F482131

General Info

Members Datasets Scaffolds Average Seq Length
818 296 1636 319

Family's Representative Sequence

Representative Sequence 3300042008|Ga0439450_015579|Ga0439450_015579_14_1174
Length 386
Sequence MQHDERYRKSAQGVEAVDAGRSPRIDAVHADILLRKPRMMPWAGPARYNARILRTHSFGTRRMIPASQLHFKSVNYTGQGPGPKVIIMGATHGNEKCGTQAIQRIMAEIDAGTLPIVNGSVTFVPIVNPKAYAQNTRSGDRNLNRDLSPKAEPHDFEDHVANWLCPLLAQHDVLLDLHSFNAAHGEPFLMVGPLDNDGPLEPFKHMRAERALARRLGVRRFVTGWMAAYGGGVQRRSRGNAQELQTVLRYGMGTTEYMRSTGGYALTLECGQHLDPRAPDVAYTAIMNTLAFLKIIDAPEPEPIAFEEMEALQMVVVHDKLDAGDQFTRQWASFDPVAEGEQIGVRADGTPVVAEFAGRILFPDVNAQPNHEWYYLTRPNPAFGRE

Samples

Sample ID Description Type Environment
1 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
119 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
257 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
258 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
259 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
260 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
261 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
268 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
269 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
270 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
271 2643221556 Massilia sp. Root1485 Isolate Unclassified
272 2643221638 Duganella sp. Root336D2 Isolate Unclassified
273 2643221645 Massilia sp. Root351 Isolate Unclassified
274 2643221664 Massilia sp. Root418 Isolate Unclassified
275 2643221684 Massilia sp. Root133 Isolate Unclassified
276 2738541280 Massilia sp. GV090 Isolate Unclassified
277 2738541297 Duganella sp. GV083 Isolate Unclassified
278 2738541300 Massilia sp. GV016 Isolate Unclassified
279 2738541357 Duganella sp. GV053 Isolate Unclassified
280 2738543003 Duganella sp. GV066 Isolate Unclassified
281 2738543018 Massilia sp. GV045 Isolate Unclassified
282 2738543026 Duganella sp. GV089 Isolate Unclassified
283 2738543029 Duganella sp. GV039 Isolate Unclassified
284 2738543030 Massilia sp. GV097 Isolate Unclassified
285 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
286 2842711865 Duganella sp. R-73148 Isolate Unclassified
287 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
288 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
289 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
290 2857553236 Duganella sp. R-74557 Isolate Unclassified
291 2857558681 Duganella sp. R-74565 Isolate Unclassified
292 2904424332 Duganella sp. 1411 Isolate Rhizosphere
293 2919476304 Duganella sp. 3397 Isolate Unclassified
294 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
295 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
296 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.58
Metatranscriptomes 0
Isolates 3.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 0.49
Rhizoplane 3.3
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439450_015579 3300042008 Bacteria 1559
2 JGI25154J39366_1000716 3300002738 Bacteria 15035
3 JGI25158J39367_1006807 3300002739 Unclassified 1631
4 JGI25152J39213_1000005 3300002773 Bacteria 160019
5 JGI25150J39212_1000571 3300002774 Bacteria 14701
6 JGI25150J39212_1001739 3300002774 Bacteria 5827
7 JGI25150J39212_1005726 3300002774 Unclassified 2629
8 JGI25159J45721_1003493 3300002987 Bacteria 5539
9 JGI25159J45721_1004574 3300002987 Unclassified 4551
10 JGI25153J46596_10005856 3300003215 Bacteria 6369
11 rootL2_10030442 3300003322 Bacteria 3708
12 rootL2_10030453 3300003322 Bacteria 3049
13 rootL2_10035258 3300003322 Bacteria 5432
14 rootL2_10117580 3300003322 Bacteria 2190
15 rootH1_10094760 3300003323 Bacteria 3192
16 JGI25161J50226_1000182 3300003374 Bacteria 42010
17 Ga0055529_1000068 3300003763 Bacteria 163911
18 Ga0055526_1000013 3300003771 Bacteria 233580
19 Ga0055526_1000048 3300003771 Bacteria 120076
20 Ga0055526_1000934 3300003771 Bacteria 21684
21 Ga0055526_1005682 3300003771 Bacteria 7080
22 Ga0055526_1009881 3300003771 Unclassified 4524
23 Ga0055537_1000039 3300003773 Bacteria 92151
24 Ga0055537_1002487 3300003773 Bacteria 6146
25 Ga0055537_1013747 3300003773 Unclassified 1504
26 Ga0055537_1018641 3300003773 Unclassified 1102
27 Ga0055524_1000008 3300003775 Bacteria 297761
28 Ga0055524_1000187 3300003775 Bacteria 68927
29 Ga0055524_1004427 3300003775 Bacteria 6483
30 Ga0055524_1007806 3300003775 Unclassified 4512
31 Ga0055524_1014954 3300003775 Unclassified 2852
32 Ga0055534_1000174 3300003784 Bacteria 47983
33 Ga0055534_1001797 3300003784 Bacteria 8068
34 Ga0055534_1011384 3300003784 Unclassified 1812
35 Ga0055528_1000066 3300003790 Bacteria 84724
36 Ga0055530_10010604 3300003791 Unclassified 3386
37 Ga0055531_10005354 3300003794 Bacteria 7522
38 Ga0055543_1000112 3300004625 Bacteria 69589
39 Ga0055543_1004521 3300004625 Bacteria 3762
40 Ga0065165_1000005 3300005262 Bacteria 370361
41 Ga0065165_1001216 3300005262 Bacteria 29672
42 Ga0065165_1013430 3300005262 Bacteria 3255
43 Ga0065715_10226472 3300005293 Bacteria 1250
44 Ga0070658_10298854 3300005327 Bacteria 1372
45 Ga0070670_100179593 3300005331 Bacteria 1837
46 Ga0070677_10023916 3300005333 Bacteria 2266
47 Ga0070666_10019569 3300005335 Bacteria 4371
48 Ga0070666_10187186 3300005335 Bacteria 1454
49 Ga0068868_100005354 3300005338 Bacteria 9010
50 Ga0070661_100028344 3300005344 Bacteria 4039
51 Ga0070669_100034198 3300005353 Bacteria 3680
52 Ga0070671_100023446 3300005355 Bacteria 5050
53 Ga0070674_100182477 3300005356 Bacteria 1609
54 Ga0070673_100000606 3300005364 Bacteria 19571
55 Ga0070673_100123979 3300005364 Bacteria 2159
56 Ga0070659_100216032 3300005366 Bacteria 1581
57 Ga0070667_100033198 3300005367 Bacteria 4311
58 Ga0070678_100001713 3300005456 Bacteria 11776
59 Ga0070678_100329196 3300005456 Bacteria 1307
60 Ga0068867_100014626 3300005459 Bacteria 5561
61 Ga0070672_100096403 3300005543 Bacteria 2393
62 Ga0068855_100002919 3300005563 Bacteria 20926
63 Ga0070664_100125975 3300005564 Bacteria 2247
64 Ga0070664_100162879 3300005564 Bacteria 1974
65 Ga0068852_100121583 3300005616 Bacteria 2392
66 Ga0068859_100001422 3300005617 Bacteria 24299
67 Ga0068864_100401147 3300005618 Bacteria 1303
68 Ga0068861_100035186 3300005719 Bacteria 3708
69 Ga0068861_100134371 3300005719 Bacteria 2011
70 Ga0068861_100514437 3300005719 Bacteria 1084
71 Ga0068863_100017744 3300005841 Bacteria 6812
72 Ga0068858_100003140 3300005842 Bacteria 16536
73 Ga0068862_100044143 3300005844 Bacteria 3802
74 Ga0097621_100085920 3300006237 Bacteria 2625
75 Ga0068871_100002105 3300006358 Bacteria 13467
76 Ga0097620_100001422 3300006931 Bacteria 24299
77 Ga0099826_10000001 3300006948 Bacteria 1155201
78 Ga0105244_10002659 3300009036 Bacteria 13391
79 Ga0105243_10076171 3300009148 Bacteria 2725
80 Ga0105242_10091014 3300009176 Unclassified 2567
81 Ga0105248_10065661 3300009177 Bacteria 4074
82 Ga0105238_10460173 3300009551 Bacteria 1270
83 Ga0157371_10000026 3300013102 Bacteria 274703
84 Ga0157374_10439844 3300013296 Bacteria 1304
85 Ga0163162_10017462 3300013306 Bacteria 7020
86 Ga0163162_10147621 3300013306 Bacteria 2468
87 Ga0157375_10231092 3300013308 Bacteria 2009
88 Ga0163163_10015841 3300014325 Bacteria 6983
89 Ga0157380_10049131 3300014326 Bacteria 3326
90 Ga0182008_10004711 3300014497 Bacteria 7910
91 Ga0182008_10027096 3300014497 Bacteria 2905
92 Ga0157376_10126687 3300014969 Bacteria 2272
93 Ga0182006_1000029 3300015261 Bacteria 247579
94 Ga0182006_1026492 3300015261 Bacteria 2372
95 Ga0182007_10000997 3300015262 Bacteria 15535
96 Ga0182005_1000002 3300015265 Bacteria 908499
97 Ga0182005_1000012 3300015265 Bacteria 396944
98 Ga0163161_10060543 3300017792 Bacteria 2756
99 Ga0163161_10110159 3300017792 Bacteria 2058
100 Ga0213872_10000032 3300021361 Bacteria 138939
101 Ga0209436_100484 3300025208 Bacteria 17563
102 Ga0209436_111393 3300025208 Bacteria 1564
103 Ga0209563_100003 3300025230 Bacteria 1932942
104 Ga0207425_1000001 3300025245 Bacteria 2525432
105 Ga0207425_1000130 3300025245 Bacteria 70791
106 Ga0207425_1000132 3300025245 Bacteria 68018
107 Ga0209646_1000007 3300025246 Bacteria 670994
108 Ga0209677_108796 3300025253 Bacteria 1898
109 Ga0209148_1005446 3300025254 Bacteria 2918
110 Ga0209129_1000003 3300025258 Bacteria 903689
111 Ga0209129_1009156 3300025258 Bacteria 2649
112 Ga0209565_1000003 3300025263 Bacteria 1099648
113 Ga0209565_1003147 3300025263 Bacteria 5511
114 Ga0209565_1003288 3300025263 Bacteria 5312
115 Ga0209565_1004100 3300025263 Bacteria 4538
116 Ga0209565_1006959 3300025263 Bacteria 3106
117 Ga0209565_1017245 3300025263 Bacteria 1587
118 Ga0209455_1000026 3300025272 Bacteria 653778
119 Ga0209673_1000003 3300025273 Bacteria 980859
120 Ga0209673_1014177 3300025273 Bacteria 3096
121 Ga0209673_1033525 3300025273 Bacteria 1564
122 Ga0209130_1000084 3300025284 Bacteria 160070
123 Ga0209130_1000237 3300025284 Bacteria 70739
124 Ga0209130_1004662 3300025284 Bacteria 5089
125 Ga0209675_1000003 3300025291 Bacteria 1003982
126 Ga0209675_1006952 3300025291 Bacteria 4438
127 Ga0209675_1013840 3300025291 Bacteria 2493
128 Ga0209025_1006230 3300025294 Bacteria 9350
129 Ga0209564_1000002 3300025295 Bacteria 1636803
130 Ga0209564_1000007 3300025295 Bacteria 1028582
131 Ga0209564_1000012 3300025295 Bacteria 792078
132 Ga0209564_1000311 3300025295 Bacteria 95587
133 Ga0209564_1005699 3300025295 Bacteria 6983
134 Ga0209564_1007930 3300025295 Bacteria 5355
135 Ga0209758_1000041 3300025297 Bacteria 410328
136 Ga0209758_1000757 3300025297 Bacteria 46825
137 Ga0209050_1000011 3300025298 Bacteria 914037
138 Ga0209050_1000164 3300025298 Bacteria 154628
139 Ga0209050_1000664 3300025298 Bacteria 52795
140 Ga0209256_1000005 3300025299 Bacteria 1315082
141 Ga0209256_1000068 3300025299 Bacteria 246064
142 Ga0209256_1000395 3300025299 Bacteria 69343
143 Ga0209256_1000952 3300025299 Bacteria 35118
144 Ga0209256_1003000 3300025299 Bacteria 12538
145 Ga0207426_1003864 3300025302 Bacteria 7725
146 Ga0207426_1058678 3300025302 Bacteria 1116
147 Ga0209257_1000003 3300025304 Bacteria 1702593
148 Ga0209257_1016232 3300025304 Bacteria 3027
149 Ga0207697_10040931 3300025315 Bacteria 1902
150 Ga0207655_1004019 3300025728 Bacteria 10620
151 Ga0207682_10005733 3300025893 Bacteria 5037
152 Ga0207682_10006232 3300025893 Bacteria 4818
153 Ga0207680_10002181 3300025903 Bacteria 9174
154 Ga0207645_10119665 3300025907 Bacteria 1709
155 Ga0207705_10001990 3300025909 Bacteria 15883
156 Ga0207705_10072000 3300025909 Bacteria 2506
157 Ga0207705_10183385 3300025909 Bacteria 1580
158 Ga0207654_10023184 3300025911 Bacteria 3321
159 Ga0207662_10012947 3300025918 Bacteria 4657
160 Ga0207681_10015030 3300025923 Bacteria 4824
161 Ga0207644_10014885 3300025931 Bacteria 5214
162 Ga0207706_10080716 3300025933 Bacteria 2859
163 Ga0207709_10054405 3300025935 Bacteria 2468
164 Ga0207669_10123980 3300025937 Bacteria 1760
165 Ga0207691_10088615 3300025940 Bacteria 2775
166 Ga0207691_10111128 3300025940 Bacteria 2437
167 Ga0207711_10027897 3300025941 Bacteria 4746
168 Ga0207679_10040362 3300025945 Bacteria 3340
169 Ga0207679_10077164 3300025945 Bacteria 2533
170 Ga0207679_10199365 3300025945 Bacteria 1671
171 Ga0207667_10001048 3300025949 Bacteria 35209
172 Ga0207651_10031915 3300025960 Bacteria 3374
173 Ga0207677_10002910 3300026023 Bacteria 9042
174 Ga0207703_10007134 3300026035 Bacteria 8892
175 Ga0207641_10004402 3300026088 Bacteria 12205
176 Ga0207641_10218363 3300026088 Bacteria 1767
177 Ga0207648_10119713 3300026089 Bacteria 2314
178 Ga0207648_10170142 3300026089 Bacteria 1926
179 Ga0207676_10003508 3300026095 Bacteria 11098
180 Ga0207675_100010028 3300026118 Bacteria 8878
181 Ga0207675_100175568 3300026118 Bacteria 2050
182 Ga0207683_10006519 3300026121 Bacteria 9994
183 Ga0207683_10355145 3300026121 Bacteria 1346
184 Ga0207698_10081845 3300026142 Bacteria 2608
185 Ga0209281_1003014 3300027111 Bacteria 5967
186 Ga0209281_1005961 3300027111 Bacteria 3257
187 Ga0209282_1000001 3300027666 Bacteria 2450367
188 Ga0268266_10187480 3300028379 Bacteria 1887
189 Ga0268265_10081584 3300028380 Bacteria 2554
190 Ga0307515_10241205 3300028794 Bacteria 1578
191 Ga0316180_1112319 3300030736 Bacteria 1632
192 Ga0316181_1216539 3300030744 Bacteria 1218
193 Ga0307408_100001129 3300031548 Bacteria 20315
194 Ga0307408_100001185 3300031548 Bacteria 19736
195 Ga0307408_100003316 3300031548 Bacteria 11066
196 Ga0307416_100084493 3300032002 Bacteria 2697
197 Ga0307414_10003286 3300032004 Bacteria 8617
198 Ga0373952_0002402 3300035092 Bacteria 3375
199 Ga0373935_0161480 3300035692 Bacteria 1528
200 Ga0395899_0004735 3300037312 Bacteria 10613
201 Ga0395899_0005686 3300037312 Bacteria 9680
202 Ga0395899_0010310 3300037312 Bacteria 7165
203 Ga0395899_0091327 3300037312 Bacteria 2206
204 Ga0395900_0002091 3300037418 Bacteria 22383
205 Ga0395900_0003097 3300037418 Bacteria 18057
206 Ga0395900_0003147 3300037418 Bacteria 17898
207 Ga0395900_0080938 3300037418 Bacteria 3337
208 Ga0395898_0011645 3300037466 Bacteria 9124
209 Ga0395898_0017086 3300037466 Bacteria 7410
210 Ga0395898_0031587 3300037466 Bacteria 5290
211 Ga0395898_0091283 3300037466 Bacteria 2930
212 Ga0395905_0013949 3300037471 Bacteria 7685
213 Ga0395905_0015250 3300037471 Bacteria 7306
214 Ga0395905_0055941 3300037471 Bacteria 3692
215 Ga0395905_0059785 3300037471 Bacteria 3563
216 Ga0395905_0149117 3300037471 Bacteria 2200
217 Ga0395905_0436863 3300037471 Bacteria 1206
218 Ga0395901_0000212 3300038443 Bacteria 73375
219 Ga0395901_0000522 3300038443 Bacteria 44365
220 Ga0395901_0229464 3300038443 Bacteria 1938
221 Ga0436360_1203167 3300039438 Bacteria 839
222 Ga0436361_0168778 3300039447 Bacteria 51987
223 Ga0436361_0993359 3300039447 Bacteria 43823
224 Ga0439448_0016603 3300042005 Bacteria 2241
225 Ga0439449_0024840 3300042007 Bacteria 2240
226 Ga0439450_011670 3300042008 Bacteria 1726
227 Ga0439450_043299 3300042008 Bacteria 1051
228 Ga0439455_0006438 3300042012 Bacteria 2437
229 Ga0450897_001616 3300042128 Bacteria 1561
230 Ga0466972_0023087 3300044658 Bacteria 3095
231 Ga0466965_0009082 3300044683 Bacteria 4611
232 Ga0466965_0016185 3300044683 Bacteria 3545
233 Ga0466965_0024959 3300044683 Bacteria 2892
234 Ga0466966_0000457 3300044684 Bacteria 26267
235 Ga0466966_0019594 3300044684 Bacteria 4451
236 Ga0466966_0065376 3300044684 Bacteria 2287
237 Ga0466966_0132664 3300044684 Bacteria 1524
238 Ga0466966_0145256 3300044684 Bacteria 1448
239 Ga0466961_0009150 3300044693 Bacteria 6307
240 Ga0466961_0027393 3300044693 Bacteria 3665
241 Ga0466963_0207435 3300044694 Bacteria 1371
242 Ga0466964_0000435 3300044706 Bacteria 12697
243 Ga0466964_0002446 3300044706 Bacteria 6605
244 Ga0466964_0014920 3300044706 Bacteria 2959
245 Ga0466968_0001497 3300044735 Bacteria 8367
246 Ga0466968_0043937 3300044735 Bacteria 1893
247 Ga0466970_0024531 3300044765 Bacteria 3154
248 Ga0466970_0095349 3300044765 Bacteria 1617
249 Ga0466957_0000114 3300044842 Bacteria 33158
250 Ga0466957_0012400 3300044842 Bacteria 4933
251 Ga0466957_0027382 3300044842 Bacteria 3387
252 Ga0466960_0067601 3300044901 Bacteria 1770
253 Ga0466959_0005057 3300045049 Bacteria 8964
254 Ga0466959_0025010 3300045049 Bacteria 4423
255 Ga0466959_0030580 3300045049 Bacteria 3988
256 Ga0451576_0017483 3300045051 Bacteria 7883
257 Ga0466967_0030085 3300045976 Bacteria 4553
258 Ga0495617_000042 3300046452 Bacteria 122225
259 Ga0495617_000063 3300046452 Bacteria 95793
260 Ga0495617_037565 3300046452 Bacteria 1621
261 Ga0495627_000057 3300046453 Bacteria 144773
262 Ga0495627_000323 3300046453 Bacteria 46699
263 Ga0495627_003505 3300046453 Bacteria 6881
264 Ga0495590_0000010 3300046457 Bacteria 317890
265 Ga0495590_0000837 3300046457 Bacteria 13900
266 Ga0495590_0002387 3300046457 Bacteria 7779
267 Ga0495590_0062336 3300046457 Bacteria 1305
268 Ga0495629_0017851 3300046459 Bacteria 5085
269 Ga0495629_0035318 3300046459 Bacteria 3532
270 Ga0495638_0000027 3300046460 Bacteria 337569
271 Ga0495638_0020283 3300046460 Bacteria 4392
272 Ga0495638_0020825 3300046460 Bacteria 4331
273 Ga0495638_0024603 3300046460 Bacteria 3924
274 Ga0495638_0048379 3300046460 Bacteria 2662
275 Ga0495638_0056006 3300046460 Bacteria 2447
276 Ga0495653_0004474 3300046463 Bacteria 11286
277 Ga0495653_0035700 3300046463 Bacteria 3921
278 Ga0495653_0066832 3300046463 Bacteria 2702
279 Ga0495653_0112559 3300046463 Bacteria 1953
280 Ga0495650_0000044 3300046471 Bacteria 355139
281 Ga0495650_0000066 3300046471 Bacteria 272883
282 Ga0495650_0000229 3300046471 Bacteria 114086
283 Ga0495650_0001129 3300046471 Bacteria 29018
284 Ga0495650_0003132 3300046471 Bacteria 12383
285 Ga0495650_0017307 3300046471 Bacteria 3617
286 Ga0495650_0030602 3300046471 Bacteria 2435
287 Ga0495582_0020516 3300046473 Bacteria 3618
288 Ga0495605_0000027 3300046474 Bacteria 220680
289 Ga0495605_0000049 3300046474 Bacteria 166669
290 Ga0495605_0000130 3300046474 Bacteria 98652
291 Ga0495605_0009901 3300046474 Bacteria 5345
292 Ga0495605_0012517 3300046474 Bacteria 4703
293 Ga0495605_0030705 3300046474 Bacteria 2752
294 Ga0495605_0037262 3300046474 Bacteria 2447
295 Ga0495605_0050378 3300046474 Bacteria 2031
296 Ga0495605_0062472 3300046474 Bacteria 1779
297 Ga0495605_0091000 3300046474 Bacteria 1414
298 Ga0495639_0013547 3300046475 Bacteria 3524
299 Ga0495584_0000001 3300046491 Bacteria 649329
300 Ga0495584_0000137 3300046491 Bacteria 50397
301 Ga0495584_0000164 3300046491 Bacteria 46886
302 Ga0495584_0001830 3300046491 Bacteria 12360
303 Ga0495584_0007483 3300046491 Bacteria 5693
304 Ga0495584_0008092 3300046491 Bacteria 5463
305 Ga0495584_0010845 3300046491 Bacteria 4676
306 Ga0495584_0122624 3300046491 Bacteria 1316
307 Ga0495584_0138294 3300046491 Bacteria 1236
308 Ga0495585_0000003 3300046492 Bacteria 406344
309 Ga0495585_0000011 3300046492 Bacteria 210440
310 Ga0495585_0000040 3300046492 Bacteria 130615
311 Ga0495585_0000233 3300046492 Bacteria 57350
312 Ga0495585_0000365 3300046492 Bacteria 43900
313 Ga0495585_0000385 3300046492 Bacteria 42521
314 Ga0495585_0000486 3300046492 Bacteria 37724
315 Ga0495585_0002878 3300046492 Bacteria 11968
316 Ga0495585_0004384 3300046492 Bacteria 9162
317 Ga0495585_0046779 3300046492 Bacteria 2411
318 Ga0495585_0048301 3300046492 Bacteria 2366
319 Ga0495585_0106325 3300046492 Bacteria 1496
320 Ga0495594_0001143 3300046499 Bacteria 13853
321 Ga0495594_0024171 3300046499 Bacteria 3261
322 Ga0495594_0062918 3300046499 Bacteria 2055
323 Ga0495594_0076177 3300046499 Bacteria 1870
324 Ga0495594_0148906 3300046499 Bacteria 1328
325 Ga0495596_0000106 3300046500 Bacteria 59325
326 Ga0495596_0000424 3300046500 Bacteria 27006
327 Ga0495596_0001138 3300046500 Bacteria 15633
328 Ga0495596_0001319 3300046500 Bacteria 14292
329 Ga0495596_0006923 3300046500 Bacteria 5163
330 Ga0495596_0014663 3300046500 Bacteria 3299
331 Ga0495596_0018568 3300046500 Bacteria 2864
332 Ga0495596_0020523 3300046500 Bacteria 2704
333 Ga0495596_0075812 3300046500 Bacteria 1306
334 Ga0495607_0001405 3300046501 Bacteria 21429
335 Ga0495607_0001669 3300046501 Bacteria 19202
336 Ga0495607_0002038 3300046501 Bacteria 16919
337 Ga0495607_0005509 3300046501 Bacteria 9041
338 Ga0495607_0006690 3300046501 Bacteria 8074
339 Ga0495607_0006835 3300046501 Bacteria 7961
340 Ga0495607_0058664 3300046501 Bacteria 2199
341 Ga0495583_0000006 3300046506 Bacteria 436893
342 Ga0495583_0000095 3300046506 Bacteria 152114
343 Ga0495583_0000117 3300046506 Bacteria 135061
344 Ga0495583_0000381 3300046506 Bacteria 68754
345 Ga0495583_0000551 3300046506 Bacteria 52385
346 Ga0495583_0004237 3300046506 Bacteria 10405
347 Ga0495583_0008753 3300046506 Bacteria 6141
348 Ga0495583_0011133 3300046506 Bacteria 5183
349 Ga0495583_0015640 3300046506 Bacteria 4116
350 Ga0495583_0029846 3300046506 Bacteria 2663
351 Ga0495583_0046412 3300046506 Bacteria 2003
352 Ga0495583_0113016 3300046506 Bacteria 1149
353 Ga0495606_0000125 3300046507 Bacteria 130102
354 Ga0495606_0000128 3300046507 Bacteria 128179
355 Ga0495606_0000557 3300046507 Bacteria 59505
356 Ga0495606_0001131 3300046507 Bacteria 38024
357 Ga0495606_0001352 3300046507 Bacteria 33283
358 Ga0495606_0005861 3300046507 Bacteria 11582
359 Ga0495606_0007239 3300046507 Bacteria 9999
360 Ga0495606_0022454 3300046507 Bacteria 4597
361 Ga0495606_0042627 3300046507 Bacteria 3033
362 Ga0495606_0050520 3300046507 Bacteria 2720
363 Ga0495606_0164429 3300046507 Bacteria 1292
364 Ga0495608_0253561 3300046511 Bacteria 1097
365 Ga0495610_0000008 3300046512 Bacteria 622732
366 Ga0495610_0002638 3300046512 Bacteria 14832
367 Ga0495610_0005058 3300046512 Bacteria 9508
368 Ga0495610_0009097 3300046512 Bacteria 6328
369 Ga0495610_0009298 3300046512 Bacteria 6230
370 Ga0495610_0107015 3300046512 Bacteria 1244
371 Ga0495616_0000075 3300046513 Bacteria 84686
372 Ga0495616_0000170 3300046513 Bacteria 56058
373 Ga0495616_0000902 3300046513 Bacteria 21420
374 Ga0495616_0001358 3300046513 Bacteria 17066
375 Ga0495616_0003193 3300046513 Bacteria 10572
376 Ga0495616_0005436 3300046513 Bacteria 7841
377 Ga0495616_0008471 3300046513 Bacteria 6090
378 Ga0495616_0011720 3300046513 Bacteria 5010
379 Ga0495620_0098836 3300046515 Bacteria 1165
380 Ga0495628_0096240 3300046516 Bacteria 2287
381 Ga0495630_0093605 3300046517 Bacteria 2271
382 Ga0495630_0099341 3300046517 Bacteria 2202
383 Ga0495631_0000417 3300046518 Bacteria 29338
384 Ga0495631_0002592 3300046518 Bacteria 10111
385 Ga0495631_0005682 3300046518 Bacteria 6506
386 Ga0495631_0007774 3300046518 Bacteria 5440
387 Ga0495631_0013672 3300046518 Bacteria 3933
388 Ga0495631_0014256 3300046518 Bacteria 3840
389 Ga0495631_0017463 3300046518 Bacteria 3394
390 Ga0495631_0024430 3300046518 Bacteria 2790
391 Ga0495631_0059670 3300046518 Bacteria 1656
392 Ga0495632_0000057 3300046519 Bacteria 123635
393 Ga0495632_0000091 3300046519 Bacteria 93600
394 Ga0495632_0000201 3300046519 Bacteria 60697
395 Ga0495632_0000358 3300046519 Bacteria 43419
396 Ga0495632_0025745 3300046519 Bacteria 3108
397 Ga0495637_0000067 3300046520 Bacteria 86002
398 Ga0495643_0000022 3300046522 Bacteria 289691
399 Ga0495643_0000065 3300046522 Bacteria 179031
400 Ga0495643_0000094 3300046522 Bacteria 150795
401 Ga0495643_0000326 3300046522 Bacteria 65454
402 Ga0495643_0001487 3300046522 Bacteria 21325
403 Ga0495643_0007451 3300046522 Bacteria 7049
404 Ga0495643_0014799 3300046522 Bacteria 4632
405 Ga0495643_0041640 3300046522 Bacteria 2504
406 Ga0495643_0073832 3300046522 Bacteria 1787
407 Ga0495643_0132751 3300046522 Bacteria 1248
408 Ga0495644_0007237 3300046523 Bacteria 4290
409 Ga0495644_0036002 3300046523 Bacteria 1867
410 Ga0495644_0056542 3300046523 Bacteria 1474
411 Ga0495644_0088409 3300046523 Bacteria 1168
412 Ga0495648_0000011 3300046524 Bacteria 299518
413 Ga0495648_0000078 3300046524 Bacteria 127397
414 Ga0495648_0000883 3300046524 Bacteria 31505
415 Ga0495648_0000928 3300046524 Bacteria 30479
416 Ga0495648_0002119 3300046524 Bacteria 18687
417 Ga0495648_0012722 3300046524 Bacteria 6254
418 Ga0495648_0016036 3300046524 Bacteria 5410
419 Ga0495648_0021870 3300046524 Bacteria 4417
420 Ga0495648_0043528 3300046524 Bacteria 2813
421 Ga0495648_0057531 3300046524 Bacteria 2331
422 Ga0495663_0001726 3300046525 Bacteria 6785
423 Ga0495663_0043871 3300046525 Bacteria 1367
424 Ga0495663_0057552 3300046525 Bacteria 1216
425 Ga0495666_0000160 3300046526 Bacteria 28558
426 Ga0495666_0000267 3300046526 Bacteria 22575
427 Ga0495666_0008547 3300046526 Bacteria 5132
428 Ga0495666_0017645 3300046526 Bacteria 3553
429 Ga0495666_0064778 3300046526 Bacteria 1744
430 Ga0495642_0000012 3300046528 Bacteria 127229
431 Ga0495642_0000128 3300046528 Bacteria 43466
432 Ga0495642_0000439 3300046528 Bacteria 21933
433 Ga0495642_0000919 3300046528 Bacteria 13828
434 Ga0495642_0003382 3300046528 Bacteria 6297
435 Ga0495642_0006493 3300046528 Bacteria 4487
436 Ga0495642_0009466 3300046528 Bacteria 3728
437 Ga0495642_0012229 3300046528 Bacteria 3307
438 Ga0495642_0018438 3300046528 Bacteria 2732
439 Ga0495642_0023585 3300046528 Bacteria 2429
440 Ga0495642_0026918 3300046528 Bacteria 2286
441 Ga0495642_0030434 3300046528 Bacteria 2159
442 Ga0495642_0096280 3300046528 Bacteria 1256
443 Ga0495652_0058522 3300046529 Bacteria 3262
444 Ga0495654_0000002 3300046530 Bacteria 1021205
445 Ga0495654_0010283 3300046530 Bacteria 5094
446 Ga0495654_0023750 3300046530 Bacteria 3173
447 Ga0495654_0028268 3300046530 Bacteria 2868
448 Ga0495654_0032205 3300046530 Bacteria 2658
449 Ga0495654_0072958 3300046530 Bacteria 1624
450 Ga0495654_0078306 3300046530 Bacteria 1554
451 Ga0495665_0003469 3300046531 Bacteria 8556
452 Ga0495665_0018914 3300046531 Bacteria 3702
453 Ga0495665_0039773 3300046531 Bacteria 2504
454 Ga0495640_0148636 3300046533 Bacteria 1506
455 Ga0495586_0016175 3300046535 Bacteria 3968
456 Ga0495586_0021113 3300046535 Bacteria 3469
457 Ga0495586_0108193 3300046535 Bacteria 1546
458 Ga0495586_0128037 3300046535 Bacteria 1421
459 Ga0495587_0014738 3300046536 Bacteria 4896
460 Ga0495609_0000001 3300046538 Bacteria 1060094
461 Ga0495609_0001621 3300046538 Bacteria 14679
462 Ga0495609_0002680 3300046538 Bacteria 10766
463 Ga0495609_0004160 3300046538 Bacteria 8036
464 Ga0495609_0005651 3300046538 Bacteria 6517
465 Ga0495609_0007380 3300046538 Bacteria 5497
466 Ga0495609_0013816 3300046538 Bacteria 3806
467 Ga0495609_0019974 3300046538 Bacteria 3097
468 Ga0495609_0034566 3300046538 Bacteria 2291
469 Ga0495609_0039085 3300046538 Bacteria 2137
470 Ga0495609_0055489 3300046538 Bacteria 1757
471 Ga0495609_0072809 3300046538 Bacteria 1508
472 Ga0495609_0078055 3300046538 Bacteria 1449
473 Ga0495609_0101599 3300046538 Bacteria 1245
474 Ga0495597_0000009 3300046542 Bacteria 227319
475 Ga0495597_0000029 3300046542 Bacteria 136312
476 Ga0495597_0000107 3300046542 Bacteria 73749
477 Ga0495597_0000335 3300046542 Bacteria 42105
478 Ga0495597_0000466 3300046542 Bacteria 34350
479 Ga0495597_0003120 3300046542 Bacteria 9945
480 Ga0495597_0008860 3300046542 Bacteria 5018
481 Ga0495597_0011431 3300046542 Bacteria 4303
482 Ga0495597_0029264 3300046542 Bacteria 2515
483 Ga0495597_0067704 3300046542 Bacteria 1544
484 Ga0495645_0101123 3300046543 Bacteria 2050
485 Ga0495622_0000043 3300046557 Bacteria 115796
486 Ga0495622_0001191 3300046557 Bacteria 13432
487 Ga0495622_0011143 3300046557 Bacteria 4150
488 Ga0495622_0019628 3300046557 Bacteria 3147
489 Ga0495633_0000381 3300046558 Bacteria 47007
490 Ga0495633_0000577 3300046558 Bacteria 35551
491 Ga0495633_0001135 3300046558 Bacteria 21402
492 Ga0495633_0001381 3300046558 Bacteria 18966
493 Ga0495633_0003447 3300046558 Bacteria 10518
494 Ga0495633_0006010 3300046558 Bacteria 7293
495 Ga0495633_0006135 3300046558 Bacteria 7194
496 Ga0495633_0007174 3300046558 Bacteria 6460
497 Ga0495633_0012130 3300046558 Bacteria 4601
498 Ga0495633_0014246 3300046558 Bacteria 4164
499 Ga0495633_0016160 3300046558 Bacteria 3856
500 Ga0495633_0038540 3300046558 Bacteria 2282
501 Ga0495633_0041795 3300046558 Bacteria 2179
502 Ga0495656_0033049 3300046615 Bacteria 2109
503 Ga0495656_0062651 3300046615 Bacteria 1627
504 Ga0495668_0000006 3300046616 Bacteria 553404
505 Ga0495668_0000027 3300046616 Bacteria 297194
506 Ga0495668_0000096 3300046616 Bacteria 139693
507 Ga0495668_0000180 3300046616 Bacteria 94157
508 Ga0495668_0000429 3300046616 Bacteria 54505
509 Ga0495668_0001010 3300046616 Bacteria 30202
510 Ga0495668_0001031 3300046616 Bacteria 29510
511 Ga0495668_0001648 3300046616 Bacteria 20817
512 Ga0495668_0003280 3300046616 Bacteria 12289
513 Ga0495668_0006316 3300046616 Bacteria 7797
514 Ga0495668_0007037 3300046616 Bacteria 7257
515 Ga0495668_0016242 3300046616 Bacteria 4327
516 Ga0495668_0032675 3300046616 Bacteria 2926
517 Ga0495668_0035888 3300046616 Bacteria 2779
518 Ga0495668_0037133 3300046616 Bacteria 2727
519 Ga0495668_0042122 3300046616 Bacteria 2542
520 Ga0495668_0066935 3300046616 Bacteria 1976
521 Ga0495668_0084778 3300046616 Bacteria 1737
522 Ga0495668_0095069 3300046616 Bacteria 1631
523 Ga0495668_0121559 3300046616 Bacteria 1428
524 Ga0495634_0022518 3300046642 Bacteria 4439
525 Ga0495611_0000437 3300046648 Bacteria 25695
526 Ga0495611_0008801 3300046648 Bacteria 4270
527 Ga0495611_0012180 3300046648 Bacteria 3655
528 Ga0495611_0013380 3300046648 Bacteria 3493
529 Ga0495611_0014600 3300046648 Bacteria 3358
530 Ga0495611_0044894 3300046648 Bacteria 1977
531 Ga0495611_0060529 3300046648 Bacteria 1720
532 Ga0495611_0120645 3300046648 Bacteria 1222
533 Ga0495625_0000053 3300046660 Bacteria 190575
534 Ga0495625_0002139 3300046660 Bacteria 21993
535 Ga0495625_0008684 3300046660 Bacteria 8631
536 Ga0495625_0009670 3300046660 Bacteria 8036
537 Ga0495625_0009909 3300046660 Bacteria 7924
538 Ga0495625_0018522 3300046660 Bacteria 5433
539 Ga0495625_0025290 3300046660 Bacteria 4504
540 Ga0495625_0047439 3300046660 Bacteria 3097
541 Ga0495625_0050151 3300046660 Bacteria 2996
542 Ga0495625_0054292 3300046660 Bacteria 2862
543 Ga0495625_0088900 3300046660 Bacteria 2139
544 Ga0495625_0098309 3300046660 Bacteria 2013
545 Ga0495625_0206796 3300046660 Bacteria 1292
546 Ga0495659_0000001 3300046664 Bacteria 325846
547 Ga0495659_0017668 3300046664 Bacteria 2367
548 Ga0495661_0000023 3300046665 Bacteria 189053
549 Ga0495661_0000148 3300046665 Bacteria 81610
550 Ga0495661_0000287 3300046665 Bacteria 57151
551 Ga0495661_0003345 3300046665 Bacteria 11883
552 Ga0495661_0004688 3300046665 Bacteria 9819
553 Ga0495661_0025832 3300046665 Bacteria 3788
554 Ga0495661_0033305 3300046665 Bacteria 3251
555 Ga0495661_0049687 3300046665 Bacteria 2542
556 Ga0495661_0051076 3300046665 Bacteria 2498
557 Ga0495661_0057062 3300046665 Bacteria 2333
558 Ga0495661_0061447 3300046665 Bacteria 2230
559 Ga0495661_0102466 3300046665 Bacteria 1609
560 Ga0495661_0174753 3300046665 Bacteria 1142
561 Ga0495588_0000041 3300046674 Bacteria 377896
562 Ga0495588_0003113 3300046674 Bacteria 7178
563 Ga0495588_0020102 3300046674 Bacteria 3276
564 Ga0495588_0094174 3300046674 Bacteria 1570
565 Ga0495588_0136839 3300046674 Bacteria 1293
566 Ga0495588_0161383 3300046674 Bacteria 1185
567 Ga0495623_0010749 3300046679 Bacteria 5926
568 Ga0495623_0051175 3300046679 Bacteria 2614
569 Ga0495623_0070655 3300046679 Bacteria 2174
570 Ga0495646_0081670 3300046680 Bacteria 1883
571 Ga0495646_0108020 3300046680 Bacteria 1587
572 Ga0495658_0002916 3300046683 Bacteria 8587
573 Ga0495669_0000017 3300046684 Bacteria 131447
574 Ga0495669_0000429 3300046684 Bacteria 19950
575 Ga0495669_0000484 3300046684 Bacteria 18421
576 Ga0495669_0009083 3300046684 Bacteria 4189
577 Ga0495613_0016878 3300046689 Bacteria 5436
578 Ga0495624_0006051 3300046690 Bacteria 8629
579 Ga0495670_0000122 3300046691 Bacteria 33678
580 Ga0495670_0001433 3300046691 Bacteria 11688
581 Ga0495670_0001786 3300046691 Bacteria 10557
582 Ga0495670_0010563 3300046691 Bacteria 4538
583 Ga0495670_0019050 3300046691 Bacteria 3382
584 Ga0495670_0036181 3300046691 Bacteria 2460
585 Ga0495670_0036802 3300046691 Bacteria 2439
586 Ga0495670_0086930 3300046691 Bacteria 1597
587 Ga0495670_0117606 3300046691 Bacteria 1379
588 Ga0495671_0000002 3300046692 Bacteria 1136189
589 Ga0495671_0000035 3300046692 Bacteria 188543
590 Ga0495671_0000140 3300046692 Bacteria 63602
591 Ga0495671_0002321 3300046692 Bacteria 12087
592 Ga0495671_0009573 3300046692 Bacteria 5408
593 Ga0495671_0016243 3300046692 Bacteria 3978
594 Ga0495671_0047593 3300046692 Bacteria 2142
595 Ga0495671_0048524 3300046692 Bacteria 2118
596 Ga0495649_0002789 3300046694 Bacteria 12166
597 Ga0495649_0028441 3300046694 Bacteria 3098
598 Ga0495589_0000027 3300046794 Bacteria 181084
599 Ga0495589_0000102 3300046794 Bacteria 82380
600 Ga0495589_0000600 3300046794 Bacteria 24459
601 Ga0495589_0003377 3300046794 Bacteria 8654
602 Ga0495589_0005590 3300046794 Bacteria 6629
603 Ga0495589_0016821 3300046794 Bacteria 3755
604 Ga0495589_0040644 3300046794 Bacteria 2321
605 Ga0495589_0114346 3300046794 Bacteria 1301
606 Ga0495600_0047066 3300046809 Bacteria 2813
607 Ga0495660_0000069 3300046810 Bacteria 115654
608 Ga0495660_0000132 3300046810 Bacteria 81849
609 Ga0495660_0001231 3300046810 Bacteria 17853
610 Ga0495660_0003475 3300046810 Bacteria 9727
611 Ga0495660_0018729 3300046810 Bacteria 3976
612 Ga0495660_0022256 3300046810 Bacteria 3619
613 Ga0495660_0025019 3300046810 Bacteria 3393
614 Ga0495660_0031928 3300046810 Bacteria 2958
615 Ga0495660_0036753 3300046810 Bacteria 2730
616 Ga0495660_0056861 3300046810 Bacteria 2112
617 Ga0495660_0080464 3300046810 Bacteria 1709
618 Ga0495660_0182145 3300046810 Bacteria 1015
619 Ga0495581_0004532 3300047315 Bacteria 8026
620 Ga0495581_0043781 3300047315 Bacteria 2589
621 Ga0495604_0019344 3300047317 Bacteria 5451
622 Ga0495604_0050325 3300047317 Bacteria 3235
623 Ga0495636_0003615 3300047318 Bacteria 5997
624 Ga0495636_0004270 3300047318 Bacteria 5605
625 Ga0495636_0011926 3300047318 Bacteria 3444
626 Ga0495674_0002798 3300047319 Bacteria 16935
627 Ga0495672_0000022 3300047320 Bacteria 420632
628 Ga0495672_0000066 3300047320 Bacteria 193318
629 Ga0495672_0000095 3300047320 Bacteria 143883
630 Ga0495672_0000231 3300047320 Bacteria 79748
631 Ga0495672_0003237 3300047320 Bacteria 14136
632 Ga0495672_0005035 3300047320 Bacteria 10569
633 Ga0495672_0022297 3300047320 Bacteria 4119
634 Ga0495676_0000017 3300047321 Bacteria 181815
635 Ga0495676_0033969 3300047321 Bacteria 4285
636 Ga0495676_0074145 3300047321 Bacteria 2607
637 Ga0495680_0006458 3300047322 Bacteria 10889
638 Ga0495680_0134329 3300047322 Bacteria 1815
639 Ga0495683_0000005 3300047323 Bacteria 287871
640 Ga0495683_0105998 3300047323 Bacteria 1347
641 Ga0495683_0130721 3300047323 Bacteria 1184
642 Ga0495687_000023 3300047443 Bacteria 317750
643 Ga0495687_000027 3300047443 Bacteria 299689
644 Ga0495687_000034 3300047443 Bacteria 257321
645 Ga0495687_000048 3300047443 Bacteria 205967
646 Ga0495687_000524 3300047443 Bacteria 45771
647 Ga0495687_001158 3300047443 Bacteria 25533
648 Ga0495687_002491 3300047443 Bacteria 14686
649 Ga0495687_035282 3300047443 Bacteria 2250
650 Ga0495675_0009439 3300047444 Bacteria 6070
651 Ga0495675_0026728 3300047444 Bacteria 3680
652 Ga0495677_0000001 3300047445 Bacteria 715000
653 Ga0495677_0000067 3300047445 Bacteria 55897
654 Ga0495677_0000677 3300047445 Bacteria 13782
655 Ga0495677_0005267 3300047445 Bacteria 4916
656 Ga0495677_0005773 3300047445 Bacteria 4686
657 Ga0495677_0005839 3300047445 Bacteria 4659
658 Ga0495677_0005940 3300047445 Bacteria 4624
659 Ga0495677_0011590 3300047445 Bacteria 3223
660 Ga0495677_0014975 3300047445 Bacteria 2820
661 Ga0495677_0039007 3300047445 Bacteria 1736
662 Ga0495679_004242 3300047446 Bacteria 6661
663 Ga0495679_005144 3300047446 Bacteria 5860
664 Ga0495679_006136 3300047446 Bacteria 5231
665 Ga0495679_006944 3300047446 Bacteria 4797
666 Ga0495679_021023 3300047446 Bacteria 2263
667 Ga0495685_009304 3300047447 Bacteria 3278
668 Ga0495685_014627 3300047447 Bacteria 2668
669 Ga0495685_051605 3300047447 Bacteria 1394
670 Ga0495673_0000059 3300047469 Bacteria 233234
671 Ga0495673_0000064 3300047469 Bacteria 225793
672 Ga0495673_0049798 3300047469 Bacteria 1842
673 Ga0495681_0000018 3300047470 Bacteria 177306
674 Ga0495681_0001220 3300047470 Bacteria 19572
675 Ga0495681_0003868 3300047470 Bacteria 10347
676 Ga0495681_0004757 3300047470 Bacteria 9199
677 Ga0495681_0008989 3300047470 Bacteria 6199
678 Ga0495681_0009121 3300047470 Bacteria 6143
679 Ga0495681_0009347 3300047470 Bacteria 6047
680 Ga0495681_0010500 3300047470 Bacteria 5603
681 Ga0495681_0020670 3300047470 Bacteria 3566
682 Ga0495681_0047735 3300047470 Bacteria 2035
683 Ga0495686_0000135 3300047472 Bacteria 148920
684 Ga0495686_0000462 3300047472 Bacteria 61070
685 Ga0495686_0000640 3300047472 Bacteria 48223
686 Ga0495686_0001427 3300047472 Bacteria 26117
687 Ga0495686_0009909 3300047472 Bacteria 6824
688 Ga0495686_0036829 3300047472 Bacteria 3138
689 Ga0495686_0147790 3300047472 Bacteria 1382
690 Ga0495593_0002837 3300047673 Bacteria 10436
691 Ga0495593_0039247 3300047673 Bacteria 2553
692 Ga0495602_0123721 3300048088 Bacteria 2076
693 Ga0495614_0060962 3300048089 Bacteria 1620
694 Ga0495615_0000944 3300048090 Bacteria 4132
695 Ga0495615_0028137 3300048090 Bacteria 1325
696 Ga0495626_0000037 3300048091 Bacteria 178573
697 Ga0495626_0000535 3300048091 Bacteria 37780
698 Ga0495626_0000754 3300048091 Bacteria 29854
699 Ga0495626_0003874 3300048091 Bacteria 9383
700 Ga0495626_0004907 3300048091 Bacteria 8039
701 Ga0495626_0007550 3300048091 Bacteria 6039
702 Ga0495626_0009094 3300048091 Bacteria 5389
703 Ga0495626_0010374 3300048091 Bacteria 4973
704 Ga0495626_0015581 3300048091 Bacteria 3886
705 Ga0495626_0017666 3300048091 Bacteria 3596
706 Ga0495626_0024208 3300048091 Bacteria 2979
707 Ga0495626_0031604 3300048091 Bacteria 2547
708 Ga0495626_0043744 3300048091 Bacteria 2099
709 Ga0495626_0046493 3300048091 Bacteria 2021
710 Ga0495626_0098322 3300048091 Bacteria 1278
711 Ga0496101_0123396 3300048904 Bacteria 1960
712 Ga0496102_0000151 3300048905 Bacteria 94403
713 Ga0496102_0000182 3300048905 Bacteria 84891
714 Ga0496102_0010154 3300048905 Bacteria 8095
715 Ga0496102_0105874 3300048905 Bacteria 2617
716 Ga0496102_0232126 3300048905 Bacteria 1739
717 Ga0496103_0005130 3300048906 Bacteria 7885
718 Ga0496103_0027157 3300048906 Bacteria 3466
719 Ga0496103_0043530 3300048906 Bacteria 2765
720 Ga0496103_0100972 3300048906 Bacteria 1826
721 Ga0496104_0016139 3300048907 Bacteria 6779
722 Ga0496104_0269407 3300048907 Bacteria 1615
723 Ga0496105_0046695 3300048908 Bacteria 3574
724 Ga0496106_0009494 3300048909 Bacteria 7190
725 Ga0496106_0173532 3300048909 Bacteria 1710
726 Ga0496109_0202926 3300048912 Bacteria 1864
727 Ga0496109_0434692 3300048912 Bacteria 1240
728 Ga0496110_0074408 3300048913 Bacteria 3017
729 Ga0496112_0315152 3300048915 Bacteria 1509
730 Ga0496113_0002561 3300048916 Bacteria 10618
731 Ga0496113_0006144 3300048916 Bacteria 7581
732 Ga0496113_0212904 3300048916 Bacteria 1539
733 Ga0496114_0065321 3300048917 Bacteria 3049
734 Ga0496115_0017832 3300048918 Bacteria 5437
735 Ga0496115_0021525 3300048918 Bacteria 4983
736 Ga0496115_0097860 3300048918 Bacteria 2403
737 Ga0496115_0123143 3300048918 Bacteria 2134
738 Ga0496116_0015645 3300048919 Bacteria 5989
739 Ga0496116_0074770 3300048919 Bacteria 2129
740 Ga0496117_0000001 3300048920 Bacteria 2526244
741 Ga0496118_0000002 3300048921 Bacteria 1690764
742 Ga0496121_0007795 3300048924 Bacteria 12820
743 Ga0496121_0011077 3300048924 Bacteria 10062
744 Ga0496121_0305301 3300048924 Bacteria 1078
745 Ga0496122_0000712 3300048925 Bacteria 65645
746 Ga0496122_0003090 3300048925 Bacteria 22393
747 Ga0496122_0013372 3300048925 Bacteria 8035
748 Ga0496122_0014805 3300048925 Bacteria 7515
749 Ga0496122_0075194 3300048925 Bacteria 2385
750 Ga0496123_0000502 3300048926 Bacteria 67921
751 Ga0496123_0005830 3300048926 Bacteria 12218
752 Ga0496123_0020981 3300048926 Bacteria 5091
753 Ga0496123_0065455 3300048926 Bacteria 2310
754 Ga0496124_0003831 3300048927 Bacteria 18028
755 Ga0496124_0012443 3300048927 Bacteria 8400
756 Ga0496124_0029879 3300048927 Bacteria 4848
757 Ga0496124_0065386 3300048927 Bacteria 3033
758 Ga0496124_0132635 3300048927 Bacteria 1977
759 Ga0496124_0180620 3300048927 Bacteria 1624
760 Ga0496124_0220205 3300048927 Bacteria 1428
761 Ga0496125_0017614 3300048928 Bacteria 6805
762 Ga0496125_0034021 3300048928 Bacteria 4498
763 Ga0496125_0213634 3300048928 Bacteria 1250
764 Ga0496126_0030419 3300048929 Bacteria 5115
765 Ga0495678_000100 3300049459 Bacteria 106118
766 Ga0495678_000286 3300049459 Bacteria 55456
767 Ga0495678_000588 3300049459 Bacteria 34196
768 Ga0495678_000705 3300049459 Bacteria 30390
769 Ga0495678_002236 3300049459 Bacteria 13490
770 Ga0495678_003925 3300049459 Bacteria 8916
771 Ga0495682_0000066 3300049460 Bacteria 97829
772 Ga0495682_0001017 3300049460 Bacteria 16630
773 Ga0501222_009165 3300049662 Bacteria 1310
774 Ga0501227_002037 3300049665 Bacteria 4484
775 Ga0501238_002661 3300049671 Bacteria 2151
776 Ga0501249_001440 3300049679 Bacteria 4903
777 Ga0501249_013450 3300049679 Bacteria 1739
778 Ga0501241_012372 3300049758 Bacteria 1551
779 Ga0501269_000423 3300049766 Bacteria 9533
780 Ga0501035_0000866 3300049822 Bacteria 32272
781 Ga0501044_0031874 3300049823 Bacteria 5544
782 Ga0501044_0429043 3300049823 Bacteria 1231
783 Ga0500594_0002295 3300053118 Bacteria 4147
784 Ga0500594_0004222 3300053118 Bacteria 3168
785 Ga0500618_000137 3300053125 Bacteria 61561
786 Ga0500618_009677 3300053125 Bacteria 2622
787 Ga0500559_0000249 3300053136 Bacteria 42713
788 Ga0500586_000227 3300053145 Bacteria 11155
789 Ga0500586_001150 3300053145 Bacteria 5489
790 Ga0500587_001548 3300053739 Bacteria 3270
791 2547373026 2547132103 Bacteria 5115736
792 2643792135 2643221554 Bacteria 6603920
793 2643799142 2643221556 Bacteria 7251154
794 2644212112 2643221638 Bacteria 6579467
795 2644251528 2643221645 Bacteria 7207331
796 2644357398 2643221664 Bacteria 7272945
797 2644473527 2643221684 Bacteria 7145183
798 2738739989 2738541280 Bacteria 6630198
799 2738828589 2738541297 Bacteria 6549566
800 2738844256 2738541300 Bacteria 6675882
801 2739152385 2738541357 Bacteria 6549408
802 2739194305 2738543003 Bacteria 6549560
803 2739274184 2738543018 Bacteria 6718814
804 2739320781 2738543026 Bacteria 6549408
805 2739339022 2738543029 Bacteria 6549249
806 2739343228 2738543030 Bacteria 6719714
807 2809142964 2808606418 Bacteria 6724496
808 2842717562 2842711865 Bacteria 7155354
809 2843693368 2843690924 Bacteria 5169057
810 2846035068 2846033681 Bacteria 4377894
811 2857550097 2857547612 Bacteria 6179999
812 2857558217 2857553236 Bacteria 6166726
813 2857564517 2857558681 Bacteria 6617694
814 2904427031 2904424332 Bacteria 7633521
815 2919480201 2919476304 Bacteria 5888696
816 2932418947 2932416698 Bacteria 6315112
817 8047679258 8047673197 Bacteria 7395230
818 8055229116 8055225921 Bacteria 3341787
819 Ga0439450_015579
820 JGI25154J39366_1000716
821 JGI25158J39367_1006807
822 JGI25152J39213_1000005
823 JGI25150J39212_1000571
824 JGI25150J39212_1001739
825 JGI25150J39212_1005726
826 JGI25159J45721_1003493
827 JGI25159J45721_1004574
828 JGI25153J46596_10005856
829 rootL2_10030442
830 rootL2_10030453
831 rootL2_10035258
832 rootL2_10117580
833 rootH1_10094760
834 JGI25161J50226_1000182
835 Ga0055529_1000068
836 Ga0055526_1000013
837 Ga0055526_1000048
838 Ga0055526_1000934
839 Ga0055526_1005682
840 Ga0055526_1009881
841 Ga0055537_1000039
842 Ga0055537_1002487
843 Ga0055537_1013747
844 Ga0055537_1018641
845 Ga0055524_1000008
846 Ga0055524_1000187
847 Ga0055524_1004427
848 Ga0055524_1007806
849 Ga0055524_1014954
850 Ga0055534_1000174
851 Ga0055534_1001797
852 Ga0055534_1011384
853 Ga0055528_1000066
854 Ga0055530_10010604
855 Ga0055531_10005354
856 Ga0055543_1000112
857 Ga0055543_1004521
858 Ga0065165_1000005
859 Ga0065165_1001216
860 Ga0065165_1013430
861 Ga0065715_10226472
862 Ga0070658_10298854
863 Ga0070670_100179593
864 Ga0070677_10023916
865 Ga0070666_10019569
866 Ga0070666_10187186
867 Ga0068868_100005354
868 Ga0070661_100028344
869 Ga0070669_100034198
870 Ga0070671_100023446
871 Ga0070674_100182477
872 Ga0070673_100000606
873 Ga0070673_100123979
874 Ga0070659_100216032
875 Ga0070667_100033198
876 Ga0070678_100001713
877 Ga0070678_100329196
878 Ga0068867_100014626
879 Ga0070672_100096403
880 Ga0068855_100002919
881 Ga0070664_100125975
882 Ga0070664_100162879
883 Ga0068852_100121583
884 Ga0068859_100001422
885 Ga0068864_100401147
886 Ga0068861_100035186
887 Ga0068861_100134371
888 Ga0068861_100514437
889 Ga0068863_100017744
890 Ga0068858_100003140
891 Ga0068862_100044143
892 Ga0097621_100085920
893 Ga0068871_100002105
894 Ga0097620_100001422
895 Ga0099826_10000001
896 Ga0105244_10002659
897 Ga0105243_10076171
898 Ga0105242_10091014
899 Ga0105248_10065661
900 Ga0105238_10460173
901 Ga0157371_10000026
902 Ga0157374_10439844
903 Ga0163162_10017462
904 Ga0163162_10147621
905 Ga0157375_10231092
906 Ga0163163_10015841
907 Ga0157380_10049131
908 Ga0182008_10004711
909 Ga0182008_10027096
910 Ga0157376_10126687
911 Ga0182006_1000029
912 Ga0182006_1026492
913 Ga0182007_10000997
914 Ga0182005_1000002
915 Ga0182005_1000012
916 Ga0163161_10060543
917 Ga0163161_10110159
918 Ga0213872_10000032
919 Ga0209436_100484
920 Ga0209436_111393
921 Ga0209563_100003
922 Ga0207425_1000001
923 Ga0207425_1000130
924 Ga0207425_1000132
925 Ga0209646_1000007
926 Ga0209677_108796
927 Ga0209148_1005446
928 Ga0209129_1000003
929 Ga0209129_1009156
930 Ga0209565_1000003
931 Ga0209565_1003147
932 Ga0209565_1003288
933 Ga0209565_1004100
934 Ga0209565_1006959
935 Ga0209565_1017245
936 Ga0209455_1000026
937 Ga0209673_1000003
938 Ga0209673_1014177
939 Ga0209673_1033525
940 Ga0209130_1000084
941 Ga0209130_1000237
942 Ga0209130_1004662
943 Ga0209675_1000003
944 Ga0209675_1006952
945 Ga0209675_1013840
946 Ga0209025_1006230
947 Ga0209564_1000002
948 Ga0209564_1000007
949 Ga0209564_1000012
950 Ga0209564_1000311
951 Ga0209564_1005699
952 Ga0209564_1007930
953 Ga0209758_1000041
954 Ga0209758_1000757
955 Ga0209050_1000011
956 Ga0209050_1000164
957 Ga0209050_1000664
958 Ga0209256_1000005
959 Ga0209256_1000068
960 Ga0209256_1000395
961 Ga0209256_1000952
962 Ga0209256_1003000
963 Ga0207426_1003864
964 Ga0207426_1058678
965 Ga0209257_1000003
966 Ga0209257_1016232
967 Ga0207697_10040931
968 Ga0207655_1004019
969 Ga0207682_10005733
970 Ga0207682_10006232
971 Ga0207680_10002181
972 Ga0207645_10119665
973 Ga0207705_10001990
974 Ga0207705_10072000
975 Ga0207705_10183385
976 Ga0207654_10023184
977 Ga0207662_10012947
978 Ga0207681_10015030
979 Ga0207644_10014885
980 Ga0207706_10080716
981 Ga0207709_10054405
982 Ga0207669_10123980
983 Ga0207691_10088615
984 Ga0207691_10111128
985 Ga0207711_10027897
986 Ga0207679_10040362
987 Ga0207679_10077164
988 Ga0207679_10199365
989 Ga0207667_10001048
990 Ga0207651_10031915
991 Ga0207677_10002910
992 Ga0207703_10007134
993 Ga0207641_10004402
994 Ga0207641_10218363
995 Ga0207648_10119713
996 Ga0207648_10170142
997 Ga0207676_10003508
998 Ga0207675_100010028
999 Ga0207675_100175568
1000 Ga0207683_10006519
1001 Ga0207683_10355145
1002 Ga0207698_10081845
1003 Ga0209281_1003014
1004 Ga0209281_1005961
1005 Ga0209282_1000001
1006 Ga0268266_10187480
1007 Ga0268265_10081584
1008 Ga0307515_10241205
1009 Ga0316180_1112319
1010 Ga0316181_1216539
1011 Ga0307408_100001129
1012 Ga0307408_100001185
1013 Ga0307408_100003316
1014 Ga0307416_100084493
1015 Ga0307414_10003286
1016 Ga0373952_0002402
1017 Ga0373935_0161480
1018 Ga0395899_0004735
1019 Ga0395899_0005686
1020 Ga0395899_0010310
1021 Ga0395899_0091327
1022 Ga0395900_0002091
1023 Ga0395900_0003097
1024 Ga0395900_0003147
1025 Ga0395900_0080938
1026 Ga0395898_0011645
1027 Ga0395898_0017086
1028 Ga0395898_0031587
1029 Ga0395898_0091283
1030 Ga0395905_0013949
1031 Ga0395905_0015250
1032 Ga0395905_0055941
1033 Ga0395905_0059785
1034 Ga0395905_0149117
1035 Ga0395905_0436863
1036 Ga0395901_0000212
1037 Ga0395901_0000522
1038 Ga0395901_0229464
1039 Ga0436360_1203167
1040 Ga0436361_0168778
1041 Ga0436361_0993359
1042 Ga0439448_0016603
1043 Ga0439449_0024840
1044 Ga0439450_011670
1045 Ga0439450_043299
1046 Ga0439455_0006438
1047 Ga0450897_001616
1048 Ga0466972_0023087
1049 Ga0466965_0009082
1050 Ga0466965_0016185
1051 Ga0466965_0024959
1052 Ga0466966_0000457
1053 Ga0466966_0019594
1054 Ga0466966_0065376
1055 Ga0466966_0132664
1056 Ga0466966_0145256
1057 Ga0466961_0009150
1058 Ga0466961_0027393
1059 Ga0466963_0207435
1060 Ga0466964_0000435
1061 Ga0466964_0002446
1062 Ga0466964_0014920
1063 Ga0466968_0001497
1064 Ga0466968_0043937
1065 Ga0466970_0024531
1066 Ga0466970_0095349
1067 Ga0466957_0000114
1068 Ga0466957_0012400
1069 Ga0466957_0027382
1070 Ga0466960_0067601
1071 Ga0466959_0005057
1072 Ga0466959_0025010
1073 Ga0466959_0030580
1074 Ga0451576_0017483
1075 Ga0466967_0030085
1076 Ga0495617_000042
1077 Ga0495617_000063
1078 Ga0495617_037565
1079 Ga0495627_000057
1080 Ga0495627_000323
1081 Ga0495627_003505
1082 Ga0495590_0000010
1083 Ga0495590_0000837
1084 Ga0495590_0002387
1085 Ga0495590_0062336
1086 Ga0495629_0017851
1087 Ga0495629_0035318
1088 Ga0495638_0000027
1089 Ga0495638_0020283
1090 Ga0495638_0020825
1091 Ga0495638_0024603
1092 Ga0495638_0048379
1093 Ga0495638_0056006
1094 Ga0495653_0004474
1095 Ga0495653_0035700
1096 Ga0495653_0066832
1097 Ga0495653_0112559
1098 Ga0495650_0000044
1099 Ga0495650_0000066
1100 Ga0495650_0000229
1101 Ga0495650_0001129
1102 Ga0495650_0003132
1103 Ga0495650_0017307
1104 Ga0495650_0030602
1105 Ga0495582_0020516
1106 Ga0495605_0000027
1107 Ga0495605_0000049
1108 Ga0495605_0000130
1109 Ga0495605_0009901
1110 Ga0495605_0012517
1111 Ga0495605_0030705
1112 Ga0495605_0037262
1113 Ga0495605_0050378
1114 Ga0495605_0062472
1115 Ga0495605_0091000
1116 Ga0495639_0013547
1117 Ga0495584_0000001
1118 Ga0495584_0000137
1119 Ga0495584_0000164
1120 Ga0495584_0001830
1121 Ga0495584_0007483
1122 Ga0495584_0008092
1123 Ga0495584_0010845
1124 Ga0495584_0122624
1125 Ga0495584_0138294
1126 Ga0495585_0000003
1127 Ga0495585_0000011
1128 Ga0495585_0000040
1129 Ga0495585_0000233
1130 Ga0495585_0000365
1131 Ga0495585_0000385
1132 Ga0495585_0000486
1133 Ga0495585_0002878
1134 Ga0495585_0004384
1135 Ga0495585_0046779
1136 Ga0495585_0048301
1137 Ga0495585_0106325
1138 Ga0495594_0001143
1139 Ga0495594_0024171
1140 Ga0495594_0062918
1141 Ga0495594_0076177
1142 Ga0495594_0148906
1143 Ga0495596_0000106
1144 Ga0495596_0000424
1145 Ga0495596_0001138
1146 Ga0495596_0001319
1147 Ga0495596_0006923
1148 Ga0495596_0014663
1149 Ga0495596_0018568
1150 Ga0495596_0020523
1151 Ga0495596_0075812
1152 Ga0495607_0001405
1153 Ga0495607_0001669
1154 Ga0495607_0002038
1155 Ga0495607_0005509
1156 Ga0495607_0006690
1157 Ga0495607_0006835
1158 Ga0495607_0058664
1159 Ga0495583_0000006
1160 Ga0495583_0000095
1161 Ga0495583_0000117
1162 Ga0495583_0000381
1163 Ga0495583_0000551
1164 Ga0495583_0004237
1165 Ga0495583_0008753
1166 Ga0495583_0011133
1167 Ga0495583_0015640
1168 Ga0495583_0029846
1169 Ga0495583_0046412
1170 Ga0495583_0113016
1171 Ga0495606_0000125
1172 Ga0495606_0000128
1173 Ga0495606_0000557
1174 Ga0495606_0001131
1175 Ga0495606_0001352
1176 Ga0495606_0005861
1177 Ga0495606_0007239
1178 Ga0495606_0022454
1179 Ga0495606_0042627
1180 Ga0495606_0050520
1181 Ga0495606_0164429
1182 Ga0495608_0253561
1183 Ga0495610_0000008
1184 Ga0495610_0002638
1185 Ga0495610_0005058
1186 Ga0495610_0009097
1187 Ga0495610_0009298
1188 Ga0495610_0107015
1189 Ga0495616_0000075
1190 Ga0495616_0000170
1191 Ga0495616_0000902
1192 Ga0495616_0001358
1193 Ga0495616_0003193
1194 Ga0495616_0005436
1195 Ga0495616_0008471
1196 Ga0495616_0011720
1197 Ga0495620_0098836
1198 Ga0495628_0096240
1199 Ga0495630_0093605
1200 Ga0495630_0099341
1201 Ga0495631_0000417
1202 Ga0495631_0002592
1203 Ga0495631_0005682
1204 Ga0495631_0007774
1205 Ga0495631_0013672
1206 Ga0495631_0014256
1207 Ga0495631_0017463
1208 Ga0495631_0024430
1209 Ga0495631_0059670
1210 Ga0495632_0000057
1211 Ga0495632_0000091
1212 Ga0495632_0000201
1213 Ga0495632_0000358
1214 Ga0495632_0025745
1215 Ga0495637_0000067
1216 Ga0495643_0000022
1217 Ga0495643_0000065
1218 Ga0495643_0000094
1219 Ga0495643_0000326
1220 Ga0495643_0001487
1221 Ga0495643_0007451
1222 Ga0495643_0014799
1223 Ga0495643_0041640
1224 Ga0495643_0073832
1225 Ga0495643_0132751
1226 Ga0495644_0007237
1227 Ga0495644_0036002
1228 Ga0495644_0056542
1229 Ga0495644_0088409
1230 Ga0495648_0000011
1231 Ga0495648_0000078
1232 Ga0495648_0000883
1233 Ga0495648_0000928
1234 Ga0495648_0002119
1235 Ga0495648_0012722
1236 Ga0495648_0016036
1237 Ga0495648_0021870
1238 Ga0495648_0043528
1239 Ga0495648_0057531
1240 Ga0495663_0001726
1241 Ga0495663_0043871
1242 Ga0495663_0057552
1243 Ga0495666_0000160
1244 Ga0495666_0000267
1245 Ga0495666_0008547
1246 Ga0495666_0017645
1247 Ga0495666_0064778
1248 Ga0495642_0000012
1249 Ga0495642_0000128
1250 Ga0495642_0000439
1251 Ga0495642_0000919
1252 Ga0495642_0003382
1253 Ga0495642_0006493
1254 Ga0495642_0009466
1255 Ga0495642_0012229
1256 Ga0495642_0018438
1257 Ga0495642_0023585
1258 Ga0495642_0026918
1259 Ga0495642_0030434
1260 Ga0495642_0096280
1261 Ga0495652_0058522
1262 Ga0495654_0000002
1263 Ga0495654_0010283
1264 Ga0495654_0023750
1265 Ga0495654_0028268
1266 Ga0495654_0032205
1267 Ga0495654_0072958
1268 Ga0495654_0078306
1269 Ga0495665_0003469
1270 Ga0495665_0018914
1271 Ga0495665_0039773
1272 Ga0495640_0148636
1273 Ga0495586_0016175
1274 Ga0495586_0021113
1275 Ga0495586_0108193
1276 Ga0495586_0128037
1277 Ga0495587_0014738
1278 Ga0495609_0000001
1279 Ga0495609_0001621
1280 Ga0495609_0002680
1281 Ga0495609_0004160
1282 Ga0495609_0005651
1283 Ga0495609_0007380
1284 Ga0495609_0013816
1285 Ga0495609_0019974
1286 Ga0495609_0034566
1287 Ga0495609_0039085
1288 Ga0495609_0055489
1289 Ga0495609_0072809
1290 Ga0495609_0078055
1291 Ga0495609_0101599
1292 Ga0495597_0000009
1293 Ga0495597_0000029
1294 Ga0495597_0000107
1295 Ga0495597_0000335
1296 Ga0495597_0000466
1297 Ga0495597_0003120
1298 Ga0495597_0008860
1299 Ga0495597_0011431
1300 Ga0495597_0029264
1301 Ga0495597_0067704
1302 Ga0495645_0101123
1303 Ga0495622_0000043
1304 Ga0495622_0001191
1305 Ga0495622_0011143
1306 Ga0495622_0019628
1307 Ga0495633_0000381
1308 Ga0495633_0000577
1309 Ga0495633_0001135
1310 Ga0495633_0001381
1311 Ga0495633_0003447
1312 Ga0495633_0006010
1313 Ga0495633_0006135
1314 Ga0495633_0007174
1315 Ga0495633_0012130
1316 Ga0495633_0014246
1317 Ga0495633_0016160
1318 Ga0495633_0038540
1319 Ga0495633_0041795
1320 Ga0495656_0033049
1321 Ga0495656_0062651
1322 Ga0495668_0000006
1323 Ga0495668_0000027
1324 Ga0495668_0000096
1325 Ga0495668_0000180
1326 Ga0495668_0000429
1327 Ga0495668_0001010
1328 Ga0495668_0001031
1329 Ga0495668_0001648
1330 Ga0495668_0003280
1331 Ga0495668_0006316
1332 Ga0495668_0007037
1333 Ga0495668_0016242
1334 Ga0495668_0032675
1335 Ga0495668_0035888
1336 Ga0495668_0037133
1337 Ga0495668_0042122
1338 Ga0495668_0066935
1339 Ga0495668_0084778
1340 Ga0495668_0095069
1341 Ga0495668_0121559
1342 Ga0495634_0022518
1343 Ga0495611_0000437
1344 Ga0495611_0008801
1345 Ga0495611_0012180
1346 Ga0495611_0013380
1347 Ga0495611_0014600
1348 Ga0495611_0044894
1349 Ga0495611_0060529
1350 Ga0495611_0120645
1351 Ga0495625_0000053
1352 Ga0495625_0002139
1353 Ga0495625_0008684
1354 Ga0495625_0009670
1355 Ga0495625_0009909
1356 Ga0495625_0018522
1357 Ga0495625_0025290
1358 Ga0495625_0047439
1359 Ga0495625_0050151
1360 Ga0495625_0054292
1361 Ga0495625_0088900
1362 Ga0495625_0098309
1363 Ga0495625_0206796
1364 Ga0495659_0000001
1365 Ga0495659_0017668
1366 Ga0495661_0000023
1367 Ga0495661_0000148
1368 Ga0495661_0000287
1369 Ga0495661_0003345
1370 Ga0495661_0004688
1371 Ga0495661_0025832
1372 Ga0495661_0033305
1373 Ga0495661_0049687
1374 Ga0495661_0051076
1375 Ga0495661_0057062
1376 Ga0495661_0061447
1377 Ga0495661_0102466
1378 Ga0495661_0174753
1379 Ga0495588_0000041
1380 Ga0495588_0003113
1381 Ga0495588_0020102
1382 Ga0495588_0094174
1383 Ga0495588_0136839
1384 Ga0495588_0161383
1385 Ga0495623_0010749
1386 Ga0495623_0051175
1387 Ga0495623_0070655
1388 Ga0495646_0081670
1389 Ga0495646_0108020
1390 Ga0495658_0002916
1391 Ga0495669_0000017
1392 Ga0495669_0000429
1393 Ga0495669_0000484
1394 Ga0495669_0009083
1395 Ga0495613_0016878
1396 Ga0495624_0006051
1397 Ga0495670_0000122
1398 Ga0495670_0001433
1399 Ga0495670_0001786
1400 Ga0495670_0010563
1401 Ga0495670_0019050
1402 Ga0495670_0036181
1403 Ga0495670_0036802
1404 Ga0495670_0086930
1405 Ga0495670_0117606
1406 Ga0495671_0000002
1407 Ga0495671_0000035
1408 Ga0495671_0000140
1409 Ga0495671_0002321
1410 Ga0495671_0009573
1411 Ga0495671_0016243
1412 Ga0495671_0047593
1413 Ga0495671_0048524
1414 Ga0495649_0002789
1415 Ga0495649_0028441
1416 Ga0495589_0000027
1417 Ga0495589_0000102
1418 Ga0495589_0000600
1419 Ga0495589_0003377
1420 Ga0495589_0005590
1421 Ga0495589_0016821
1422 Ga0495589_0040644
1423 Ga0495589_0114346
1424 Ga0495600_0047066
1425 Ga0495660_0000069
1426 Ga0495660_0000132
1427 Ga0495660_0001231
1428 Ga0495660_0003475
1429 Ga0495660_0018729
1430 Ga0495660_0022256
1431 Ga0495660_0025019
1432 Ga0495660_0031928
1433 Ga0495660_0036753
1434 Ga0495660_0056861
1435 Ga0495660_0080464
1436 Ga0495660_0182145
1437 Ga0495581_0004532
1438 Ga0495581_0043781
1439 Ga0495604_0019344
1440 Ga0495604_0050325
1441 Ga0495636_0003615
1442 Ga0495636_0004270
1443 Ga0495636_0011926
1444 Ga0495674_0002798
1445 Ga0495672_0000022
1446 Ga0495672_0000066
1447 Ga0495672_0000095
1448 Ga0495672_0000231
1449 Ga0495672_0003237
1450 Ga0495672_0005035
1451 Ga0495672_0022297
1452 Ga0495676_0000017
1453 Ga0495676_0033969
1454 Ga0495676_0074145
1455 Ga0495680_0006458
1456 Ga0495680_0134329
1457 Ga0495683_0000005
1458 Ga0495683_0105998
1459 Ga0495683_0130721
1460 Ga0495687_000023
1461 Ga0495687_000027
1462 Ga0495687_000034
1463 Ga0495687_000048
1464 Ga0495687_000524
1465 Ga0495687_001158
1466 Ga0495687_002491
1467 Ga0495687_035282
1468 Ga0495675_0009439
1469 Ga0495675_0026728
1470 Ga0495677_0000001
1471 Ga0495677_0000067
1472 Ga0495677_0000677
1473 Ga0495677_0005267
1474 Ga0495677_0005773
1475 Ga0495677_0005839
1476 Ga0495677_0005940
1477 Ga0495677_0011590
1478 Ga0495677_0014975
1479 Ga0495677_0039007
1480 Ga0495679_004242
1481 Ga0495679_005144
1482 Ga0495679_006136
1483 Ga0495679_006944
1484 Ga0495679_021023
1485 Ga0495685_009304
1486 Ga0495685_014627
1487 Ga0495685_051605
1488 Ga0495673_0000059
1489 Ga0495673_0000064
1490 Ga0495673_0049798
1491 Ga0495681_0000018
1492 Ga0495681_0001220
1493 Ga0495681_0003868
1494 Ga0495681_0004757
1495 Ga0495681_0008989
1496 Ga0495681_0009121
1497 Ga0495681_0009347
1498 Ga0495681_0010500
1499 Ga0495681_0020670
1500 Ga0495681_0047735
1501 Ga0495686_0000135
1502 Ga0495686_0000462
1503 Ga0495686_0000640
1504 Ga0495686_0001427
1505 Ga0495686_0009909
1506 Ga0495686_0036829
1507 Ga0495686_0147790
1508 Ga0495593_0002837
1509 Ga0495593_0039247
1510 Ga0495602_0123721
1511 Ga0495614_0060962
1512 Ga0495615_0000944
1513 Ga0495615_0028137
1514 Ga0495626_0000037
1515 Ga0495626_0000535
1516 Ga0495626_0000754
1517 Ga0495626_0003874
1518 Ga0495626_0004907
1519 Ga0495626_0007550
1520 Ga0495626_0009094
1521 Ga0495626_0010374
1522 Ga0495626_0015581
1523 Ga0495626_0017666
1524 Ga0495626_0024208
1525 Ga0495626_0031604
1526 Ga0495626_0043744
1527 Ga0495626_0046493
1528 Ga0495626_0098322
1529 Ga0496101_0123396
1530 Ga0496102_0000151
1531 Ga0496102_0000182
1532 Ga0496102_0010154
1533 Ga0496102_0105874
1534 Ga0496102_0232126
1535 Ga0496103_0005130
1536 Ga0496103_0027157
1537 Ga0496103_0043530
1538 Ga0496103_0100972
1539 Ga0496104_0016139
1540 Ga0496104_0269407
1541 Ga0496105_0046695
1542 Ga0496106_0009494
1543 Ga0496106_0173532
1544 Ga0496109_0202926
1545 Ga0496109_0434692
1546 Ga0496110_0074408
1547 Ga0496112_0315152
1548 Ga0496113_0002561
1549 Ga0496113_0006144
1550 Ga0496113_0212904
1551 Ga0496114_0065321
1552 Ga0496115_0017832
1553 Ga0496115_0021525
1554 Ga0496115_0097860
1555 Ga0496115_0123143
1556 Ga0496116_0015645
1557 Ga0496116_0074770
1558 Ga0496117_0000001
1559 Ga0496118_0000002
1560 Ga0496121_0007795
1561 Ga0496121_0011077
1562 Ga0496121_0305301
1563 Ga0496122_0000712
1564 Ga0496122_0003090
1565 Ga0496122_0013372
1566 Ga0496122_0014805
1567 Ga0496122_0075194
1568 Ga0496123_0000502
1569 Ga0496123_0005830
1570 Ga0496123_0020981
1571 Ga0496123_0065455
1572 Ga0496124_0003831
1573 Ga0496124_0012443
1574 Ga0496124_0029879
1575 Ga0496124_0065386
1576 Ga0496124_0132635
1577 Ga0496124_0180620
1578 Ga0496124_0220205
1579 Ga0496125_0017614
1580 Ga0496125_0034021
1581 Ga0496125_0213634
1582 Ga0496126_0030419
1583 Ga0495678_000100
1584 Ga0495678_000286
1585 Ga0495678_000588
1586 Ga0495678_000705
1587 Ga0495678_002236
1588 Ga0495678_003925
1589 Ga0495682_0000066
1590 Ga0495682_0001017
1591 Ga0501222_009165
1592 Ga0501227_002037
1593 Ga0501238_002661
1594 Ga0501249_001440
1595 Ga0501249_013450
1596 Ga0501241_012372
1597 Ga0501269_000423
1598 Ga0501035_0000866
1599 Ga0501044_0031874
1600 Ga0501044_0429043
1601 Ga0500594_0002295
1602 Ga0500594_0004222
1603 Ga0500618_000137
1604 Ga0500618_009677
1605 Ga0500559_0000249
1606 Ga0500586_000227
1607 Ga0500586_001150
1608 Ga0500587_001548
1609 2547373026
1610 2643792135
1611 2643799142
1612 2644212112
1613 2644251528
1614 2644357398
1615 2644473527
1616 2738739989
1617 2738828589
1618 2738844256
1619 2739152385
1620 2739194305
1621 2739274184
1622 2739320781
1623 2739339022
1624 2739343228
1625 2809142964
1626 2842717562
1627 2843693368
1628 2846035068
1629 2857550097
1630 2857558217
1631 2857564517
1632 2904427031
1633 2919480201
1634 2932418947
1635 8047679258
1636 8055229116

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24827

81

215

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cdx-assembly1.cif.gz_B crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7233 9 291
3cdx-assembly1.cif.gz_A crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7212 9 291
3cdx-assembly1.cif.gz_C crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7192 9 291
3cdx-assembly1.cif.gz_D crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7067 9 291
3cdx-assembly1.cif.gz_E crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7048 9 291
ID Description Score Start End Superfamily
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8397 226 285 2.40.50.630
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8043 226 285 2.40.50.630
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7067 9 291 3.40.630.10
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6808 9 291 3.40.630.10
af_P76215_1_322_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6784 17 291 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A1M7R4T8-F1-model_v4 Succinylglutamate desuccinylase / Aspartoacylase family protein 0.9821 74 294
AF-A0A349KYS1-F1-model_v4 Succinylglutamate desuccinylase 0.9808 4 66 GO:0016788
GO:0046872
AF-A0A1M7R4T8-F1-model_v4 Succinylglutamate desuccinylase / Aspartoacylase family protein 0.9734 74 294
AF-A0A7Y9HLT1-F1-model_v4 Putative deacylase 0.9621 67 294 GO:0016788
GO:0046872
AF-A0A349KYS0-F1-model_v4 Succinylglutamate desuccinylase 0.9606 95 294

Map