10226472 | 3300005293 | Bacteria | 1250 |
| 44 | Ga0070658_10298854 | 3300005327 | Bacteria | 1372 |
| 45 | Ga0070670_100179593 | 3300005331 | Bacteria | 1837 |
| 46 | Ga0070677_10023916 | 3300005333 | Bacteria | 2266 |
| 47 | Ga0070666_10019569 | 3300005335 | Bacteria | 4371 |
| 48 | Ga0070666_10187186 | 3300005335 | Bacteria | 1454 |
| 49 | Ga0068868_100005354 | 3300005338 | Bacteria | 9010 |
| 50 | Ga0070661_100028344 | 3300005344 | Bacteria | 4039 |
| 51 | Ga0070669_100034198 | 3300005353 | Bacteria | 3680 |
| 52 | Ga0070671_100023446 | 3300005355 | Bacteria | 5050 |
| 53 | Ga0070674_100182477 | 3300005356 | Bacteria | 1609 |
| 54 | Ga0070673_100000606 | 3300005364 | Bacteria | 19571 |
| 55 | Ga0070673_100123979 | 3300005364 | Bacteria | 2159 |
| 56 | Ga0070659_100216032 | 3300005366 | Bacteria | 1581 |
| 57 | Ga0070667_100033198 | 3300005367 | Bacteria | 4311 |
| 58 | Ga0070678_100001713 | 3300005456 | Bacteria | 11776 |
| 59 | Ga0070678_100329196 | 3300005456 | Bacteria | 1307 |
| 60 | Ga0068867_100014626 | 3300005459 | Bacteria | 5561 |
| 61 | Ga0070672_100096403 | 3300005543 | Bacteria | 2393 |
| 62 | Ga0068855_100002919 | 3300005563 | Bacteria | 20926 |
| 63 | Ga0070664_100125975 | 3300005564 | Bacteria | 2247 |
| 64 | Ga0070664_100162879 | 3300005564 | Bacteria | 1974 |
| 65 | Ga0068852_100121583 | 3300005616 | Bacteria | 2392 |
| 66 | Ga0068859_100001422 | 3300005617 | Bacteria | 24299 |
| 67 | Ga0068864_100401147 | 3300005618 | Bacteria | 1303 |
| 68 | Ga0068861_100035186 | 3300005719 | Bacteria | 3708 |
| 69 | Ga0068861_100134371 | 3300005719 | Bacteria | 2011 |
| 70 | Ga0068861_100514437 | 3300005719 | Bacteria | 1084 |
| 71 | Ga0068863_100017744 | 3300005841 | Bacteria | 6812 |
| 72 | Ga0068858_100003140 | 3300005842 | Bacteria | 16536 |
| 73 | Ga0068862_100044143 | 3300005844 | Bacteria | 3802 |
| 74 | Ga0097621_100085920 | 3300006237 | Bacteria | 2625 |
| 75 | Ga0068871_100002105 | 3300006358 | Bacteria | 13467 |
| 76 | Ga0097620_100001422 | 3300006931 | Bacteria | 24299 |
| 77 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 78 | Ga0105244_10002659 | 3300009036 | Bacteria | 13391 |
| 79 | Ga0105243_10076171 | 3300009148 | Bacteria | 2725 |
| 80 | Ga0105242_10091014 | 3300009176 | Unclassified | 2567 |
| 81 | Ga0105248_10065661 | 3300009177 | Bacteria | 4074 |
| 82 | Ga0105238_10460173 | 3300009551 | Bacteria | 1270 |
| 83 | Ga0157371_10000026 | 3300013102 | Bacteria | 274703 |
| 84 | Ga0157374_10439844 | 3300013296 | Bacteria | 1304 |
| 85 | Ga0163162_10017462 | 3300013306 | Bacteria | 7020 |
| 86 | Ga0163162_10147621 | 3300013306 | Bacteria | 2468 |
| 87 | Ga0157375_10231092 | 3300013308 | Bacteria | 2009 |
| 88 | Ga0163163_10015841 | 3300014325 | Bacteria | 6983 |
| 89 | Ga0157380_10049131 | 3300014326 | Bacteria | 3326 |
| 90 | Ga0182008_10004711 | 3300014497 | Bacteria | 7910 |
| 91 | Ga0182008_10027096 | 3300014497 | Bacteria | 2905 |
| 92 | Ga0157376_10126687 | 3300014969 | Bacteria | 2272 |
| 93 | Ga0182006_1000029 | 3300015261 | Bacteria | 247579 |
| 94 | Ga0182006_1026492 | 3300015261 | Bacteria | 2372 |
| 95 | Ga0182007_10000997 | 3300015262 | Bacteria | 15535 |
| 96 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 97 | Ga0182005_1000012 | 3300015265 | Bacteria | 396944 |
| 98 | Ga0163161_10060543 | 3300017792 | Bacteria | 2756 |
| 99 | Ga0163161_10110159 | 3300017792 | Bacteria | 2058 |
| 100 | Ga0213872_10000032 | 3300021361 | Bacteria | 138939 |
| 101 | Ga0209436_100484 | 3300025208 | Bacteria | 17563 |
| 102 | Ga0209436_111393 | 3300025208 | Bacteria | 1564 |
| 103 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 104 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 105 | Ga0207425_1000130 | 3300025245 | Bacteria | 70791 |
| 106 | Ga0207425_1000132 | 3300025245 | Bacteria | 68018 |
| 107 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 108 | Ga0209677_108796 | 3300025253 | Bacteria | 1898 |
| 109 | Ga0209148_1005446 | 3300025254 | Bacteria | 2918 |
| 110 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 111 | Ga0209129_1009156 | 3300025258 | Bacteria | 2649 |
| 112 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 113 | Ga0209565_1003147 | 3300025263 | Bacteria | 5511 |
| 114 | Ga0209565_1003288 | 3300025263 | Bacteria | 5312 |
| 115 | Ga0209565_1004100 | 3300025263 | Bacteria | 4538 |
| 116 | Ga0209565_1006959 | 3300025263 | Bacteria | 3106 |
| 117 | Ga0209565_1017245 | 3300025263 | Bacteria | 1587 |
| 118 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 119 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 120 | Ga0209673_1014177 | 3300025273 | Bacteria | 3096 |
| 121 | Ga0209673_1033525 | 3300025273 | Bacteria | 1564 |
| 122 | Ga0209130_1000084 | 3300025284 | Bacteria | 160070 |
| 123 | Ga0209130_1000237 | 3300025284 | Bacteria | 70739 |
| 124 | Ga0209130_1004662 | 3300025284 | Bacteria | 5089 |
| 125 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 126 | Ga0209675_1006952 | 3300025291 | Bacteria | 4438 |
| 127 | Ga0209675_1013840 | 3300025291 | Bacteria | 2493 |
| 128 | Ga0209025_1006230 | 3300025294 | Bacteria | 9350 |
| 129 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 130 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 131 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 132 | Ga0209564_1000311 | 3300025295 | Bacteria | 95587 |
| 133 | Ga0209564_1005699 | 3300025295 | Bacteria | 6983 |
| 134 | Ga0209564_1007930 | 3300025295 | Bacteria | 5355 |
| 135 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 136 | Ga0209758_1000757 | 3300025297 | Bacteria | 46825 |
| 137 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 138 | Ga0209050_1000164 | 3300025298 | Bacteria | 154628 |
| 139 | Ga0209050_1000664 | 3300025298 | Bacteria | 52795 |
| 140 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 141 | Ga0209256_1000068 | 3300025299 | Bacteria | 246064 |
| 142 | Ga0209256_1000395 | 3300025299 | Bacteria | 69343 |
| 143 | Ga0209256_1000952 | 3300025299 | Bacteria | 35118 |
| 144 | Ga0209256_1003000 | 3300025299 | Bacteria | 12538 |
| 145 | Ga0207426_1003864 | 3300025302 | Bacteria | 7725 |
| 146 | Ga0207426_1058678 | 3300025302 | Bacteria | 1116 |
| 147 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 148 | Ga0209257_1016232 | 3300025304 | Bacteria | 3027 |
| 149 | Ga0207697_10040931 | 3300025315 | Bacteria | 1902 |
| 150 | Ga0207655_1004019 | 3300025728 | Bacteria | 10620 |
| 151 | Ga0207682_10005733 | 3300025893 | Bacteria | 5037 |
| 152 | Ga0207682_10006232 | 3300025893 | Bacteria | 4818 |
| 153 | Ga0207680_10002181 | 3300025903 | Bacteria | 9174 |
| 154 | Ga0207645_10119665 | 3300025907 | Bacteria | 1709 |
| 155 | Ga0207705_10001990 | 3300025909 | Bacteria | 15883 |
| 156 | Ga0207705_10072000 | 3300025909 | Bacteria | 2506 |
| 157 | Ga0207705_10183385 | 3300025909 | Bacteria | 1580 |
| 158 | Ga0207654_10023184 | 3300025911 | Bacteria | 3321 |
| 159 | Ga0207662_10012947 | 3300025918 | Bacteria | 4657 |
| 160 | Ga0207681_10015030 | 3300025923 | Bacteria | 4824 |
| 161 | Ga0207644_10014885 | 3300025931 | Bacteria | 5214 |
| 162 | Ga0207706_10080716 | 3300025933 | Bacteria | 2859 |
| 163 | Ga0207709_10054405 | 3300025935 | Bacteria | 2468 |
| 164 | Ga0207669_10123980 | 3300025937 | Bacteria | 1760 |
| 165 | Ga0207691_10088615 | 3300025940 | Bacteria | 2775 |
| 166 | Ga0207691_10111128 | 3300025940 | Bacteria | 2437 |
| 167 | Ga0207711_10027897 | 3300025941 | Bacteria | 4746 |
| 168 | Ga0207679_10040362 | 3300025945 | Bacteria | 3340 |
| 169 | Ga0207679_10077164 | 3300025945 | Bacteria | 2533 |
| 170 | Ga0207679_10199365 | 3300025945 | Bacteria | 1671 |
| 171 | Ga0207667_10001048 | 3300025949 | Bacteria | 35209 |
| 172 | Ga0207651_10031915 | 3300025960 | Bacteria | 3374 |
| 173 | Ga0207677_10002910 | 3300026023 | Bacteria | 9042 |
| 174 | Ga0207703_10007134 | 3300026035 | Bacteria | 8892 |
| 175 | Ga0207641_10004402 | 3300026088 | Bacteria | 12205 |
| 176 | Ga0207641_10218363 | 3300026088 | Bacteria | 1767 |
| 177 | Ga0207648_10119713 | 3300026089 | Bacteria | 2314 |
| 178 | Ga0207648_10170142 | 3300026089 | Bacteria | 1926 |
| 179 | Ga0207676_10003508 | 3300026095 | Bacteria | 11098 |
| 180 | Ga0207675_100010028 | 3300026118 | Bacteria | 8878 |
| 181 | Ga0207675_100175568 | 3300026118 | Bacteria | 2050 |
| 182 | Ga0207683_10006519 | 3300026121 | Bacteria | 9994 |
| 183 | Ga0207683_10355145 | 3300026121 | Bacteria | 1346 |
| 184 | Ga0207698_10081845 | 3300026142 | Bacteria | 2608 |
| 185 | Ga0209281_1003014 | 3300027111 | Bacteria | 5967 |
| 186 | Ga0209281_1005961 | 3300027111 | Bacteria | 3257 |
| 187 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 188 | Ga0268266_10187480 | 3300028379 | Bacteria | 1887 |
| 189 | Ga0268265_10081584 | 3300028380 | Bacteria | 2554 |
| 190 | Ga0307515_10241205 | 3300028794 | Bacteria | 1578 |
| 191 | Ga0316180_1112319 | 3300030736 | Bacteria | 1632 |
| 192 | Ga0316181_1216539 | 3300030744 | Bacteria | 1218 |
| 193 | Ga0307408_100001129 | 3300031548 | Bacteria | 20315 |
| 194 | Ga0307408_100001185 | 3300031548 | Bacteria | 19736 |
| 195 | Ga0307408_100003316 | 3300031548 | Bacteria | 11066 |
| 196 | Ga0307416_100084493 | 3300032002 | Bacteria | 2697 |
| 197 | Ga0307414_10003286 | 3300032004 | Bacteria | 8617 |
| 198 | Ga0373952_0002402 | 3300035092 | Bacteria | 3375 |
| 199 | Ga0373935_0161480 | 3300035692 | Bacteria | 1528 |
| 200 | Ga0395899_0004735 | 3300037312 | Bacteria | 10613 |
| 201 | Ga0395899_0005686 | 3300037312 | Bacteria | 9680 |
| 202 | Ga0395899_0010310 | 3300037312 | Bacteria | 7165 |
| 203 | Ga0395899_0091327 | 3300037312 | Bacteria | 2206 |
| 204 | Ga0395900_0002091 | 3300037418 | Bacteria | 22383 |
| 205 | Ga0395900_0003097 | 3300037418 | Bacteria | 18057 |
| 206 | Ga0395900_0003147 | 3300037418 | Bacteria | 17898 |
| 207 | Ga0395900_0080938 | 3300037418 | Bacteria | 3337 |
| 208 | Ga0395898_0011645 | 3300037466 | Bacteria | 9124 |
| 209 | Ga0395898_0017086 | 3300037466 | Bacteria | 7410 |
| 210 | Ga0395898_0031587 | 3300037466 | Bacteria | 5290 |
| 211 | Ga0395898_0091283 | 3300037466 | Bacteria | 2930 |
| 212 | Ga0395905_0013949 | 3300037471 | Bacteria | 7685 |
| 213 | Ga0395905_0015250 | 3300037471 | Bacteria | 7306 |
| 214 | Ga0395905_0055941 | 3300037471 | Bacteria | 3692 |
| 215 | Ga0395905_0059785 | 3300037471 | Bacteria | 3563 |
| 216 | Ga0395905_0149117 | 3300037471 | Bacteria | 2200 |
| 217 | Ga0395905_0436863 | 3300037471 | Bacteria | 1206 |
| 218 | Ga0395901_0000212 | 3300038443 | Bacteria | 73375 |
| 219 | Ga0395901_0000522 | 3300038443 | Bacteria | 44365 |
| 220 | Ga0395901_0229464 | 3300038443 | Bacteria | 1938 |
| 221 | Ga0436360_1203167 | 3300039438 | Bacteria | 839 |
| 222 | Ga0436361_0168778 | 3300039447 | Bacteria | 51987 |
| 223 | Ga0436361_0993359 | 3300039447 | Bacteria | 43823 |
| 224 | Ga0439448_0016603 | 3300042005 | Bacteria | 2241 |
| 225 | Ga0439449_0024840 | 3300042007 | Bacteria | 2240 |
| 226 | Ga0439450_011670 | 3300042008 | Bacteria | 1726 |
| 227 | Ga0439450_043299 | 3300042008 | Bacteria | 1051 |
| 228 | Ga0439455_0006438 | 3300042012 | Bacteria | 2437 |
| 229 | Ga0450897_001616 | 3300042128 | Bacteria | 1561 |
| 230 | Ga0466972_0023087 | 3300044658 | Bacteria | 3095 |
| 231 | Ga0466965_0009082 | 3300044683 | Bacteria | 4611 |
| 232 | Ga0466965_0016185 | 3300044683 | Bacteria | 3545 |
| 233 | Ga0466965_0024959 | 3300044683 | Bacteria | 2892 |
| 234 | Ga0466966_0000457 | 3300044684 | Bacteria | 26267 |
| 235 | Ga0466966_0019594 | 3300044684 | Bacteria | 4451 |
| 236 | Ga0466966_0065376 | 3300044684 | Bacteria | 2287 |
| 237 | Ga0466966_0132664 | 3300044684 | Bacteria | 1524 |
| 238 | Ga0466966_0145256 | 3300044684 | Bacteria | 1448 |
| 239 | Ga0466961_0009150 | 3300044693 | Bacteria | 6307 |
| 240 | Ga0466961_0027393 | 3300044693 | Bacteria | 3665 |
| 241 | Ga0466963_0207435 | 3300044694 | Bacteria | 1371 |
| 242 | Ga0466964_0000435 | 3300044706 | Bacteria | 12697 |
| 243 | Ga0466964_0002446 | 3300044706 | Bacteria | 6605 |
| 244 | Ga0466964_0014920 | 3300044706 | Bacteria | 2959 |
| 245 | Ga0466968_0001497 | 3300044735 | Bacteria | 8367 |
| 246 | Ga0466968_0043937 | 3300044735 | Bacteria | 1893 |
| 247 | Ga0466970_0024531 | 3300044765 | Bacteria | 3154 |
| 248 | Ga0466970_0095349 | 3300044765 | Bacteria | 1617 |
| 249 | Ga0466957_0000114 | 3300044842 | Bacteria | 33158 |
| 250 | Ga0466957_0012400 | 3300044842 | Bacteria | 4933 |
| 251 | Ga0466957_0027382 | 3300044842 | Bacteria | 3387 |
| 252 | Ga0466960_0067601 | 3300044901 | Bacteria | 1770 |
| 253 | Ga0466959_0005057 | 3300045049 | Bacteria | 8964 |
| 254 | Ga0466959_0025010 | 3300045049 | Bacteria | 4423 |
| 255 | Ga0466959_0030580 | 3300045049 | Bacteria | 3988 |
| 256 | Ga0451576_0017483 | 3300045051 | Bacteria | 7883 |
| 257 | Ga0466967_0030085 | 3300045976 | Bacteria | 4553 |
| 258 | Ga0495617_000042 | 3300046452 | Bacteria | 122225 |
| 259 | Ga0495617_000063 | 3300046452 | Bacteria | 95793 |
| 260 | Ga0495617_037565 | 3300046452 | Bacteria | 1621 |
| 261 | Ga0495627_000057 | 3300046453 | Bacteria | 144773 |
| 262 | Ga0495627_000323 | 3300046453 | Bacteria | 46699 |
| 263 | Ga0495627_003505 | 3300046453 | Bacteria | 6881 |
| 264 | Ga0495590_0000010 | 3300046457 | Bacteria | 317890 |
| 265 | Ga0495590_0000837 | 3300046457 | Bacteria | 13900 |
| 266 | Ga0495590_0002387 | 3300046457 | Bacteria | 7779 |
| 267 | Ga0495590_0062336 | 3300046457 | Bacteria | 1305 |
| 268 | Ga0495629_0017851 | 3300046459 | Bacteria | 5085 |
| 269 | Ga0495629_0035318 | 3300046459 | Bacteria | 3532 |
| 270 | Ga0495638_0000027 | 3300046460 | Bacteria | 337569 |
| 271 | Ga0495638_0020283 | 3300046460 | Bacteria | 4392 |
| 272 | Ga0495638_0020825 | 3300046460 | Bacteria | 4331 |
| 273 | Ga0495638_0024603 | 3300046460 | Bacteria | 3924 |
| 274 | Ga0495638_0048379 | 3300046460 | Bacteria | 2662 |
| 275 | Ga0495638_0056006 | 3300046460 | Bacteria | 2447 |
| 276 | Ga0495653_0004474 | 3300046463 | Bacteria | 11286 |
| 277 | Ga0495653_0035700 | 3300046463 | Bacteria | 3921 |
| 278 | Ga0495653_0066832 | 3300046463 | Bacteria | 2702 |
| 279 | Ga0495653_0112559 | 3300046463 | Bacteria | 1953 |
| 280 | Ga0495650_0000044 | 3300046471 | Bacteria | 355139 |
| 281 | Ga0495650_0000066 | 3300046471 | Bacteria | 272883 |
| 282 | Ga0495650_0000229 | 3300046471 | Bacteria | 114086 |
| 283 | Ga0495650_0001129 | 3300046471 | Bacteria | 29018 |
| 284 | Ga0495650_0003132 | 3300046471 | Bacteria | 12383 |
| 285 | Ga0495650_0017307 | 3300046471 | Bacteria | 3617 |
| 286 | Ga0495650_0030602 | 3300046471 | Bacteria | 2435 |
| 287 | Ga0495582_0020516 | 3300046473 | Bacteria | 3618 |
| 288 | Ga0495605_0000027 | 3300046474 | Bacteria | 220680 |
| 289 | Ga0495605_0000049 | 3300046474 | Bacteria | 166669 |
| 290 | Ga0495605_0000130 | 3300046474 | Bacteria | 98652 |
| 291 | Ga0495605_0009901 | 3300046474 | Bacteria | 5345 |
| 292 | Ga0495605_0012517 | 3300046474 | Bacteria | 4703 |
| 293 | Ga0495605_0030705 | 3300046474 | Bacteria | 2752 |
| 294 | Ga0495605_0037262 | 3300046474 | Bacteria | 2447 |
| 295 | Ga0495605_0050378 | 3300046474 | Bacteria | 2031 |
| 296 | Ga0495605_0062472 | 3300046474 | Bacteria | 1779 |
| 297 | Ga0495605_0091000 | 3300046474 | Bacteria | 1414 |
| 298 | Ga0495639_0013547 | 3300046475 | Bacteria | 3524 |
| 299 | Ga0495584_0000001 | 3300046491 | Bacteria | 649329 |
| 300 | Ga0495584_0000137 | 3300046491 | Bacteria | 50397 |
| 301 | Ga0495584_0000164 | 3300046491 | Bacteria | 46886 |
| 302 | Ga0495584_0001830 | 3300046491 | Bacteria | 12360 |
| 303 | Ga0495584_0007483 | 3300046491 | Bacteria | 5693 |
| 304 | Ga0495584_0008092 | 3300046491 | Bacteria | 5463 |
| 305 | Ga0495584_0010845 | 3300046491 | Bacteria | 4676 |
| 306 | Ga0495584_0122624 | 3300046491 | Bacteria | 1316 |
| 307 | Ga0495584_0138294 | 3300046491 | Bacteria | 1236 |
| 308 | Ga0495585_0000003 | 3300046492 | Bacteria | 406344 |
| 309 | Ga0495585_0000011 | 3300046492 | Bacteria | 210440 |
| 310 | Ga0495585_0000040 | 3300046492 | Bacteria | 130615 |
| 311 | Ga0495585_0000233 | 3300046492 | Bacteria | 57350 |
| 312 | Ga0495585_0000365 | 3300046492 | Bacteria | 43900 |
| 313 | Ga0495585_0000385 | 3300046492 | Bacteria | 42521 |
| 314 | Ga0495585_0000486 | 3300046492 | Bacteria | 37724 |
| 315 | Ga0495585_0002878 | 3300046492 | Bacteria | 11968 |
| 316 | Ga0495585_0004384 | 3300046492 | Bacteria | 9162 |
| 317 | Ga0495585_0046779 | 3300046492 | Bacteria | 2411 |
| 318 | Ga0495585_0048301 | 3300046492 | Bacteria | 2366 |
| 319 | Ga0495585_0106325 | 3300046492 | Bacteria | 1496 |
| 320 | Ga0495594_0001143 | 3300046499 | Bacteria | 13853 |
| 321 | Ga0495594_0024171 | 3300046499 | Bacteria | 3261 |
| 322 | Ga0495594_0062918 | 3300046499 | Bacteria | 2055 |
| 323 | Ga0495594_0076177 | 3300046499 | Bacteria | 1870 |
| 324 | Ga0495594_0148906 | 3300046499 | Bacteria | 1328 |
| 325 | Ga0495596_0000106 | 3300046500 | Bacteria | 59325 |
| 326 | Ga0495596_0000424 | 3300046500 | Bacteria | 27006 |
| 327 | Ga0495596_0001138 | 3300046500 | Bacteria | 15633 |
| 328 | Ga0495596_0001319 | 3300046500 | Bacteria | 14292 |
| 329 | Ga0495596_0006923 | 3300046500 | Bacteria | 5163 |
| 330 | Ga0495596_0014663 | 3300046500 | Bacteria | 3299 |
| 331 | Ga0495596_0018568 | 3300046500 | Bacteria | 2864 |
| 332 | Ga0495596_0020523 | 3300046500 | Bacteria | 2704 |
| 333 | Ga0495596_0075812 | 3300046500 | Bacteria | 1306 |
| 334 | Ga0495607_0001405 | 3300046501 | Bacteria | 21429 |
| 335 | Ga0495607_0001669 | 3300046501 | Bacteria | 19202 |
| 336 | Ga0495607_0002038 | 3300046501 | Bacteria | 16919 |
| 337 | Ga0495607_0005509 | 3300046501 | Bacteria | 9041 |
| 338 | Ga0495607_0006690 | 3300046501 | Bacteria | 8074 |
| 339 | Ga0495607_0006835 | 3300046501 | Bacteria | 7961 |
| 340 | Ga0495607_0058664 | 3300046501 | Bacteria | 2199 |
| 341 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 342 | Ga0495583_0000095 | 3300046506 | Bacteria | 152114 |
| 343 | Ga0495583_0000117 | 3300046506 | Bacteria | 135061 |
| 344 | Ga0495583_0000381 | 3300046506 | Bacteria | 68754 |
| 345 | Ga0495583_0000551 | 3300046506 | Bacteria | 52385 |
| 346 | Ga0495583_0004237 | 3300046506 | Bacteria | 10405 |
| 347 | Ga0495583_0008753 | 3300046506 | Bacteria | 6141 |
| 348 | Ga0495583_0011133 | 3300046506 | Bacteria | 5183 |
| 349 | Ga0495583_0015640 | 3300046506 | Bacteria | 4116 |
| 350 | Ga0495583_0029846 | 3300046506 | Bacteria | 2663 |
| 351 | Ga0495583_0046412 | 3300046506 | Bacteria | 2003 |
| 352 | Ga0495583_0113016 | 3300046506 | Bacteria | 1149 |
| 353 | Ga0495606_0000125 | 3300046507 | Bacteria | 130102 |
| 354 | Ga0495606_0000128 | 3300046507 | Bacteria | 128179 |
| 355 | Ga0495606_0000557 | 3300046507 | Bacteria | 59505 |
| 356 | Ga0495606_0001131 | 3300046507 | Bacteria | 38024 |
| 357 | Ga0495606_0001352 | 3300046507 | Bacteria | 33283 |
| 358 | Ga0495606_0005861 | 3300046507 | Bacteria | 11582 |
| 359 | Ga0495606_0007239 | 3300046507 | Bacteria | 9999 |
| 360 | Ga0495606_0022454 | 3300046507 | Bacteria | 4597 |
| 361 | Ga0495606_0042627 | 3300046507 | Bacteria | 3033 |
| 362 | Ga0495606_0050520 | 3300046507 | Bacteria | 2720 |
| 363 | Ga0495606_0164429 | 3300046507 | Bacteria | 1292 |
| 364 | Ga0495608_0253561 | 3300046511 | Bacteria | 1097 |
| 365 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 366 | Ga0495610_0002638 | 3300046512 | Bacteria | 14832 |
| 367 | Ga0495610_0005058 | 3300046512 | Bacteria | 9508 |
| 368 | Ga0495610_0009097 | 3300046512 | Bacteria | 6328 |
| 369 | Ga0495610_0009298 | 3300046512 | Bacteria | 6230 |
| 370 | Ga0495610_0107015 | 3300046512 | Bacteria | 1244 |
| 371 | Ga0495616_0000075 | 3300046513 | Bacteria | 84686 |
| 372 | Ga0495616_0000170 | 3300046513 | Bacteria | 56058 |
| 373 | Ga0495616_0000902 | 3300046513 | Bacteria | 21420 |
| 374 | Ga0495616_0001358 | 3300046513 | Bacteria | 17066 |
| 375 | Ga0495616_0003193 | 3300046513 | Bacteria | 10572 |
| 376 | Ga0495616_0005436 | 3300046513 | Bacteria | 7841 |
| 377 | Ga0495616_0008471 | 3300046513 | Bacteria | 6090 |
| 378 | Ga0495616_0011720 | 3300046513 | Bacteria | 5010 |
| 379 | Ga0495620_0098836 | 3300046515 | Bacteria | 1165 |
| 380 | Ga0495628_0096240 | 3300046516 | Bacteria | 2287 |
| 381 | Ga0495630_0093605 | 3300046517 | Bacteria | 2271 |
| 382 | Ga0495630_0099341 | 3300046517 | Bacteria | 2202 |
| 383 | Ga0495631_0000417 | 3300046518 | Bacteria | 29338 |
| 384 | Ga0495631_0002592 | 3300046518 | Bacteria | 10111 |
| 385 | Ga0495631_0005682 | 3300046518 | Bacteria | 6506 |
| 386 | Ga0495631_0007774 | 3300046518 | Bacteria | 5440 |
| 387 | Ga0495631_0013672 | 3300046518 | Bacteria | 3933 |
| 388 | Ga0495631_0014256 | 3300046518 | Bacteria | 3840 |
| 389 | Ga0495631_0017463 | 3300046518 | Bacteria | 3394 |
| 390 | Ga0495631_0024430 | 3300046518 | Bacteria | 2790 |
| 391 | Ga0495631_0059670 | 3300046518 | Bacteria | 1656 |
| 392 | Ga0495632_0000057 | 3300046519 | Bacteria | 123635 |
| 393 | Ga0495632_0000091 | 3300046519 | Bacteria | 93600 |
| 394 | Ga0495632_0000201 | 3300046519 | Bacteria | 60697 |
| 395 | Ga0495632_0000358 | 3300046519 | Bacteria | 43419 |
| 396 | Ga0495632_0025745 | 3300046519 | Bacteria | 3108 |
| 397 | Ga0495637_0000067 | 3300046520 | Bacteria | 86002 |
| 398 | Ga0495643_0000022 | 3300046522 | Bacteria | 289691 |
| 399 | Ga0495643_0000065 | 3300046522 | Bacteria | 179031 |
| 400 | Ga0495643_0000094 | 3300046522 | Bacteria | 150795 |
| 401 | Ga0495643_0000326 | 3300046522 | Bacteria | 65454 |
| 402 | Ga0495643_0001487 | 3300046522 | Bacteria | 21325 |
| 403 | Ga0495643_0007451 | 3300046522 | Bacteria | 7049 |
| 404 | Ga0495643_0014799 | 3300046522 | Bacteria | 4632 |
| 405 | Ga0495643_0041640 | 3300046522 | Bacteria | 2504 |
| 406 | Ga0495643_0073832 | 3300046522 | Bacteria | 1787 |
| 407 | Ga0495643_0132751 | 3300046522 | Bacteria | 1248 |
| 408 | Ga0495644_0007237 | 3300046523 | Bacteria | 4290 |
| 409 | Ga0495644_0036002 | 3300046523 | Bacteria | 1867 |
| 410 | Ga0495644_0056542 | 3300046523 | Bacteria | 1474 |
| 411 | Ga0495644_0088409 | 3300046523 | Bacteria | 1168 |
| 412 | Ga0495648_0000011 | 3300046524 | Bacteria | 299518 |
| 413 | Ga0495648_0000078 | 3300046524 | Bacteria | 127397 |
| 414 | Ga0495648_0000883 | 3300046524 | Bacteria | 31505 |
| 415 | Ga0495648_0000928 | 3300046524 | Bacteria | 30479 |
| 416 | Ga0495648_0002119 | 3300046524 | Bacteria | 18687 |
| 417 | Ga0495648_0012722 | 3300046524 | Bacteria | 6254 |
| 418 | Ga0495648_0016036 | 3300046524 | Bacteria | 5410 |
| 419 | Ga0495648_0021870 | 3300046524 | Bacteria | 4417 |
| 420 | Ga0495648_0043528 | 3300046524 | Bacteria | 2813 |
| 421 | Ga0495648_0057531 | 3300046524 | Bacteria | 2331 |
| 422 | Ga0495663_0001726 | 3300046525 | Bacteria | 6785 |
| 423 | Ga0495663_0043871 | 3300046525 | Bacteria | 1367 |
| 424 | Ga0495663_0057552 | 3300046525 | Bacteria | 1216 |
| 425 | Ga0495666_0000160 | 3300046526 | Bacteria | 28558 |
| 426 | Ga0495666_0000267 | 3300046526 | Bacteria | 22575 |
| 427 | Ga0495666_0008547 | 3300046526 | Bacteria | 5132 |
| 428 | Ga0495666_0017645 | 3300046526 | Bacteria | 3553 |
| 429 | Ga0495666_0064778 | 3300046526 | Bacteria | 1744 |
| 430 | Ga0495642_0000012 | 3300046528 | Bacteria | 127229 |
| 431 | Ga0495642_0000128 | 3300046528 | Bacteria | 43466 |
| 432 | Ga0495642_0000439 | 3300046528 | Bacteria | 21933 |
| 433 | Ga0495642_0000919 | 3300046528 | Bacteria | 13828 |
| 434 | Ga0495642_0003382 | 3300046528 | Bacteria | 6297 |
| 435 | Ga0495642_0006493 | 3300046528 | Bacteria | 4487 |
| 436 | Ga0495642_0009466 | 3300046528 | Bacteria | 3728 |
| 437 | Ga0495642_0012229 | 3300046528 | Bacteria | 3307 |
| 438 | Ga0495642_0018438 | 3300046528 | Bacteria | 2732 |
| 439 | Ga0495642_0023585 | 3300046528 | Bacteria | 2429 |
| 440 | Ga0495642_0026918 | 3300046528 | Bacteria | 2286 |
| 441 | Ga0495642_0030434 | 3300046528 | Bacteria | 2159 |
| 442 | Ga0495642_0096280 | 3300046528 | Bacteria | 1256 |
| 443 | Ga0495652_0058522 | 3300046529 | Bacteria | 3262 |
| 444 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 445 | Ga0495654_0010283 | 3300046530 | Bacteria | 5094 |
| 446 | Ga0495654_0023750 | 3300046530 | Bacteria | 3173 |
| 447 | Ga0495654_0028268 | 3300046530 | Bacteria | 2868 |
| 448 | Ga0495654_0032205 | 3300046530 | Bacteria | 2658 |
| 449 | Ga0495654_0072958 | 3300046530 | Bacteria | 1624 |
| 450 | Ga0495654_0078306 | 3300046530 | Bacteria | 1554 |
| 451 | Ga0495665_0003469 | 3300046531 | Bacteria | 8556 |
| 452 | Ga0495665_0018914 | 3300046531 | Bacteria | 3702 |
| 453 | Ga0495665_0039773 | 3300046531 | Bacteria | 2504 |
| 454 | Ga0495640_0148636 | 3300046533 | Bacteria | 1506 |
| 455 | Ga0495586_0016175 | 3300046535 | Bacteria | 3968 |
| 456 | Ga0495586_0021113 | 3300046535 | Bacteria | 3469 |
| 457 | Ga0495586_0108193 | 3300046535 | Bacteria | 1546 |
| 458 | Ga0495586_0128037 | 3300046535 | Bacteria | 1421 |
| 459 | Ga0495587_0014738 | 3300046536 | Bacteria | 4896 |
| 460 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 461 | Ga0495609_0001621 | 3300046538 | Bacteria | 14679 |
| 462 | Ga0495609_0002680 | 3300046538 | Bacteria | 10766 |
| 463 | Ga0495609_0004160 | 3300046538 | Bacteria | 8036 |
| 464 | Ga0495609_0005651 | 3300046538 | Bacteria | 6517 |
| 465 | Ga0495609_0007380 | 3300046538 | Bacteria | 5497 |
| 466 | Ga0495609_0013816 | 3300046538 | Bacteria | 3806 |
| 467 | Ga0495609_0019974 | 3300046538 | Bacteria | 3097 |
| 468 | Ga0495609_0034566 | 3300046538 | Bacteria | 2291 |
| 469 | Ga0495609_0039085 | 3300046538 | Bacteria | 2137 |
| 470 | Ga0495609_0055489 | 3300046538 | Bacteria | 1757 |
| 471 | Ga0495609_0072809 | 3300046538 | Bacteria | 1508 |
| 472 | Ga0495609_0078055 | 3300046538 | Bacteria | 1449 |
| 473 | Ga0495609_0101599 | 3300046538 | Bacteria | 1245 |
| 474 | Ga0495597_0000009 | 3300046542 | Bacteria | 227319 |
| 475 | Ga0495597_0000029 | 3300046542 | Bacteria | 136312 |
| 476 | Ga0495597_0000107 | 3300046542 | Bacteria | 73749 |
| 477 | Ga0495597_0000335 | 3300046542 | Bacteria | 42105 |
| 478 | Ga0495597_0000466 | 3300046542 | Bacteria | 34350 |
| 479 | Ga0495597_0003120 | 3300046542 | Bacteria | 9945 |
| 480 | Ga0495597_0008860 | 3300046542 | Bacteria | 5018 |
| 481 | Ga0495597_0011431 | 3300046542 | Bacteria | 4303 |
| 482 | Ga0495597_0029264 | 3300046542 | Bacteria | 2515 |
| 483 | Ga0495597_0067704 | 3300046542 | Bacteria | 1544 |
| 484 | Ga0495645_0101123 | 3300046543 | Bacteria | 2050 |
| 485 | Ga0495622_0000043 | 3300046557 | Bacteria | 115796 |
| 486 | Ga0495622_0001191 | 3300046557 | Bacteria | 13432 |
| 487 | Ga0495622_0011143 | 3300046557 | Bacteria | 4150 |
| 488 | Ga0495622_0019628 | 3300046557 | Bacteria | 3147 |
| 489 | Ga0495633_0000381 | 3300046558 | Bacteria | 47007 |
| 490 | Ga0495633_0000577 | 3300046558 | Bacteria | 35551 |
| 491 | Ga0495633_0001135 | 3300046558 | Bacteria | 21402 |
| 492 | Ga0495633_0001381 | 3300046558 | Bacteria | 18966 |
| 493 | Ga0495633_0003447 | 3300046558 | Bacteria | 10518 |
| 494 | Ga0495633_0006010 | 3300046558 | Bacteria | 7293 |
| 495 | Ga0495633_0006135 | 3300046558 | Bacteria | 7194 |
| 496 | Ga0495633_0007174 | 3300046558 | Bacteria | 6460 |
| 497 | Ga0495633_0012130 | 3300046558 | Bacteria | 4601 |
| 498 | Ga0495633_0014246 | 3300046558 | Bacteria | 4164 |
| 499 | Ga0495633_0016160 | 3300046558 | Bacteria | 3856 |
| 500 | Ga0495633_0038540 | 3300046558 | Bacteria | 2282 |
| 501 | Ga0495633_0041795 | 3300046558 | Bacteria | 2179 |
| 502 | Ga0495656_0033049 | 3300046615 | Bacteria | 2109 |
| 503 | Ga0495656_0062651 | 3300046615 | Bacteria | 1627 |
| 504 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 505 | Ga0495668_0000027 | 3300046616 | Bacteria | 297194 |
| 506 | Ga0495668_0000096 | 3300046616 | Bacteria | 139693 |
| 507 | Ga0495668_0000180 | 3300046616 | Bacteria | 94157 |
| 508 | Ga0495668_0000429 | 3300046616 | Bacteria | 54505 |
| 509 | Ga0495668_0001010 | 3300046616 | Bacteria | 30202 |
| 510 | Ga0495668_0001031 | 3300046616 | Bacteria | 29510 |
| 511 | Ga0495668_0001648 | 3300046616 | Bacteria | 20817 |
| 512 | Ga0495668_0003280 | 3300046616 | Bacteria | 12289 |
| 513 | Ga0495668_0006316 | 3300046616 | Bacteria | 7797 |
| 514 | Ga0495668_0007037 | 3300046616 | Bacteria | 7257 |
| 515 | Ga0495668_0016242 | 3300046616 | Bacteria | 4327 |
| 516 | Ga0495668_0032675 | 3300046616 | Bacteria | 2926 |
| 517 | Ga0495668_0035888 | 3300046616 | Bacteria | 2779 |
| 518 | Ga0495668_0037133 | 3300046616 | Bacteria | 2727 |
| 519 | Ga0495668_0042122 | 3300046616 | Bacteria | 2542 |
| 520 | Ga0495668_0066935 | 3300046616 | Bacteria | 1976 |
| 521 | Ga0495668_0084778 | 3300046616 | Bacteria | 1737 |
| 522 | Ga0495668_0095069 | 3300046616 | Bacteria | 1631 |
| 523 | Ga0495668_0121559 | 3300046616 | Bacteria | 1428 |
| 524 | Ga0495634_0022518 | 3300046642 | Bacteria | 4439 |
| 525 | Ga0495611_0000437 | 3300046648 | Bacteria | 25695 |
| 526 | Ga0495611_0008801 | 3300046648 | Bacteria | 4270 |
| 527 | Ga0495611_0012180 | 3300046648 | Bacteria | 3655 |
| 528 | Ga0495611_0013380 | 3300046648 | Bacteria | 3493 |
| 529 | Ga0495611_0014600 | 3300046648 | Bacteria | 3358 |
| 530 | Ga0495611_0044894 | 3300046648 | Bacteria | 1977 |
| 531 | Ga0495611_0060529 | 3300046648 | Bacteria | 1720 |
| 532 | Ga0495611_0120645 | 3300046648 | Bacteria | 1222 |
| 533 | Ga0495625_0000053 | 3300046660 | Bacteria | 190575 |
| 534 | Ga0495625_0002139 | 3300046660 | Bacteria | 21993 |
| 535 | Ga0495625_0008684 | 3300046660 | Bacteria | 8631 |
| 536 | Ga0495625_0009670 | 3300046660 | Bacteria | 8036 |
| 537 | Ga0495625_0009909 | 3300046660 | Bacteria | 7924 |
| 538 | Ga0495625_0018522 | 3300046660 | Bacteria | 5433 |
| 539 | Ga0495625_0025290 | 3300046660 | Bacteria | 4504 |
| 540 | Ga0495625_0047439 | 3300046660 | Bacteria | 3097 |
| 541 | Ga0495625_0050151 | 3300046660 | Bacteria | 2996 |
| 542 | Ga0495625_0054292 | 3300046660 | Bacteria | 2862 |
| 543 | Ga0495625_0088900 | 3300046660 | Bacteria | 2139 |
| 544 | Ga0495625_0098309 | 3300046660 | Bacteria | 2013 |
| 545 | Ga0495625_0206796 | 3300046660 | Bacteria | 1292 |
| 546 | Ga0495659_0000001 | 3300046664 | Bacteria | 325846 |
| 547 | Ga0495659_0017668 | 3300046664 | Bacteria | 2367 |
| 548 | Ga0495661_0000023 | 3300046665 | Bacteria | 189053 |
| 549 | Ga0495661_0000148 | 3300046665 | Bacteria | 81610 |
| 550 | Ga0495661_0000287 | 3300046665 | Bacteria | 57151 |
| 551 | Ga0495661_0003345 | 3300046665 | Bacteria | 11883 |
| 552 | Ga0495661_0004688 | 3300046665 | Bacteria | 9819 |
| 553 | Ga0495661_0025832 | 3300046665 | Bacteria | 3788 |
| 554 | Ga0495661_0033305 | 3300046665 | Bacteria | 3251 |
| 555 | Ga0495661_0049687 | 3300046665 | Bacteria | 2542 |
| 556 | Ga0495661_0051076 | 3300046665 | Bacteria | 2498 |
| 557 | Ga0495661_0057062 | 3300046665 | Bacteria | 2333 |
| 558 | Ga0495661_0061447 | 3300046665 | Bacteria | 2230 |
| 559 | Ga0495661_0102466 | 3300046665 | Bacteria | 1609 |
| 560 | Ga0495661_0174753 | 3300046665 | Bacteria | 1142 |
| 561 | Ga0495588_0000041 | 3300046674 | Bacteria | 377896 |
| 562 | Ga0495588_0003113 | 3300046674 | Bacteria | 7178 |
| 563 | Ga0495588_0020102 | 3300046674 | Bacteria | 3276 |
| 564 | Ga0495588_0094174 | 3300046674 | Bacteria | 1570 |
| 565 | Ga0495588_0136839 | 3300046674 | Bacteria | 1293 |
| 566 | Ga0495588_0161383 | 3300046674 | Bacteria | 1185 |
| 567 | Ga0495623_0010749 | 3300046679 | Bacteria | 5926 |
| 568 | Ga0495623_0051175 | 3300046679 | Bacteria | 2614 |
| 569 | Ga0495623_0070655 | 3300046679 | Bacteria | 2174 |
| 570 | Ga0495646_0081670 | 3300046680 | Bacteria | 1883 |
| 571 | Ga0495646_0108020 | 3300046680 | Bacteria | 1587 |
| 572 | Ga0495658_0002916 | 3300046683 | Bacteria | 8587 |
| 573 | Ga0495669_0000017 | 3300046684 | Bacteria | 131447 |
| 574 | Ga0495669_0000429 | 3300046684 | Bacteria | 19950 |
| 575 | Ga0495669_0000484 | 3300046684 | Bacteria | 18421 |
| 576 | Ga0495669_0009083 | 3300046684 | Bacteria | 4189 |
| 577 | Ga0495613_0016878 | 3300046689 | Bacteria | 5436 |
| 578 | Ga0495624_0006051 | 3300046690 | Bacteria | 8629 |
| 579 | Ga0495670_0000122 | 3300046691 | Bacteria | 33678 |
| 580 | Ga0495670_0001433 | 3300046691 | Bacteria | 11688 |
| 581 | Ga0495670_0001786 | 3300046691 | Bacteria | 10557 |
| 582 | Ga0495670_0010563 | 3300046691 | Bacteria | 4538 |
| 583 | Ga0495670_0019050 | 3300046691 | Bacteria | 3382 |
| 584 | Ga0495670_0036181 | 3300046691 | Bacteria | 2460 |
| 585 | Ga0495670_0036802 | 3300046691 | Bacteria | 2439 |
| 586 | Ga0495670_0086930 | 3300046691 | Bacteria | 1597 |
| 587 | Ga0495670_0117606 | 3300046691 | Bacteria | 1379 |
| 588 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 589 | Ga0495671_0000035 | 3300046692 | Bacteria | 188543 |
| 590 | Ga0495671_0000140 | 3300046692 | Bacteria | 63602 |
| 591 | Ga0495671_0002321 | 3300046692 | Bacteria | 12087 |
| 592 | Ga0495671_0009573 | 3300046692 | Bacteria | 5408 |
| 593 | Ga0495671_0016243 | 3300046692 | Bacteria | 3978 |
| 594 | Ga0495671_0047593 | 3300046692 | Bacteria | 2142 |
| 595 | Ga0495671_0048524 | 3300046692 | Bacteria | 2118 |
| 596 | Ga0495649_0002789 | 3300046694 | Bacteria | 12166 |
| 597 | Ga0495649_0028441 | 3300046694 | Bacteria | 3098 |
| 598 | Ga0495589_0000027 | 3300046794 | Bacteria | 181084 |
| 599 | Ga0495589_0000102 | 3300046794 | Bacteria | 82380 |
| 600 | Ga0495589_0000600 | 3300046794 | Bacteria | 24459 |
| 601 | Ga0495589_0003377 | 3300046794 | Bacteria | 8654 |
| 602 | Ga0495589_0005590 | 3300046794 | Bacteria | 6629 |
| 603 | Ga0495589_0016821 | 3300046794 | Bacteria | 3755 |
| 604 | Ga0495589_0040644 | 3300046794 | Bacteria | 2321 |
| 605 | Ga0495589_0114346 | 3300046794 | Bacteria | 1301 |
| 606 | Ga0495600_0047066 | 3300046809 | Bacteria | 2813 |
| 607 | Ga0495660_0000069 | 3300046810 | Bacteria | 115654 |
| 608 | Ga0495660_0000132 | 3300046810 | Bacteria | 81849 |
| 609 | Ga0495660_0001231 | 3300046810 | Bacteria | 17853 |
| 610 | Ga0495660_0003475 | 3300046810 | Bacteria | 9727 |
| 611 | Ga0495660_0018729 | 3300046810 | Bacteria | 3976 |
| 612 | Ga0495660_0022256 | 3300046810 | Bacteria | 3619 |
| 613 | Ga0495660_0025019 | 3300046810 | Bacteria | 3393 |
| 614 | Ga0495660_0031928 | 3300046810 | Bacteria | 2958 |
| 615 | Ga0495660_0036753 | 3300046810 | Bacteria | 2730 |
| 616 | Ga0495660_0056861 | 3300046810 | Bacteria | 2112 |
| 617 | Ga0495660_0080464 | 3300046810 | Bacteria | 1709 |
| 618 | Ga0495660_0182145 | 3300046810 | Bacteria | 1015 |
| 619 | Ga0495581_0004532 | 3300047315 | Bacteria | 8026 |
| 620 | Ga0495581_0043781 | 3300047315 | Bacteria | 2589 |
| 621 | Ga0495604_0019344 | 3300047317 | Bacteria | 5451 |
| 622 | Ga0495604_0050325 | 3300047317 | Bacteria | 3235 |
| 623 | Ga0495636_0003615 | 3300047318 | Bacteria | 5997 |
| 624 | Ga0495636_0004270 | 3300047318 | Bacteria | 5605 |
| 625 | Ga0495636_0011926 | 3300047318 | Bacteria | 3444 |
| 626 | Ga0495674_0002798 | 3300047319 | Bacteria | 16935 |
| 627 | Ga0495672_0000022 | 3300047320 | Bacteria | 420632 |
| 628 | Ga0495672_0000066 | 3300047320 | Bacteria | 193318 |
| 629 | Ga0495672_0000095 | 3300047320 | Bacteria | 143883 |
| 630 | Ga0495672_0000231 | 3300047320 | Bacteria | 79748 |
| 631 | Ga0495672_0003237 | 3300047320 | Bacteria | 14136 |
| 632 | Ga0495672_0005035 | 3300047320 | Bacteria | 10569 |
| 633 | Ga0495672_0022297 | 3300047320 | Bacteria | 4119 |
| 634 | Ga0495676_0000017 | 3300047321 | Bacteria | 181815 |
| 635 | Ga0495676_0033969 | 3300047321 | Bacteria | 4285 |
| 636 | Ga0495676_0074145 | 3300047321 | Bacteria | 2607 |
| 637 | Ga0495680_0006458 | 3300047322 | Bacteria | 10889 |
| 638 | Ga0495680_0134329 | 3300047322 | Bacteria | 1815 |
| 639 | Ga0495683_0000005 | 3300047323 | Bacteria | 287871 |
| 640 | Ga0495683_0105998 | 3300047323 | Bacteria | 1347 |
| 641 | Ga0495683_0130721 | 3300047323 | Bacteria | 1184 |
| 642 | Ga0495687_000023 | 3300047443 | Bacteria | 317750 |
| 643 | Ga0495687_000027 | 3300047443 | Bacteria | 299689 |
| 644 | Ga0495687_000034 | 3300047443 | Bacteria | 257321 |
| 645 | Ga0495687_000048 | 3300047443 | Bacteria | 205967 |
| 646 | Ga0495687_000524 | 3300047443 | Bacteria | 45771 |
| 647 | Ga0495687_001158 | 3300047443 | Bacteria | 25533 |
| 648 | Ga0495687_002491 | 3300047443 | Bacteria | 14686 |
| 649 | Ga0495687_035282 | 3300047443 | Bacteria | 2250 |
| 650 | Ga0495675_0009439 | 3300047444 | Bacteria | 6070 |
| 651 | Ga0495675_0026728 | 3300047444 | Bacteria | 3680 |
| 652 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 653 | Ga0495677_0000067 | 3300047445 | Bacteria | 55897 |
| 654 | Ga0495677_0000677 | 3300047445 | Bacteria | 13782 |
| 655 | Ga0495677_0005267 | 3300047445 | Bacteria | 4916 |
| 656 | Ga0495677_0005773 | 3300047445 | Bacteria | 4686 |
| 657 | Ga0495677_0005839 | 3300047445 | Bacteria | 4659 |
| 658 | Ga0495677_0005940 | 3300047445 | Bacteria | 4624 |
| 659 | Ga0495677_0011590 | 3300047445 | Bacteria | 3223 |
| 660 | Ga0495677_0014975 | 3300047445 | Bacteria | 2820 |
| 661 | Ga0495677_0039007 | 3300047445 | Bacteria | 1736 |
| 662 | Ga0495679_004242 | 3300047446 | Bacteria | 6661 |
| 663 | Ga0495679_005144 | 3300047446 | Bacteria | 5860 |
| 664 | Ga0495679_006136 | 3300047446 | Bacteria | 5231 |
| 665 | Ga0495679_006944 | 3300047446 | Bacteria | 4797 |
| 666 | Ga0495679_021023 | 3300047446 | Bacteria | 2263 |
| 667 | Ga0495685_009304 | 3300047447 | Bacteria | 3278 |
| 668 | Ga0495685_014627 | 3300047447 | Bacteria | 2668 |
| 669 | Ga0495685_051605 | 3300047447 | Bacteria | 1394 |
| 670 | Ga0495673_0000059 | 3300047469 | Bacteria | 233234 |
| 671 | Ga0495673_0000064 | 3300047469 | Bacteria | 225793 |
| 672 | Ga0495673_0049798 | 3300047469 | Bacteria | 1842 |
| 673 | Ga0495681_0000018 | 3300047470 | Bacteria | 177306 |
| 674 | Ga0495681_0001220 | 3300047470 | Bacteria | 19572 |
| 675 | Ga0495681_0003868 | 3300047470 | Bacteria | 10347 |
| 676 | Ga0495681_0004757 | 3300047470 | Bacteria | 9199 |
| 677 | Ga0495681_0008989 | 3300047470 | Bacteria | 6199 |
| 678 | Ga0495681_0009121 | 3300047470 | Bacteria | 6143 |
| 679 | Ga0495681_0009347 | 3300047470 | Bacteria | 6047 |
| 680 | Ga0495681_0010500 | 3300047470 | Bacteria | 5603 |
| 681 | Ga0495681_0020670 | 3300047470 | Bacteria | 3566 |
| 682 | Ga0495681_0047735 | 3300047470 | Bacteria | 2035 |
| 683 | Ga0495686_0000135 | 3300047472 | Bacteria | 148920 |
| 684 | Ga0495686_0000462 | 3300047472 | Bacteria | 61070 |
| 685 | Ga0495686_0000640 | 3300047472 | Bacteria | 48223 |
| 686 | Ga0495686_0001427 | 3300047472 | Bacteria | 26117 |
| 687 | Ga0495686_0009909 | 3300047472 | Bacteria | 6824 |
| 688 | Ga0495686_0036829 | 3300047472 | Bacteria | 3138 |
| 689 | Ga0495686_0147790 | 3300047472 | Bacteria | 1382 |
| 690 | Ga0495593_0002837 | 3300047673 | Bacteria | 10436 |
| 691 | Ga0495593_0039247 | 3300047673 | Bacteria | 2553 |
| 692 | Ga0495602_0123721 | 3300048088 | Bacteria | 2076 |
| 693 | Ga0495614_0060962 | 3300048089 | Bacteria | 1620 |
| 694 | Ga0495615_0000944 | 3300048090 | Bacteria | 4132 |
| 695 | Ga0495615_0028137 | 3300048090 | Bacteria | 1325 |
| 696 | Ga0495626_0000037 | 3300048091 | Bacteria | 178573 |
| 697 | Ga0495626_0000535 | 3300048091 | Bacteria | 37780 |
| 698 | Ga0495626_0000754 | 3300048091 | Bacteria | 29854 |
| 699 | Ga0495626_0003874 | 3300048091 | Bacteria | 9383 |
| 700 | Ga0495626_0004907 | 3300048091 | Bacteria | 8039 |
| 701 | Ga0495626_0007550 | 3300048091 | Bacteria | 6039 |
| 702 | Ga0495626_0009094 | 3300048091 | Bacteria | 5389 |
| 703 | Ga0495626_0010374 | 3300048091 | Bacteria | 4973 |
| 704 | Ga0495626_0015581 | 3300048091 | Bacteria | 3886 |
| 705 | Ga0495626_0017666 | 3300048091 | Bacteria | 3596 |
| 706 | Ga0495626_0024208 | 3300048091 | Bacteria | 2979 |
| 707 | Ga0495626_0031604 | 3300048091 | Bacteria | 2547 |
| 708 | Ga0495626_0043744 | 3300048091 | Bacteria | 2099 |
| 709 | Ga0495626_0046493 | 3300048091 | Bacteria | 2021 |
| 710 | Ga0495626_0098322 | 3300048091 | Bacteria | 1278 |
| 711 | Ga0496101_0123396 | 3300048904 | Bacteria | 1960 |
| 712 | Ga0496102_0000151 | 3300048905 | Bacteria | 94403 |
| 713 | Ga0496102_0000182 | 3300048905 | Bacteria | 84891 |
| 714 | Ga0496102_0010154 | 3300048905 | Bacteria | 8095 |
| 715 | Ga0496102_0105874 | 3300048905 | Bacteria | 2617 |
| 716 | Ga0496102_0232126 | 3300048905 | Bacteria | 1739 |
| 717 | Ga0496103_0005130 | 3300048906 | Bacteria | 7885 |
| 718 | Ga0496103_0027157 | 3300048906 | Bacteria | 3466 |
| 719 | Ga0496103_0043530 | 3300048906 | Bacteria | 2765 |
| 720 | Ga0496103_0100972 | 3300048906 | Bacteria | 1826 |
| 721 | Ga0496104_0016139 | 3300048907 | Bacteria | 6779 |
| 722 | Ga0496104_0269407 | 3300048907 | Bacteria | 1615 |
| 723 | Ga0496105_0046695 | 3300048908 | Bacteria | 3574 |
| 724 | Ga0496106_0009494 | 3300048909 | Bacteria | 7190 |
| 725 | Ga0496106_0173532 | 3300048909 | Bacteria | 1710 |
| 726 | Ga0496109_0202926 | 3300048912 | Bacteria | 1864 |
| 727 | Ga0496109_0434692 | 3300048912 | Bacteria | 1240 |
| 728 | Ga0496110_0074408 | 3300048913 | Bacteria | 3017 |
| 729 | Ga0496112_0315152 | 3300048915 | Bacteria | 1509 |
| 730 | Ga0496113_0002561 | 3300048916 | Bacteria | 10618 |
| 731 | Ga0496113_0006144 | 3300048916 | Bacteria | 7581 |
| 732 | Ga0496113_0212904 | 3300048916 | Bacteria | 1539 |
| 733 | Ga0496114_0065321 | 3300048917 | Bacteria | 3049 |
| 734 | Ga0496115_0017832 | 3300048918 | Bacteria | 5437 |
| 735 | Ga0496115_0021525 | 3300048918 | Bacteria | 4983 |
| 736 | Ga0496115_0097860 | 3300048918 | Bacteria | 2403 |
| 737 | Ga0496115_0123143 | 3300048918 | Bacteria | 2134 |
| 738 | Ga0496116_0015645 | 3300048919 | Bacteria | 5989 |
| 739 | Ga0496116_0074770 | 3300048919 | Bacteria | 2129 |
| 740 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 741 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 742 | Ga0496121_0007795 | 3300048924 | Bacteria | 12820 |
| 743 | Ga0496121_0011077 | 3300048924 | Bacteria | 10062 |
| 744 | Ga0496121_0305301 | 3300048924 | Bacteria | 1078 |
| 745 | Ga0496122_0000712 | 3300048925 | Bacteria | 65645 |
| 746 | Ga0496122_0003090 | 3300048925 | Bacteria | 22393 |
| 747 | Ga0496122_0013372 | 3300048925 | Bacteria | 8035 |
| 748 | Ga0496122_0014805 | 3300048925 | Bacteria | 7515 |
| 749 | Ga0496122_0075194 | 3300048925 | Bacteria | 2385 |
| 750 | Ga0496123_0000502 | 3300048926 | Bacteria | 67921 |
| 751 | Ga0496123_0005830 | 3300048926 | Bacteria | 12218 |
| 752 | Ga0496123_0020981 | 3300048926 | Bacteria | 5091 |
| 753 | Ga0496123_0065455 | 3300048926 | Bacteria | 2310 |
| 754 | Ga0496124_0003831 | 3300048927 | Bacteria | 18028 |
| 755 | Ga0496124_0012443 | 3300048927 | Bacteria | 8400 |
| 756 | Ga0496124_0029879 | 3300048927 | Bacteria | 4848 |
| 757 | Ga0496124_0065386 | 3300048927 | Bacteria | 3033 |
| 758 | Ga0496124_0132635 | 3300048927 | Bacteria | 1977 |
| 759 | Ga0496124_0180620 | 3300048927 | Bacteria | 1624 |
| 760 | Ga0496124_0220205 | 3300048927 | Bacteria | 1428 |
| 761 | Ga0496125_0017614 | 3300048928 | Bacteria | 6805 |
| 762 | Ga0496125_0034021 | 3300048928 | Bacteria | 4498 |
| 763 | Ga0496125_0213634 | 3300048928 | Bacteria | 1250 |
| 764 | Ga0496126_0030419 | 3300048929 | Bacteria | 5115 |
| 765 | Ga0495678_000100 | 3300049459 | Bacteria | 106118 |
| 766 | Ga0495678_000286 | 3300049459 | Bacteria | 55456 |
| 767 | Ga0495678_000588 | 3300049459 | Bacteria | 34196 |
| 768 | Ga0495678_000705 | 3300049459 | Bacteria | 30390 |
| 769 | Ga0495678_002236 | 3300049459 | Bacteria | 13490 |
| 770 | Ga0495678_003925 | 3300049459 | Bacteria | 8916 |
| 771 | Ga0495682_0000066 | 3300049460 | Bacteria | 97829 |
| 772 | Ga0495682_0001017 | 3300049460 | Bacteria | 16630 |
| 773 | Ga0501222_009165 | 3300049662 | Bacteria | 1310 |
| 774 | Ga0501227_002037 | 3300049665 | Bacteria | 4484 |
| 775 | Ga0501238_002661 | 3300049671 | Bacteria | 2151 |
| 776 | Ga0501249_001440 | 3300049679 | Bacteria | 4903 |
| 777 | Ga0501249_013450 | 3300049679 | Bacteria | 1739 |
| 778 | Ga0501241_012372 | 3300049758 | Bacteria | 1551 |
| 779 | Ga0501269_000423 | 3300049766 | Bacteria | 9533 |
| 780 | Ga0501035_0000866 | 3300049822 | Bacteria | 32272 |
| 781 | Ga0501044_0031874 | 3300049823 | Bacteria | 5544 |
| 782 | Ga0501044_0429043 | 3300049823 | Bacteria | 1231 |
| 783 | Ga0500594_0002295 | 3300053118 | Bacteria | 4147 |
| 784 | Ga0500594_0004222 | 3300053118 | Bacteria | 3168 |
| 785 | Ga0500618_000137 | 3300053125 | Bacteria | 61561 |
| 786 | Ga0500618_009677 | 3300053125 | Bacteria | 2622 |
| 787 | Ga0500559_0000249 | 3300053136 | Bacteria | 42713 |
| 788 | Ga0500586_000227 | 3300053145 | Bacteria | 11155 |
| 789 | Ga0500586_001150 | 3300053145 | Bacteria | 5489 |
| 790 | Ga0500587_001548 | 3300053739 | Bacteria | 3270 |
| 791 | 2547373026 | 2547132103 | Bacteria | 5115736 |
| 792 | 2643792135 | 2643221554 | Bacteria | 6603920 |
| 793 | 2643799142 | 2643221556 | Bacteria | 7251154 |
| 794 | 2644212112 | 2643221638 | Bacteria | 6579467 |
| 795 | 2644251528 | 2643221645 | Bacteria | 7207331 |
| 796 | 2644357398 | 2643221664 | Bacteria | 7272945 |
| 797 | 2644473527 | 2643221684 | Bacteria | 7145183 |
| 798 | 2738739989 | 2738541280 | Bacteria | 6630198 |
| 799 | 2738828589 | 2738541297 | Bacteria | 6549566 |
| 800 | 2738844256 | 2738541300 | Bacteria | 6675882 |
| 801 | 2739152385 | 2738541357 | Bacteria | 6549408 |
| 802 | 2739194305 | 2738543003 | Bacteria | 6549560 |
| 803 | 2739274184 | 2738543018 | Bacteria | 6718814 |
| 804 | 2739320781 | 2738543026 | Bacteria | 6549408 |
| 805 | 2739339022 | 2738543029 | Bacteria | 6549249 |
| 806 | 2739343228 | 2738543030 | Bacteria | 6719714 |
| 807 | 2809142964 | 2808606418 | Bacteria | 6724496 |
| 808 | 2842717562 | 2842711865 | Bacteria | 7155354 |
| 809 | 2843693368 | 2843690924 | Bacteria | 5169057 |
| 810 | 2846035068 | 2846033681 | Bacteria | 4377894 |
| 811 | 2857550097 | 2857547612 | Bacteria | 6179999 |
| 812 | 2857558217 | 2857553236 | Bacteria | 6166726 |
| 813 | 2857564517 | 2857558681 | Bacteria | 6617694 |
| 814 | 2904427031 | 2904424332 | Bacteria | 7633521 |
| 815 | 2919480201 | 2919476304 | Bacteria | 5888696 |
| 816 | 2932418947 | 2932416698 | Bacteria | 6315112 |
| 817 | 8047679258 | 8047673197 | Bacteria | 7395230 |
| 818 | 8055229116 | 8055225921 | Bacteria | 3341787 |
| 819 | Ga0439450_015579 | |||
| 820 | JGI25154J39366_1000716 | |||
| 821 | JGI25158J39367_1006807 | |||
| 822 | JGI25152J39213_1000005 | |||
| 823 | JGI25150J39212_1000571 | |||
| 824 | JGI25150J39212_1001739 | |||
| 825 | JGI25150J39212_1005726 | |||
| 826 | JGI25159J45721_1003493 | |||
| 827 | JGI25159J45721_1004574 | |||
| 828 | JGI25153J46596_10005856 | |||
| 829 | rootL2_10030442 | |||
| 830 | rootL2_10030453 | |||
| 831 | rootL2_10035258 | |||
| 832 | rootL2_10117580 | |||
| 833 | rootH1_10094760 | |||
| 834 | JGI25161J50226_1000182 | |||
| 835 | Ga0055529_1000068 | |||
| 836 | Ga0055526_1000013 | |||
| 837 | Ga0055526_1000048 | |||
| 838 | Ga0055526_1000934 | |||
| 839 | Ga0055526_1005682 | |||
| 840 | Ga0055526_1009881 | |||
| 841 | Ga0055537_1000039 | |||
| 842 | Ga0055537_1002487 | |||
| 843 | Ga0055537_1013747 | |||
| 844 | Ga0055537_1018641 | |||
| 845 | Ga0055524_1000008 | |||
| 846 | Ga0055524_1000187 | |||
| 847 | Ga0055524_1004427 | |||
| 848 | Ga0055524_1007806 | |||
| 849 | Ga0055524_1014954 | |||
| 850 | Ga0055534_1000174 | |||
| 851 | Ga0055534_1001797 | |||
| 852 | Ga0055534_1011384 | |||
| 853 | Ga0055528_1000066 | |||
| 854 | Ga0055530_10010604 | |||
| 855 | Ga0055531_10005354 | |||
| 856 | Ga0055543_1000112 | |||
| 857 | Ga0055543_1004521 | |||
| 858 | Ga0065165_1000005 | |||
| 859 | Ga0065165_1001216 | |||
| 860 | Ga0065165_1013430 | |||
| 861 | Ga0065715_10226472 | |||
| 862 | Ga0070658_10298854 | |||
| 863 | Ga0070670_100179593 | |||
| 864 | Ga0070677_10023916 | |||
| 865 | Ga0070666_10019569 | |||
| 866 | Ga0070666_10187186 | |||
| 867 | Ga0068868_100005354 | |||
| 868 | Ga0070661_100028344 | |||
| 869 | Ga0070669_100034198 | |||
| 870 | Ga0070671_100023446 | |||
| 871 | Ga0070674_100182477 | |||
| 872 | Ga0070673_100000606 | |||
| 873 | Ga0070673_100123979 | |||
| 874 | Ga0070659_100216032 | |||
| 875 | Ga0070667_100033198 | |||
| 876 | Ga0070678_100001713 | |||
| 877 | Ga0070678_100329196 | |||
| 878 | Ga0068867_100014626 | |||
| 879 | Ga0070672_100096403 | |||
| 880 | Ga0068855_100002919 | |||
| 881 | Ga0070664_100125975 | |||
| 882 | Ga0070664_100162879 | |||
| 883 | Ga0068852_100121583 | |||
| 884 | Ga0068859_100001422 | |||
| 885 | Ga0068864_100401147 | |||
| 886 | Ga0068861_100035186 | |||
| 887 | Ga0068861_100134371 | |||
| 888 | Ga0068861_100514437 | |||
| 889 | Ga0068863_100017744 | |||
| 890 | Ga0068858_100003140 | |||
| 891 | Ga0068862_100044143 | |||
| 892 | Ga0097621_100085920 | |||
| 893 | Ga0068871_100002105 | |||
| 894 | Ga0097620_100001422 | |||
| 895 | Ga0099826_10000001 | |||
| 896 | Ga0105244_10002659 | |||
| 897 | Ga0105243_10076171 | |||
| 898 | Ga0105242_10091014 | |||
| 899 | Ga0105248_10065661 | |||
| 900 | Ga0105238_10460173 | |||
| 901 | Ga0157371_10000026 | |||
| 902 | Ga0157374_10439844 | |||
| 903 | Ga0163162_10017462 | |||
| 904 | Ga0163162_10147621 | |||
| 905 | Ga0157375_10231092 | |||
| 906 | Ga0163163_10015841 | |||
| 907 | Ga0157380_10049131 | |||
| 908 | Ga0182008_10004711 | |||
| 909 | Ga0182008_10027096 | |||
| 910 | Ga0157376_10126687 | |||
| 911 | Ga0182006_1000029 | |||
| 912 | Ga0182006_1026492 | |||
| 913 | Ga0182007_10000997 | |||
| 914 | Ga0182005_1000002 | |||
| 915 | Ga0182005_1000012 | |||
| 916 | Ga0163161_10060543 | |||
| 917 | Ga0163161_10110159 | |||
| 918 | Ga0213872_10000032 | |||
| 919 | Ga0209436_100484 | |||
| 920 | Ga0209436_111393 | |||
| 921 | Ga0209563_100003 | |||
| 922 | Ga0207425_1000001 | |||
| 923 | Ga0207425_1000130 | |||
| 924 | Ga0207425_1000132 | |||
| 925 | Ga0209646_1000007 | |||
| 926 | Ga0209677_108796 | |||
| 927 | Ga0209148_1005446 | |||
| 928 | Ga0209129_1000003 | |||
| 929 | Ga0209129_1009156 | |||
| 930 | Ga0209565_1000003 | |||
| 931 | Ga0209565_1003147 | |||
| 932 | Ga0209565_1003288 | |||
| 933 | Ga0209565_1004100 | |||
| 934 | Ga0209565_1006959 | |||
| 935 | Ga0209565_1017245 | |||
| 936 | Ga0209455_1000026 | |||
| 937 | Ga0209673_1000003 | |||
| 938 | Ga0209673_1014177 | |||
| 939 | Ga0209673_1033525 | |||
| 940 | Ga0209130_1000084 | |||
| 941 | Ga0209130_1000237 | |||
| 942 | Ga0209130_1004662 | |||
| 943 | Ga0209675_1000003 | |||
| 944 | Ga0209675_1006952 | |||
| 945 | Ga0209675_1013840 | |||
| 946 | Ga0209025_1006230 | |||
| 947 | Ga0209564_1000002 | |||
| 948 | Ga0209564_1000007 | |||
| 949 | Ga0209564_1000012 | |||
| 950 | Ga0209564_1000311 | |||
| 951 | Ga0209564_1005699 | |||
| 952 | Ga0209564_1007930 | |||
| 953 | Ga0209758_1000041 | |||
| 954 | Ga0209758_1000757 | |||
| 955 | Ga0209050_1000011 | |||
| 956 | Ga0209050_1000164 | |||
| 957 | Ga0209050_1000664 | |||
| 958 | Ga0209256_1000005 | |||
| 959 | Ga0209256_1000068 | |||
| 960 | Ga0209256_1000395 | |||
| 961 | Ga0209256_1000952 | |||
| 962 | Ga0209256_1003000 | |||
| 963 | Ga0207426_1003864 | |||
| 964 | Ga0207426_1058678 | |||
| 965 | Ga0209257_1000003 | |||
| 966 | Ga0209257_1016232 | |||
| 967 | Ga0207697_10040931 | |||
| 968 | Ga0207655_1004019 | |||
| 969 | Ga0207682_10005733 | |||
| 970 | Ga0207682_10006232 | |||
| 971 | Ga0207680_10002181 | |||
| 972 | Ga0207645_10119665 | |||
| 973 | Ga0207705_10001990 | |||
| 974 | Ga0207705_10072000 | |||
| 975 | Ga0207705_10183385 | |||
| 976 | Ga0207654_10023184 | |||
| 977 | Ga0207662_10012947 | |||
| 978 | Ga0207681_10015030 | |||
| 979 | Ga0207644_10014885 | |||
| 980 | Ga0207706_10080716 | |||
| 981 | Ga0207709_10054405 | |||
| 982 | Ga0207669_10123980 | |||
| 983 | Ga0207691_10088615 | |||
| 984 | Ga0207691_10111128 | |||
| 985 | Ga0207711_10027897 | |||
| 986 | Ga0207679_10040362 | |||
| 987 | Ga0207679_10077164 | |||
| 988 | Ga0207679_10199365 | |||
| 989 | Ga0207667_10001048 | |||
| 990 | Ga0207651_10031915 | |||
| 991 | Ga0207677_10002910 | |||
| 992 | Ga0207703_10007134 | |||
| 993 | Ga0207641_10004402 | |||
| 994 | Ga0207641_10218363 | |||
| 995 | Ga0207648_10119713 | |||
| 996 | Ga0207648_10170142 | |||
| 997 | Ga0207676_10003508 | |||
| 998 | Ga0207675_100010028 | |||
| 999 | Ga0207675_100175568 | |||
| 1000 | Ga0207683_10006519 | |||
| 1001 | Ga0207683_10355145 | |||
| 1002 | Ga0207698_10081845 | |||
| 1003 | Ga0209281_1003014 | |||
| 1004 | Ga0209281_1005961 | |||
| 1005 | Ga0209282_1000001 | |||
| 1006 | Ga0268266_10187480 | |||
| 1007 | Ga0268265_10081584 | |||
| 1008 | Ga0307515_10241205 | |||
| 1009 | Ga0316180_1112319 | |||
| 1010 | Ga0316181_1216539 | |||
| 1011 | Ga0307408_100001129 | |||
| 1012 | Ga0307408_100001185 | |||
| 1013 | Ga0307408_100003316 | |||
| 1014 | Ga0307416_100084493 | |||
| 1015 | Ga0307414_10003286 | |||
| 1016 | Ga0373952_0002402 | |||
| 1017 | Ga0373935_0161480 | |||
| 1018 | Ga0395899_0004735 | |||
| 1019 | Ga0395899_0005686 | |||
| 1020 | Ga0395899_0010310 | |||
| 1021 | Ga0395899_0091327 | |||
| 1022 | Ga0395900_0002091 | |||
| 1023 | Ga0395900_0003097 | |||
| 1024 | Ga0395900_0003147 | |||
| 1025 | Ga0395900_0080938 | |||
| 1026 | Ga0395898_0011645 | |||
| 1027 | Ga0395898_0017086 | |||
| 1028 | Ga0395898_0031587 | |||
| 1029 | Ga0395898_0091283 | |||
| 1030 | Ga0395905_0013949 | |||
| 1031 | Ga0395905_0015250 | |||
| 1032 | Ga0395905_0055941 | |||
| 1033 | Ga0395905_0059785 | |||
| 1034 | Ga0395905_0149117 | |||
| 1035 | Ga0395905_0436863 | |||
| 1036 | Ga0395901_0000212 | |||
| 1037 | Ga0395901_0000522 | |||
| 1038 | Ga0395901_0229464 | |||
| 1039 | Ga0436360_1203167 | |||
| 1040 | Ga0436361_0168778 | |||
| 1041 | Ga0436361_0993359 | |||
| 1042 | Ga0439448_0016603 | |||
| 1043 | Ga0439449_0024840 | |||
| 1044 | Ga0439450_011670 | |||
| 1045 | Ga0439450_043299 | |||
| 1046 | Ga0439455_0006438 | |||
| 1047 | Ga0450897_001616 | |||
| 1048 | Ga0466972_0023087 | |||
| 1049 | Ga0466965_0009082 | |||
| 1050 | Ga0466965_0016185 | |||
| 1051 | Ga0466965_0024959 | |||
| 1052 | Ga0466966_0000457 | |||
| 1053 | Ga0466966_0019594 | |||
| 1054 | Ga0466966_0065376 | |||
| 1055 | Ga0466966_0132664 | |||
| 1056 | Ga0466966_0145256 | |||
| 1057 | Ga0466961_0009150 | |||
| 1058 | Ga0466961_0027393 | |||
| 1059 | Ga0466963_0207435 | |||
| 1060 | Ga0466964_0000435 | |||
| 1061 | Ga0466964_0002446 | |||
| 1062 | Ga0466964_0014920 | |||
| 1063 | Ga0466968_0001497 | |||
| 1064 | Ga0466968_0043937 | |||
| 1065 | Ga0466970_0024531 | |||
| 1066 | Ga0466970_0095349 | |||
| 1067 | Ga0466957_0000114 | |||
| 1068 | Ga0466957_0012400 | |||
| 1069 | Ga0466957_0027382 | |||
| 1070 | Ga0466960_0067601 | |||
| 1071 | Ga0466959_0005057 | |||
| 1072 | Ga0466959_0025010 | |||
| 1073 | Ga0466959_0030580 | |||
| 1074 | Ga0451576_0017483 | |||
| 1075 | Ga0466967_0030085 | |||
| 1076 | Ga0495617_000042 | |||
| 1077 | Ga0495617_000063 | |||
| 1078 | Ga0495617_037565 | |||
| 1079 | Ga0495627_000057 | |||
| 1080 | Ga0495627_000323 | |||
| 1081 | Ga0495627_003505 | |||
| 1082 | Ga0495590_0000010 | |||
| 1083 | Ga0495590_0000837 | |||
| 1084 | Ga0495590_0002387 | |||
| 1085 | Ga0495590_0062336 | |||
| 1086 | Ga0495629_0017851 | |||
| 1087 | Ga0495629_0035318 | |||
| 1088 | Ga0495638_0000027 | |||
| 1089 | Ga0495638_0020283 | |||
| 1090 | Ga0495638_0020825 | |||
| 1091 | Ga0495638_0024603 | |||
| 1092 | Ga0495638_0048379 | |||
| 1093 | Ga0495638_0056006 | |||
| 1094 | Ga0495653_0004474 | |||
| 1095 | Ga0495653_0035700 | |||
| 1096 | Ga0495653_0066832 | |||
| 1097 | Ga0495653_0112559 | |||
| 1098 | Ga0495650_0000044 | |||
| 1099 | Ga0495650_0000066 | |||
| 1100 | Ga0495650_0000229 | |||
| 1101 | Ga0495650_0001129 | |||
| 1102 | Ga0495650_0003132 | |||
| 1103 | Ga0495650_0017307 | |||
| 1104 | Ga0495650_0030602 | |||
| 1105 | Ga0495582_0020516 | |||
| 1106 | Ga0495605_0000027 | |||
| 1107 | Ga0495605_0000049 | |||
| 1108 | Ga0495605_0000130 | |||
| 1109 | Ga0495605_0009901 | |||
| 1110 | Ga0495605_0012517 | |||
| 1111 | Ga0495605_0030705 | |||
| 1112 | Ga0495605_0037262 | |||
| 1113 | Ga0495605_0050378 | |||
| 1114 | Ga0495605_0062472 | |||
| 1115 | Ga0495605_0091000 | |||
| 1116 | Ga0495639_0013547 | |||
| 1117 | Ga0495584_0000001 | |||
| 1118 | Ga0495584_0000137 | |||
| 1119 | Ga0495584_0000164 | |||
| 1120 | Ga0495584_0001830 | |||
| 1121 | Ga0495584_0007483 | |||
| 1122 | Ga0495584_0008092 | |||
| 1123 | Ga0495584_0010845 | |||
| 1124 | Ga0495584_0122624 | |||
| 1125 | Ga0495584_0138294 | |||
| 1126 | Ga0495585_0000003 | |||
| 1127 | Ga0495585_0000011 | |||
| 1128 | Ga0495585_0000040 | |||
| 1129 | Ga0495585_0000233 | |||
| 1130 | Ga0495585_0000365 | |||
| 1131 | Ga0495585_0000385 | |||
| 1132 | Ga0495585_0000486 | |||
| 1133 | Ga0495585_0002878 | |||
| 1134 | Ga0495585_0004384 | |||
| 1135 | Ga0495585_0046779 | |||
| 1136 | Ga0495585_0048301 | |||
| 1137 | Ga0495585_0106325 | |||
| 1138 | Ga0495594_0001143 | |||
| 1139 | Ga0495594_0024171 | |||
| 1140 | Ga0495594_0062918 | |||
| 1141 | Ga0495594_0076177 | |||
| 1142 | Ga0495594_0148906 | |||
| 1143 | Ga0495596_0000106 | |||
| 1144 | Ga0495596_0000424 | |||
| 1145 | Ga0495596_0001138 | |||
| 1146 | Ga0495596_0001319 | |||
| 1147 | Ga0495596_0006923 | |||
| 1148 | Ga0495596_0014663 | |||
| 1149 | Ga0495596_0018568 | |||
| 1150 | Ga0495596_0020523 | |||
| 1151 | Ga0495596_0075812 | |||
| 1152 | Ga0495607_0001405 | |||
| 1153 | Ga0495607_0001669 | |||
| 1154 | Ga0495607_0002038 | |||
| 1155 | Ga0495607_0005509 | |||
| 1156 | Ga0495607_0006690 | |||
| 1157 | Ga0495607_0006835 | |||
| 1158 | Ga0495607_0058664 | |||
| 1159 | Ga0495583_0000006 | |||
| 1160 | Ga0495583_0000095 | |||
| 1161 | Ga0495583_0000117 | |||
| 1162 | Ga0495583_0000381 | |||
| 1163 | Ga0495583_0000551 | |||
| 1164 | Ga0495583_0004237 | |||
| 1165 | Ga0495583_0008753 | |||
| 1166 | Ga0495583_0011133 | |||
| 1167 | Ga0495583_0015640 | |||
| 1168 | Ga0495583_0029846 | |||
| 1169 | Ga0495583_0046412 | |||
| 1170 | Ga0495583_0113016 | |||
| 1171 | Ga0495606_0000125 | |||
| 1172 | Ga0495606_0000128 | |||
| 1173 | Ga0495606_0000557 | |||
| 1174 | Ga0495606_0001131 | |||
| 1175 | Ga0495606_0001352 | |||
| 1176 | Ga0495606_0005861 | |||
| 1177 | Ga0495606_0007239 | |||
| 1178 | Ga0495606_0022454 | |||
| 1179 | Ga0495606_0042627 | |||
| 1180 | Ga0495606_0050520 | |||
| 1181 | Ga0495606_0164429 | |||
| 1182 | Ga0495608_0253561 | |||
| 1183 | Ga0495610_0000008 | |||
| 1184 | Ga0495610_0002638 | |||
| 1185 | Ga0495610_0005058 | |||
| 1186 | Ga0495610_0009097 | |||
| 1187 | Ga0495610_0009298 | |||
| 1188 | Ga0495610_0107015 | |||
| 1189 | Ga0495616_0000075 | |||
| 1190 | Ga0495616_0000170 | |||
| 1191 | Ga0495616_0000902 | |||
| 1192 | Ga0495616_0001358 | |||
| 1193 | Ga0495616_0003193 | |||
| 1194 | Ga0495616_0005436 | |||
| 1195 | Ga0495616_0008471 | |||
| 1196 | Ga0495616_0011720 | |||
| 1197 | Ga0495620_0098836 | |||
| 1198 | Ga0495628_0096240 | |||
| 1199 | Ga0495630_0093605 | |||
| 1200 | Ga0495630_0099341 | |||
| 1201 | Ga0495631_0000417 | |||
| 1202 | Ga0495631_0002592 | |||
| 1203 | Ga0495631_0005682 | |||
| 1204 | Ga0495631_0007774 | |||
| 1205 | Ga0495631_0013672 | |||
| 1206 | Ga0495631_0014256 | |||
| 1207 | Ga0495631_0017463 | |||
| 1208 | Ga0495631_0024430 | |||
| 1209 | Ga0495631_0059670 | |||
| 1210 | Ga0495632_0000057 | |||
| 1211 | Ga0495632_0000091 | |||
| 1212 | Ga0495632_0000201 | |||
| 1213 | Ga0495632_0000358 | |||
| 1214 | Ga0495632_0025745 | |||
| 1215 | Ga0495637_0000067 | |||
| 1216 | Ga0495643_0000022 | |||
| 1217 | Ga0495643_0000065 | |||
| 1218 | Ga0495643_0000094 | |||
| 1219 | Ga0495643_0000326 | |||
| 1220 | Ga0495643_0001487 | |||
| 1221 | Ga0495643_0007451 | |||
| 1222 | Ga0495643_0014799 | |||
| 1223 | Ga0495643_0041640 | |||
| 1224 | Ga0495643_0073832 | |||
| 1225 | Ga0495643_0132751 | |||
| 1226 | Ga0495644_0007237 | |||
| 1227 | Ga0495644_0036002 | |||
| 1228 | Ga0495644_0056542 | |||
| 1229 | Ga0495644_0088409 | |||
| 1230 | Ga0495648_0000011 | |||
| 1231 | Ga0495648_0000078 | |||
| 1232 | Ga0495648_0000883 | |||
| 1233 | Ga0495648_0000928 | |||
| 1234 | Ga0495648_0002119 | |||
| 1235 | Ga0495648_0012722 | |||
| 1236 | Ga0495648_0016036 | |||
| 1237 | Ga0495648_0021870 | |||
| 1238 | Ga0495648_0043528 | |||
| 1239 | Ga0495648_0057531 | |||
| 1240 | Ga0495663_0001726 | |||
| 1241 | Ga0495663_0043871 | |||
| 1242 | Ga0495663_0057552 | |||
| 1243 | Ga0495666_0000160 | |||
| 1244 | Ga0495666_0000267 | |||
| 1245 | Ga0495666_0008547 | |||
| 1246 | Ga0495666_0017645 | |||
| 1247 | Ga0495666_0064778 | |||
| 1248 | Ga0495642_0000012 | |||
| 1249 | Ga0495642_0000128 | |||
| 1250 | Ga0495642_0000439 | |||
| 1251 | Ga0495642_0000919 | |||
| 1252 | Ga0495642_0003382 | |||
| 1253 | Ga0495642_0006493 | |||
| 1254 | Ga0495642_0009466 | |||
| 1255 | Ga0495642_0012229 | |||
| 1256 | Ga0495642_0018438 | |||
| 1257 | Ga0495642_0023585 | |||
| 1258 | Ga0495642_0026918 | |||
| 1259 | Ga0495642_0030434 | |||
| 1260 | Ga0495642_0096280 | |||
| 1261 | Ga0495652_0058522 | |||
| 1262 | Ga0495654_0000002 | |||
| 1263 | Ga0495654_0010283 | |||
| 1264 | Ga0495654_0023750 | |||
| 1265 | Ga0495654_0028268 | |||
| 1266 | Ga0495654_0032205 | |||
| 1267 | Ga0495654_0072958 | |||
| 1268 | Ga0495654_0078306 | |||
| 1269 | Ga0495665_0003469 | |||
| 1270 | Ga0495665_0018914 | |||
| 1271 | Ga0495665_0039773 | |||
| 1272 | Ga0495640_0148636 | |||
| 1273 | Ga0495586_0016175 | |||
| 1274 | Ga0495586_0021113 | |||
| 1275 | Ga0495586_0108193 | |||
| 1276 | Ga0495586_0128037 | |||
| 1277 | Ga0495587_0014738 | |||
| 1278 | Ga0495609_0000001 | |||
| 1279 | Ga0495609_0001621 | |||
| 1280 | Ga0495609_0002680 | |||
| 1281 | Ga0495609_0004160 | |||
| 1282 | Ga0495609_0005651 | |||
| 1283 | Ga0495609_0007380 | |||
| 1284 | Ga0495609_0013816 | |||
| 1285 | Ga0495609_0019974 | |||
| 1286 | Ga0495609_0034566 | |||
| 1287 | Ga0495609_0039085 | |||
| 1288 | Ga0495609_0055489 | |||
| 1289 | Ga0495609_0072809 | |||
| 1290 | Ga0495609_0078055 | |||
| 1291 | Ga0495609_0101599 | |||
| 1292 | Ga0495597_0000009 | |||
| 1293 | Ga0495597_0000029 | |||
| 1294 | Ga0495597_0000107 | |||
| 1295 | Ga0495597_0000335 | |||
| 1296 | Ga0495597_0000466 | |||
| 1297 | Ga0495597_0003120 | |||
| 1298 | Ga0495597_0008860 | |||
| 1299 | Ga0495597_0011431 | |||
| 1300 | Ga0495597_0029264 | |||
| 1301 | Ga0495597_0067704 | |||
| 1302 | Ga0495645_0101123 | |||
| 1303 | Ga0495622_0000043 | |||
| 1304 | Ga0495622_0001191 | |||
| 1305 | Ga0495622_0011143 | |||
| 1306 | Ga0495622_0019628 | |||
| 1307 | Ga0495633_0000381 | |||
| 1308 | Ga0495633_0000577 | |||
| 1309 | Ga0495633_0001135 | |||
| 1310 | Ga0495633_0001381 | |||
| 1311 | Ga0495633_0003447 | |||
| 1312 | Ga0495633_0006010 | |||
| 1313 | Ga0495633_0006135 | |||
| 1314 | Ga0495633_0007174 | |||
| 1315 | Ga0495633_0012130 | |||
| 1316 | Ga0495633_0014246 | |||
| 1317 | Ga0495633_0016160 | |||
| 1318 | Ga0495633_0038540 | |||
| 1319 | Ga0495633_0041795 | |||
| 1320 | Ga0495656_0033049 | |||
| 1321 | Ga0495656_0062651 | |||
| 1322 | Ga0495668_0000006 | |||
| 1323 | Ga0495668_0000027 | |||
| 1324 | Ga0495668_0000096 | |||
| 1325 | Ga0495668_0000180 | |||
| 1326 | Ga0495668_0000429 | |||
| 1327 | Ga0495668_0001010 | |||
| 1328 | Ga0495668_0001031 | |||
| 1329 | Ga0495668_0001648 | |||
| 1330 | Ga0495668_0003280 | |||
| 1331 | Ga0495668_0006316 | |||
| 1332 | Ga0495668_0007037 | |||
| 1333 | Ga0495668_0016242 | |||
| 1334 | Ga0495668_0032675 | |||
| 1335 | Ga0495668_0035888 | |||
| 1336 | Ga0495668_0037133 | |||
| 1337 | Ga0495668_0042122 | |||
| 1338 | Ga0495668_0066935 | |||
| 1339 | Ga0495668_0084778 | |||
| 1340 | Ga0495668_0095069 | |||
| 1341 | Ga0495668_0121559 | |||
| 1342 | Ga0495634_0022518 | |||
| 1343 | Ga0495611_0000437 | |||
| 1344 | Ga0495611_0008801 | |||
| 1345 | Ga0495611_0012180 | |||
| 1346 | Ga0495611_0013380 | |||
| 1347 | Ga0495611_0014600 | |||
| 1348 | Ga0495611_0044894 | |||
| 1349 | Ga0495611_0060529 | |||
| 1350 | Ga0495611_0120645 | |||
| 1351 | Ga0495625_0000053 | |||
| 1352 | Ga0495625_0002139 | |||
| 1353 | Ga0495625_0008684 | |||
| 1354 | Ga0495625_0009670 | |||
| 1355 | Ga0495625_0009909 | |||
| 1356 | Ga0495625_0018522 | |||
| 1357 | Ga0495625_0025290 | |||
| 1358 | Ga0495625_0047439 | |||
| 1359 | Ga0495625_0050151 | |||
| 1360 | Ga0495625_0054292 | |||
| 1361 | Ga0495625_0088900 | |||
| 1362 | Ga0495625_0098309 | |||
| 1363 | Ga0495625_0206796 | |||
| 1364 | Ga0495659_0000001 | |||
| 1365 | Ga0495659_0017668 | |||
| 1366 | Ga0495661_0000023 | |||
| 1367 | Ga0495661_0000148 | |||
| 1368 | Ga0495661_0000287 | |||
| 1369 | Ga0495661_0003345 | |||
| 1370 | Ga0495661_0004688 | |||
| 1371 | Ga0495661_0025832 | |||
| 1372 | Ga0495661_0033305 | |||
| 1373 | Ga0495661_0049687 | |||
| 1374 | Ga0495661_0051076 | |||
| 1375 | Ga0495661_0057062 | |||
| 1376 | Ga0495661_0061447 | |||
| 1377 | Ga0495661_0102466 | |||
| 1378 | Ga0495661_0174753 | |||
| 1379 | Ga0495588_0000041 | |||
| 1380 | Ga0495588_0003113 | |||
| 1381 | Ga0495588_0020102 | |||
| 1382 | Ga0495588_0094174 | |||
| 1383 | Ga0495588_0136839 | |||
| 1384 | Ga0495588_0161383 | |||
| 1385 | Ga0495623_0010749 | |||
| 1386 | Ga0495623_0051175 | |||
| 1387 | Ga0495623_0070655 | |||
| 1388 | Ga0495646_0081670 | |||
| 1389 | Ga0495646_0108020 | |||
| 1390 | Ga0495658_0002916 | |||
| 1391 | Ga0495669_0000017 | |||
| 1392 | Ga0495669_0000429 | |||
| 1393 | Ga0495669_0000484 | |||
| 1394 | Ga0495669_0009083 | |||
| 1395 | Ga0495613_0016878 | |||
| 1396 | Ga0495624_0006051 | |||
| 1397 | Ga0495670_0000122 | |||
| 1398 | Ga0495670_0001433 | |||
| 1399 | Ga0495670_0001786 | |||
| 1400 | Ga0495670_0010563 | |||
| 1401 | Ga0495670_0019050 | |||
| 1402 | Ga0495670_0036181 | |||
| 1403 | Ga0495670_0036802 | |||
| 1404 | Ga0495670_0086930 | |||
| 1405 | Ga0495670_0117606 | |||
| 1406 | Ga0495671_0000002 | |||
| 1407 | Ga0495671_0000035 | |||
| 1408 | Ga0495671_0000140 | |||
| 1409 | Ga0495671_0002321 | |||
| 1410 | Ga0495671_0009573 | |||
| 1411 | Ga0495671_0016243 | |||
| 1412 | Ga0495671_0047593 | |||
| 1413 | Ga0495671_0048524 | |||
| 1414 | Ga0495649_0002789 | |||
| 1415 | Ga0495649_0028441 | |||
| 1416 | Ga0495589_0000027 | |||
| 1417 | Ga0495589_0000102 | |||
| 1418 | Ga0495589_0000600 | |||
| 1419 | Ga0495589_0003377 | |||
| 1420 | Ga0495589_0005590 | |||
| 1421 | Ga0495589_0016821 | |||
| 1422 | Ga0495589_0040644 | |||
| 1423 | Ga0495589_0114346 | |||
| 1424 | Ga0495600_0047066 | |||
| 1425 | Ga0495660_0000069 | |||
| 1426 | Ga0495660_0000132 | |||
| 1427 | Ga0495660_0001231 | |||
| 1428 | Ga0495660_0003475 | |||
| 1429 | Ga0495660_0018729 | |||
| 1430 | Ga0495660_0022256 | |||
| 1431 | Ga0495660_0025019 | |||
| 1432 | Ga0495660_0031928 | |||
| 1433 | Ga0495660_0036753 | |||
| 1434 | Ga0495660_0056861 | |||
| 1435 | Ga0495660_0080464 | |||
| 1436 | Ga0495660_0182145 | |||
| 1437 | Ga0495581_0004532 | |||
| 1438 | Ga0495581_0043781 | |||
| 1439 | Ga0495604_0019344 | |||
| 1440 | Ga0495604_0050325 | |||
| 1441 | Ga0495636_0003615 | |||
| 1442 | Ga0495636_0004270 | |||
| 1443 | Ga0495636_0011926 | |||
| 1444 | Ga0495674_0002798 | |||
| 1445 | Ga0495672_0000022 | |||
| 1446 | Ga0495672_0000066 | |||
| 1447 | Ga0495672_0000095 | |||
| 1448 | Ga0495672_0000231 | |||
| 1449 | Ga0495672_0003237 | |||
| 1450 | Ga0495672_0005035 | |||
| 1451 | Ga0495672_0022297 | |||
| 1452 | Ga0495676_0000017 | |||
| 1453 | Ga0495676_0033969 | |||
| 1454 | Ga0495676_0074145 | |||
| 1455 | Ga0495680_0006458 | |||
| 1456 | Ga0495680_0134329 | |||
| 1457 | Ga0495683_0000005 | |||
| 1458 | Ga0495683_0105998 | |||
| 1459 | Ga0495683_0130721 | |||
| 1460 | Ga0495687_000023 | |||
| 1461 | Ga0495687_000027 | |||
| 1462 | Ga0495687_000034 | |||
| 1463 | Ga0495687_000048 | |||
| 1464 | Ga0495687_000524 | |||
| 1465 | Ga0495687_001158 | |||
| 1466 | Ga0495687_002491 | |||
| 1467 | Ga0495687_035282 | |||
| 1468 | Ga0495675_0009439 | |||
| 1469 | Ga0495675_0026728 | |||
| 1470 | Ga0495677_0000001 | |||
| 1471 | Ga0495677_0000067 | |||
| 1472 | Ga0495677_0000677 | |||
| 1473 | Ga0495677_0005267 | |||
| 1474 | Ga0495677_0005773 | |||
| 1475 | Ga0495677_0005839 | |||
| 1476 | Ga0495677_0005940 | |||
| 1477 | Ga0495677_0011590 | |||
| 1478 | Ga0495677_0014975 | |||
| 1479 | Ga0495677_0039007 | |||
| 1480 | Ga0495679_004242 | |||
| 1481 | Ga0495679_005144 | |||
| 1482 | Ga0495679_006136 | |||
| 1483 | Ga0495679_006944 | |||
| 1484 | Ga0495679_021023 | |||
| 1485 | Ga0495685_009304 | |||
| 1486 | Ga0495685_014627 | |||
| 1487 | Ga0495685_051605 | |||
| 1488 | Ga0495673_0000059 | |||
| 1489 | Ga0495673_0000064 | |||
| 1490 | Ga0495673_0049798 | |||
| 1491 | Ga0495681_0000018 | |||
| 1492 | Ga0495681_0001220 | |||
| 1493 | Ga0495681_0003868 | |||
| 1494 | Ga0495681_0004757 | |||
| 1495 | Ga0495681_0008989 | |||
| 1496 | Ga0495681_0009121 | |||
| 1497 | Ga0495681_0009347 | |||
| 1498 | Ga0495681_0010500 | |||
| 1499 | Ga0495681_0020670 | |||
| 1500 | Ga0495681_0047735 | |||
| 1501 | Ga0495686_0000135 | |||
| 1502 | Ga0495686_0000462 | |||
| 1503 | Ga0495686_0000640 | |||
| 1504 | Ga0495686_0001427 | |||
| 1505 | Ga0495686_0009909 | |||
| 1506 | Ga0495686_0036829 | |||
| 1507 | Ga0495686_0147790 | |||
| 1508 | Ga0495593_0002837 | |||
| 1509 | Ga0495593_0039247 | |||
| 1510 | Ga0495602_0123721 | |||
| 1511 | Ga0495614_0060962 | |||
| 1512 | Ga0495615_0000944 | |||
| 1513 | Ga0495615_0028137 | |||
| 1514 | Ga0495626_0000037 | |||
| 1515 | Ga0495626_0000535 | |||
| 1516 | Ga0495626_0000754 | |||
| 1517 | Ga0495626_0003874 | |||
| 1518 | Ga0495626_0004907 | |||
| 1519 | Ga0495626_0007550 | |||
| 1520 | Ga0495626_0009094 | |||
| 1521 | Ga0495626_0010374 | |||
| 1522 | Ga0495626_0015581 | |||
| 1523 | Ga0495626_0017666 | |||
| 1524 | Ga0495626_0024208 | |||
| 1525 | Ga0495626_0031604 | |||
| 1526 | Ga0495626_0043744 | |||
| 1527 | Ga0495626_0046493 | |||
| 1528 | Ga0495626_0098322 | |||
| 1529 | Ga0496101_0123396 | |||
| 1530 | Ga0496102_0000151 | |||
| 1531 | Ga0496102_0000182 | |||
| 1532 | Ga0496102_0010154 | |||
| 1533 | Ga0496102_0105874 | |||
| 1534 | Ga0496102_0232126 | |||
| 1535 | Ga0496103_0005130 | |||
| 1536 | Ga0496103_0027157 | |||
| 1537 | Ga0496103_0043530 | |||
| 1538 | Ga0496103_0100972 | |||
| 1539 | Ga0496104_0016139 | |||
| 1540 | Ga0496104_0269407 | |||
| 1541 | Ga0496105_0046695 | |||
| 1542 | Ga0496106_0009494 | |||
| 1543 | Ga0496106_0173532 | |||
| 1544 | Ga0496109_0202926 | |||
| 1545 | Ga0496109_0434692 | |||
| 1546 | Ga0496110_0074408 | |||
| 1547 | Ga0496112_0315152 | |||
| 1548 | Ga0496113_0002561 | |||
| 1549 | Ga0496113_0006144 | |||
| 1550 | Ga0496113_0212904 | |||
| 1551 | Ga0496114_0065321 | |||
| 1552 | Ga0496115_0017832 | |||
| 1553 | Ga0496115_0021525 | |||
| 1554 | Ga0496115_0097860 | |||
| 1555 | Ga0496115_0123143 | |||
| 1556 | Ga0496116_0015645 | |||
| 1557 | Ga0496116_0074770 | |||
| 1558 | Ga0496117_0000001 | |||
| 1559 | Ga0496118_0000002 | |||
| 1560 | Ga0496121_0007795 | |||
| 1561 | Ga0496121_0011077 | |||
| 1562 | Ga0496121_0305301 | |||
| 1563 | Ga0496122_0000712 | |||
| 1564 | Ga0496122_0003090 | |||
| 1565 | Ga0496122_0013372 | |||
| 1566 | Ga0496122_0014805 | |||
| 1567 | Ga0496122_0075194 | |||
| 1568 | Ga0496123_0000502 | |||
| 1569 | Ga0496123_0005830 | |||
| 1570 | Ga0496123_0020981 | |||
| 1571 | Ga0496123_0065455 | |||
| 1572 | Ga0496124_0003831 | |||
| 1573 | Ga0496124_0012443 | |||
| 1574 | Ga0496124_0029879 | |||
| 1575 | Ga0496124_0065386 | |||
| 1576 | Ga0496124_0132635 | |||
| 1577 | Ga0496124_0180620 | |||
| 1578 | Ga0496124_0220205 | |||
| 1579 | Ga0496125_0017614 | |||
| 1580 | Ga0496125_0034021 | |||
| 1581 | Ga0496125_0213634 | |||
| 1582 | Ga0496126_0030419 | |||
| 1583 | Ga0495678_000100 | |||
| 1584 | Ga0495678_000286 | |||
| 1585 | Ga0495678_000588 | |||
| 1586 | Ga0495678_000705 | |||
| 1587 | Ga0495678_002236 | |||
| 1588 | Ga0495678_003925 | |||
| 1589 | Ga0495682_0000066 | |||
| 1590 | Ga0495682_0001017 | |||
| 1591 | Ga0501222_009165 | |||
| 1592 | Ga0501227_002037 | |||
| 1593 | Ga0501238_002661 | |||
| 1594 | Ga0501249_001440 | |||
| 1595 | Ga0501249_013450 | |||
| 1596 | Ga0501241_012372 | |||
| 1597 | Ga0501269_000423 | |||
| 1598 | Ga0501035_0000866 | |||
| 1599 | Ga0501044_0031874 | |||
| 1600 | Ga0501044_0429043 | |||
| 1601 | Ga0500594_0002295 | |||
| 1602 | Ga0500594_0004222 | |||
| 1603 | Ga0500618_000137 | |||
| 1604 | Ga0500618_009677 | |||
| 1605 | Ga0500559_0000249 | |||
| 1606 | Ga0500586_000227 | |||
| 1607 | Ga0500586_001150 | |||
| 1608 | Ga0500587_001548 | |||
| 1609 | 2547373026 | |||
| 1610 | 2643792135 | |||
| 1611 | 2643799142 | |||
| 1612 | 2644212112 | |||
| 1613 | 2644251528 | |||
| 1614 | 2644357398 | |||
| 1615 | 2644473527 | |||
| 1616 | 2738739989 | |||
| 1617 | 2738828589 | |||
| 1618 | 2738844256 | |||
| 1619 | 2739152385 | |||
| 1620 | 2739194305 | |||
| 1621 | 2739274184 | |||
| 1622 | 2739320781 | |||
| 1623 | 2739339022 | |||
| 1624 | 2739343228 | |||
| 1625 | 2809142964 | |||
| 1626 | 2842717562 | |||
| 1627 | 2843693368 | |||
| 1628 | 2846035068 | |||
| 1629 | 2857550097 | |||
| 1630 | 2857558217 | |||
| 1631 | 2857564517 | |||
| 1632 | 2904427031 | |||
| 1633 | 2919480201 | |||
| 1634 | 2932418947 | |||
| 1635 | 8047679258 | |||
| 1636 | 8055229116 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cdx-assembly1.cif.gz_B | crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides | 0.7233 | 9 | 291 |
| 3cdx-assembly1.cif.gz_A | crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides | 0.7212 | 9 | 291 |
| 3cdx-assembly1.cif.gz_C | crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides | 0.7192 | 9 | 291 |
| 3cdx-assembly1.cif.gz_D | crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides | 0.7067 | 9 | 291 |
| 3cdx-assembly1.cif.gz_E | crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides | 0.7048 | 9 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2bcoA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8397 | 226 | 285 | 2.40.50.630 |
| 2bcoA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8043 | 226 | 285 | 2.40.50.630 |
| 3cdxD00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.7067 | 9 | 291 | 3.40.630.10 |
| 3cdxD00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.6808 | 9 | 291 | 3.40.630.10 |
| af_P76215_1_322_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.6784 | 17 | 291 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M7R4T8-F1-model_v4 | Succinylglutamate desuccinylase / Aspartoacylase family protein | 0.9821 | 74 | 294 |
|
| AF-A0A349KYS1-F1-model_v4 | Succinylglutamate desuccinylase | 0.9808 | 4 | 66 |
GO:0016788
GO:0046872 |
| AF-A0A1M7R4T8-F1-model_v4 | Succinylglutamate desuccinylase / Aspartoacylase family protein | 0.9734 | 74 | 294 |
|
| AF-A0A7Y9HLT1-F1-model_v4 | Putative deacylase | 0.9621 | 67 | 294 |
GO:0016788
GO:0046872 |
| AF-A0A349KYS0-F1-model_v4 | Succinylglutamate desuccinylase | 0.9606 | 95 | 294 |
|