F482143

General Info

Members Datasets Scaffolds Average Seq Length
818 378 1636 335

Family's Representative Sequence

Representative Sequence 3300049513|Ga0501290_001810|Ga0501290_001810_474_1520
Length 328
Sequence MSTPAEKSIPLTVVADTPAPGMLQVAGDKIARSPVQFADAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDPSEPLSLARTIADMRLKYVVITSVDDLRDGGASHFVDCIAAIREFSPRTKIEILTPDFRGKGRMERALEILATNPPDVFNHNLETVPDLYRNVRPGADYQWSLTLLQKFKAQHPDVATKSGIMLGLGETMEQVELTLRDLRAHDVDMVTIGQYLQPSPHHHPVMRYWTPDEFKALEDYGMALGFTHVASGPMVRSSYHADKQAADAGFA

Samples

Sample ID Description Type Environment
1 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
177 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
178 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
209 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
217 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
218 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
223 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
301 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
309 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
310 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
317 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
318 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
319 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
320 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
321 2643221559 Lysobacter sp. Root559 Isolate Unclassified
322 2643221573 Lysobacter sp. Root604 Isolate Unclassified
323 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
324 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
325 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
326 2643221586 Lysobacter sp. Root667 Isolate Unclassified
327 2643221593 Lysobacter sp. Root690 Isolate Unclassified
328 2643221612 Lysobacter sp. Root76 Isolate Unclassified
329 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
330 2643221695 Lysobacter sp. Root494 Isolate Unclassified
331 2643221720 Lysobacter sp. Root916 Isolate Unclassified
332 2643221727 Lysobacter sp. Root96 Isolate Unclassified
333 2643221728 Lysobacter sp. Root983 Isolate Unclassified
334 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
335 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
336 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
337 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
338 2818991457 Xanthomonas translucens 569 Isolate Unclassified
339 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
340 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
341 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
342 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
343 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
344 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
345 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
346 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
347 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
348 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
349 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
350 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
351 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
352 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
353 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
354 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
355 2919513703 Luteimonas sp. 3794 Isolate Unclassified
356 2919675420 Luteimonas terrae 4099 Isolate Unclassified
357 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
358 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
359 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
360 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
361 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
362 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
363 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
364 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
365 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
366 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
367 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
368 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
369 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
370 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
371 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
372 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
373 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
374 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
375 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
376 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
377 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
378 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.18
Metatranscriptomes 0.12
Isolates 7.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 11.98
Nodule 0.12
Rhizoplane 1.1
Rhizosphere 74.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501290_001810 3300049513 Bacteria 2839
2 SwRhRL2b_contig_1097717 2162886007 Bacteria 5538
3 JGI24736J21556_1013961 3300001904 Bacteria 1294
4 JGI25152J39213_1000103 3300002773 Bacteria 59472
5 JGI25150J39212_1000183 3300002774 Bacteria 35389
6 JGI25151J46595_10000102 3300003187 Bacteria 114881
7 JGI25151J46595_10000271 3300003187 Bacteria 59472
8 JGI25151J46595_10003508 3300003187 Bacteria 8641
9 JGI25153J46596_10000190 3300003215 Bacteria 59472
10 Ga0055526_1000014 3300003771 Bacteria 233327
11 Ga0055526_1006479 3300003771 Bacteria 6343
12 Ga0055526_1017503 3300003771 Bacteria 2732
13 Ga0055537_1000059 3300003773 Bacteria 79628
14 Ga0055537_1001365 3300003773 Bacteria 9847
15 Ga0055524_1000019 3300003775 Bacteria 233561
16 Ga0055524_1036000 3300003775 Bacteria 1339
17 Ga0055524_1036005 3300003775 Bacteria 1339
18 Ga0055536_1000773 3300003781 Bacteria 21299
19 Ga0055536_1010813 3300003781 Bacteria 3573
20 Ga0055536_1016739 3300003781 Bacteria 2437
21 Ga0055536_1028308 3300003781 Bacteria 1529
22 Ga0055534_1000012 3300003784 Bacteria 153530
23 Ga0055534_1000112 3300003784 Bacteria 59920
24 Ga0055528_1000007 3300003790 Bacteria 233327
25 Ga0055528_1001337 3300003790 Bacteria 15339
26 Ga0055530_10001674 3300003791 Bacteria 15731
27 Ga0055530_10002094 3300003791 Bacteria 13328
28 Ga0055530_10008584 3300003791 Bacteria 4064
29 Ga0055540_1034558 3300003792 Bacteria 1137
30 Ga0055531_10013881 3300003794 Bacteria 3678
31 Ga0055531_10015740 3300003794 Bacteria 3310
32 Ga0055531_10018425 3300003794 Bacteria 2881
33 Ga0055531_10035979 3300003794 Bacteria 1538
34 Ga0055531_10041479 3300003794 Bacteria 1332
35 Ga0058692_1000053 3300003856 Bacteria 107166
36 Ga0058692_1000065 3300003856 Bacteria 89723
37 Ga0065714_10017440 3300005288 Bacteria 3114
38 Ga0065704_10070850 3300005289 Bacteria 15417
39 Ga0065704_10072499 3300005289 Bacteria 8420
40 Ga0065715_10001991 3300005293 Bacteria 6051
41 Ga0065715_10008446 3300005293 Bacteria 3910
42 Ga0070658_10007622 3300005327 Bacteria 8729
43 Ga0070658_10061938 3300005327 Bacteria 3049
44 Ga0070683_100207011 3300005329 Bacteria 1863
45 Ga0070670_100001962 3300005331 Bacteria 16837
46 Ga0070670_100147541 3300005331 Bacteria 2035
47 Ga0070670_100197263 3300005331 Bacteria 1749
48 Ga0068869_100079398 3300005334 Bacteria 2446
49 Ga0068869_100355130 3300005334 Bacteria 1196
50 Ga0070666_10000022 3300005335 Bacteria 166910
51 Ga0070666_10000442 3300005335 Bacteria 25310
52 Ga0070666_10086043 3300005335 Bacteria 2153
53 Ga0070666_10118619 3300005335 Bacteria 1834
54 Ga0070666_10260359 3300005335 Bacteria 1230
55 Ga0070682_100000806 3300005337 Bacteria 18399
56 Ga0070682_100053517 3300005337 Bacteria 2530
57 Ga0070682_100088428 3300005337 Bacteria 2022
58 Ga0068868_100006535 3300005338 Bacteria 8257
59 Ga0068868_100128293 3300005338 Bacteria 2073
60 Ga0070661_100009383 3300005344 Bacteria 6771
61 Ga0070661_100015590 3300005344 Bacteria 5364
62 Ga0070661_100124692 3300005344 Bacteria 1931
63 Ga0070668_100004046 3300005347 Bacteria 10853
64 Ga0070668_100156977 3300005347 Bacteria 1844
65 Ga0070669_100039609 3300005353 Bacteria 3425
66 Ga0070669_100180249 3300005353 Bacteria 1652
67 Ga0070675_100387590 3300005354 Bacteria 1245
68 Ga0070671_100045193 3300005355 Bacteria 3661
69 Ga0070671_100069039 3300005355 Bacteria 2947
70 Ga0070671_100082960 3300005355 Bacteria 2680
71 Ga0070674_100082237 3300005356 Bacteria 2303
72 Ga0070673_100111799 3300005364 Bacteria 2267
73 Ga0070659_100011336 3300005366 Bacteria 6591
74 Ga0070659_100018023 3300005366 Bacteria 5324
75 Ga0070659_100067261 3300005366 Bacteria 2841
76 Ga0070667_100000049 3300005367 Bacteria 158483
77 Ga0070667_100005400 3300005367 Bacteria 10674
78 Ga0070667_100022905 3300005367 Bacteria 5179
79 Ga0070667_100023232 3300005367 Bacteria 5144
80 Ga0070667_100041398 3300005367 Bacteria 3865
81 Ga0070667_100050689 3300005367 Bacteria 3499
82 Ga0070667_100081048 3300005367 Bacteria 2777
83 Ga0070667_100082066 3300005367 Bacteria 2759
84 Ga0070667_100139793 3300005367 Bacteria 2120
85 Ga0070667_100155273 3300005367 Bacteria 2012
86 Ga0070667_100447199 3300005367 Bacteria 1180
87 Ga0070705_100173054 3300005440 Bacteria 1455
88 Ga0070663_100000042 3300005455 Bacteria 57899
89 Ga0070663_100006318 3300005455 Bacteria 7114
90 Ga0070663_100105609 3300005455 Bacteria 2108
91 Ga0070663_100319566 3300005455 Bacteria 1248
92 Ga0070678_100108757 3300005456 Bacteria 2165
93 Ga0070662_100001452 3300005457 Bacteria 14621
94 Ga0070681_10009167 3300005458 Bacteria 9724
95 Ga0070681_10013412 3300005458 Bacteria 8141
96 Ga0068867_100032307 3300005459 Bacteria 3785
97 Ga0068867_100090251 3300005459 Bacteria 2324
98 Ga0068867_100140107 3300005459 Bacteria 1890
99 Ga0070685_10007386 3300005466 Bacteria 5621
100 Ga0070679_100175899 3300005530 Bacteria 2113
101 Ga0070684_100024537 3300005535 Bacteria 5060
102 Ga0070684_100048363 3300005535 Bacteria 3690
103 Ga0068853_100000720 3300005539 Bacteria 22869
104 Ga0068853_100004195 3300005539 Bacteria 11116
105 Ga0068853_100007213 3300005539 Bacteria 8902
106 Ga0068853_100011114 3300005539 Bacteria 7303
107 Ga0068853_100028892 3300005539 Bacteria 4668
108 Ga0068853_100033305 3300005539 Bacteria 4371
109 Ga0068853_100148770 3300005539 Bacteria 2106
110 Ga0068853_100294941 3300005539 Bacteria 1497
111 Ga0070672_100003657 3300005543 Bacteria 9989
112 Ga0070672_100004334 3300005543 Bacteria 9283
113 Ga0070693_100005405 3300005547 Bacteria 6129
114 Ga0070693_100012299 3300005547 Bacteria 4328
115 Ga0070665_100000028 3300005548 Bacteria 351357
116 Ga0070665_100000394 3300005548 Bacteria 64434
117 Ga0070665_100008261 3300005548 Bacteria 10529
118 Ga0070665_100010878 3300005548 Bacteria 9204
119 Ga0070665_100027661 3300005548 Bacteria 5710
120 Ga0070665_100050597 3300005548 Bacteria 4169
121 Ga0070665_100067472 3300005548 Bacteria 3587
122 Ga0070665_100159083 3300005548 Bacteria 2260
123 Ga0070665_100168154 3300005548 Bacteria 2194
124 Ga0068855_100005951 3300005563 Bacteria 14870
125 Ga0068855_100105650 3300005563 Bacteria 3237
126 Ga0068855_100268834 3300005563 Bacteria 1896
127 Ga0068855_100497865 3300005563 Bacteria 1324
128 Ga0068857_100053558 3300005577 Bacteria 3579
129 Ga0068857_100168752 3300005577 Bacteria 1988
130 Ga0068854_100080020 3300005578 Bacteria 2411
131 Ga0068854_100128325 3300005578 Bacteria 1934
132 Ga0068856_100007098 3300005614 Bacteria 10939
133 Ga0068856_100229373 3300005614 Bacteria 1872
134 Ga0068852_100005973 3300005616 Bacteria 8769
135 Ga0068852_100014146 3300005616 Bacteria 6129
136 Ga0068852_100029267 3300005616 Bacteria 4522
137 Ga0068852_100055732 3300005616 Bacteria 3413
138 Ga0068859_100000280 3300005617 Bacteria 50848
139 Ga0068859_100308584 3300005617 Bacteria 1676
140 Ga0068859_100343091 3300005617 Bacteria 1588
141 Ga0068864_100020044 3300005618 Bacteria 5592
142 Ga0068866_10129171 3300005718 Bacteria 1435
143 Ga0068861_100061050 3300005719 Bacteria 2892
144 Ga0068851_10000308 3300005834 Bacteria 22240
145 Ga0068851_10032986 3300005834 Bacteria 2578
146 Ga0068851_10087320 3300005834 Bacteria 1637
147 Ga0068863_100018882 3300005841 Bacteria 6597
148 Ga0068863_100024540 3300005841 Bacteria 5751
149 Ga0068863_100066084 3300005841 Bacteria 3421
150 Ga0068863_100077761 3300005841 Bacteria 3140
151 Ga0068858_100008594 3300005842 Bacteria 9807
152 Ga0068858_100160243 3300005842 Bacteria 2118
153 Ga0068860_100002386 3300005843 Bacteria 19708
154 Ga0068860_100107390 3300005843 Bacteria 2667
155 Ga0068860_100124956 3300005843 Bacteria 2466
156 Ga0068862_100000215 3300005844 Bacteria 64251
157 Ga0068862_100099430 3300005844 Bacteria 2543
158 Ga0081540_1008082 3300005983 Bacteria 7391
159 Ga0081539_10008186 3300005985 Bacteria 9212
160 Ga0075365_10216007 3300006038 Bacteria 1345
161 Ga0075364_10002739 3300006051 Bacteria 9901
162 Ga0075367_10028635 3300006178 Bacteria 3179
163 Ga0075369_10020023 3300006186 Bacteria 2738
164 Ga0097621_100012950 3300006237 Bacteria 6197
165 Ga0097621_100083770 3300006237 Bacteria 2657
166 Ga0097621_100164034 3300006237 Bacteria 1912
167 Ga0097621_100326759 3300006237 Bacteria 1359
168 Ga0068871_100039983 3300006358 Bacteria 3755
169 Ga0068871_100190334 3300006358 Bacteria 1767
170 Ga0068865_100001586 3300006881 Bacteria 13298
171 Ga0068865_100027085 3300006881 Bacteria 3784
172 Ga0068865_100053746 3300006881 Bacteria 2795
173 Ga0097620_100000280 3300006931 Bacteria 50848
174 Ga0097620_100308555 3300006931 Bacteria 1676
175 Ga0097620_100343093 3300006931 Bacteria 1588
176 Ga0105251_10000205 3300009011 Bacteria 59437
177 Ga0105251_10002055 3300009011 Bacteria 16280
178 Ga0105244_10021621 3300009036 Bacteria 3556
179 Ga0105244_10106462 3300009036 Bacteria 1368
180 Ga0105240_10001002 3300009093 Bacteria 50418
181 Ga0105240_10004247 3300009093 Bacteria 21906
182 Ga0105240_10152371 3300009093 Bacteria 2752
183 Ga0105240_10424643 3300009093 Bacteria 1493
184 Ga0105240_10489488 3300009093 Bacteria 1370
185 Ga0105245_10083715 3300009098 Bacteria 2920
186 Ga0105245_10165864 3300009098 Bacteria 2100
187 Ga0105243_10002435 3300009148 Bacteria 15549
188 Ga0105243_10013395 3300009148 Bacteria 6201
189 Ga0105241_10055846 3300009174 Bacteria 3026
190 Ga0105241_10122713 3300009174 Bacteria 2094
191 Ga0105242_10079196 3300009176 Bacteria 2744
192 Ga0105248_10000120 3300009177 Bacteria 89960
193 Ga0105248_10117468 3300009177 Bacteria 3000
194 Ga0105237_10010356 3300009545 Bacteria 9929
195 Ga0105237_10011173 3300009545 Bacteria 9517
196 Ga0105237_10035094 3300009545 Bacteria 5076
197 Ga0105237_10053179 3300009545 Bacteria 4062
198 Ga0105237_10118736 3300009545 Bacteria 2638
199 Ga0105237_10298437 3300009545 Bacteria 1614
200 Ga0105237_10388462 3300009545 Bacteria 1400
201 Ga0105238_10000175 3300009551 Bacteria 69973
202 Ga0105238_10006626 3300009551 Bacteria 11543
203 Ga0105238_10009039 3300009551 Bacteria 9969
204 Ga0105238_10011923 3300009551 Bacteria 8758
205 Ga0105238_10030434 3300009551 Bacteria 5495
206 Ga0105238_10030657 3300009551 Bacteria 5474
207 Ga0105238_10041838 3300009551 Bacteria 4641
208 Ga0105249_10000898 3300009553 Bacteria 26273
209 Ga0105249_10001097 3300009553 Bacteria 24066
210 Ga0105249_10173073 3300009553 Bacteria 2095
211 Ga0105249_10355553 3300009553 Bacteria 1485
212 Ga0105032_100317 3300009979 Bacteria 4937
213 Ga0105239_10005391 3300010375 Bacteria 15027
214 Ga0105239_10010309 3300010375 Bacteria 10466
215 Ga0105239_10107680 3300010375 Bacteria 3088
216 Ga0105239_10331311 3300010375 Bacteria 1717
217 Ga0105239_10472879 3300010375 Bacteria 1423
218 Ga0105246_10020817 3300011119 Bacteria 4212
219 Ga0105246_10064583 3300011119 Bacteria 2558
220 Ga0157373_10009800 3300013100 Bacteria 7067
221 Ga0157373_10012798 3300013100 Bacteria 6163
222 Ga0157373_10042694 3300013100 Bacteria 3240
223 Ga0157373_10087870 3300013100 Bacteria 2190
224 Ga0157371_10000397 3300013102 Bacteria 54547
225 Ga0157371_10010395 3300013102 Bacteria 7255
226 Ga0157371_10053932 3300013102 Bacteria 2855
227 Ga0157370_10000918 3300013104 Bacteria 37372
228 Ga0157370_10001260 3300013104 Bacteria 31632
229 Ga0157370_10044732 3300013104 Bacteria 4252
230 Ga0157370_10131797 3300013104 Bacteria 2331
231 Ga0157369_10002250 3300013105 Bacteria 23203
232 Ga0157369_10004413 3300013105 Bacteria 16604
233 Ga0157369_10169167 3300013105 Bacteria 2303
234 Ga0157369_10263395 3300013105 Bacteria 1797
235 Ga0157369_10273993 3300013105 Bacteria 1758
236 Ga0157378_10254634 3300013297 Bacteria 1682
237 Ga0163162_10018817 3300013306 Bacteria 6771
238 Ga0163162_10028377 3300013306 Bacteria 5537
239 Ga0163162_10151246 3300013306 Bacteria 2439
240 Ga0163162_10280900 3300013306 Bacteria 1797
241 Ga0157372_10000344 3300013307 Bacteria 51217
242 Ga0157372_10028390 3300013307 Bacteria 6105
243 Ga0157372_10051825 3300013307 Bacteria 4568
244 Ga0157372_10057810 3300013307 Bacteria 4336
245 Ga0157375_10004149 3300013308 Bacteria 12573
246 Ga0157375_10019950 3300013308 Bacteria 6112
247 Ga0163163_10000029 3300014325 Bacteria 174973
248 Ga0163163_10000564 3300014325 Bacteria 32582
249 Ga0163163_10286193 3300014325 Bacteria 1700
250 Ga0182008_10000076 3300014497 Bacteria 77484
251 Ga0182008_10008822 3300014497 Bacteria 5474
252 Ga0182008_10020566 3300014497 Bacteria 3397
253 Ga0182008_10126418 3300014497 Bacteria 1273
254 Ga0157379_10001942 3300014968 Bacteria 17106
255 Ga0157379_10153983 3300014968 Bacteria 2073
256 Ga0157379_10220782 3300014968 Bacteria 1717
257 Ga0157376_10005280 3300014969 Bacteria 9025
258 Ga0157376_10007306 3300014969 Bacteria 7869
259 Ga0157376_10063340 3300014969 Bacteria 3114
260 Ga0182006_1004720 3300015261 Bacteria 6662
261 Ga0182007_10000079 3300015262 Bacteria 73543
262 Ga0182005_1000166 3300015265 Bacteria 45594
263 Ga0182005_1002582 3300015265 Bacteria 6416
264 Ga0183360_10002 3300015689 Bacteria 953821
265 Ga0163161_10002679 3300017792 Bacteria 12658
266 Ga0163161_10013517 3300017792 Bacteria 5684
267 Ga0163161_10021626 3300017792 Bacteria 4521
268 Ga0206349_1121353 3300020075 Bacteria 4561
269 Ga0207427_100349 3300025231 Bacteria 29540
270 Ga0209437_100886 3300025233 Bacteria 12095
271 Ga0207425_1000148 3300025245 Bacteria 59862
272 Ga0207425_1017410 3300025245 Bacteria 1579
273 Ga0209129_1000239 3300025258 Bacteria 59863
274 Ga0209129_1001622 3300025258 Bacteria 12193
275 Ga0209233_1000715 3300025261 Bacteria 15448
276 Ga0209233_1000998 3300025261 Bacteria 12103
277 Ga0209565_1000001 3300025263 Bacteria 2950419
278 Ga0209565_1000060 3300025263 Bacteria 188543
279 Ga0209565_1004771 3300025263 Bacteria 4064
280 Ga0209673_1000001 3300025273 Bacteria 3176258
281 Ga0209673_1000047 3300025273 Bacteria 289276
282 Ga0209673_1004700 3300025273 Bacteria 7194
283 Ga0209130_1002163 3300025284 Bacteria 10367
284 Ga0209675_1000001 3300025291 Bacteria 2950293
285 Ga0209675_1000007 3300025291 Bacteria 683430
286 Ga0209676_1000018 3300025292 Bacteria 631385
287 Ga0209676_1000360 3300025292 Bacteria 86307
288 Ga0209676_1000411 3300025292 Bacteria 77084
289 Ga0209676_1001983 3300025292 Bacteria 16281
290 Ga0209676_1003671 3300025292 Bacteria 9197
291 Ga0209676_1010297 3300025292 Bacteria 3918
292 Ga0209025_1000006 3300025294 Bacteria 1153444
293 Ga0209025_1000048 3300025294 Bacteria 335574
294 Ga0209025_1002898 3300025294 Bacteria 17124
295 Ga0209025_1011601 3300025294 Bacteria 5781
296 Ga0209564_1000001 3300025295 Bacteria 3176258
297 Ga0209564_1000252 3300025295 Bacteria 114416
298 Ga0209564_1008800 3300025295 Bacteria 4919
299 Ga0209758_1000056 3300025297 Bacteria 335574
300 Ga0209758_1006577 3300025297 Bacteria 8257
301 Ga0209758_1009524 3300025297 Bacteria 6014
302 Ga0209050_1000146 3300025298 Bacteria 166930
303 Ga0209050_1000592 3300025298 Bacteria 57827
304 Ga0209050_1003938 3300025298 Bacteria 10501
305 Ga0209256_1000006 3300025299 Bacteria 1250310
306 Ga0209256_1005338 3300025299 Bacteria 7467
307 Ga0209256_1005932 3300025299 Bacteria 6743
308 Ga0209256_1010244 3300025299 Bacteria 3956
309 Ga0209256_1013376 3300025299 Bacteria 3047
310 Ga0209256_1013442 3300025299 Bacteria 3036
311 Ga0209051_1003638 3300025303 Bacteria 9986
312 Ga0209257_1000035 3300025304 Bacteria 631463
313 Ga0209257_1000078 3300025304 Bacteria 317483
314 Ga0209257_1000414 3300025304 Bacteria 82489
315 Ga0209257_1000642 3300025304 Bacteria 55895
316 Ga0209257_1001448 3300025304 Bacteria 28059
317 Ga0209257_1003369 3300025304 Bacteria 13803
318 Ga0209257_1006510 3300025304 Bacteria 7479
319 Ga0209257_1010878 3300025304 Bacteria 4500
320 Ga0209257_1013090 3300025304 Bacteria 3738
321 Ga0207656_10000283 3300025321 Bacteria 17451
322 Ga0207656_10054810 3300025321 Bacteria 1734
323 Ga0207713_1000196 3300025735 Bacteria 84000
324 Ga0207713_1002516 3300025735 Bacteria 13272
325 Ga0207680_10000001 3300025903 Bacteria 1091453
326 Ga0207680_10000529 3300025903 Bacteria 18152
327 Ga0207680_10011565 3300025903 Bacteria 4464
328 Ga0207647_10001336 3300025904 Bacteria 18958
329 Ga0207647_10001796 3300025904 Bacteria 16435
330 Ga0207705_10001049 3300025909 Bacteria 22456
331 Ga0207705_10096042 3300025909 Bacteria 2176
332 Ga0207654_10000458 3300025911 Bacteria 23295
333 Ga0207654_10031499 3300025911 Bacteria 2922
334 Ga0207654_10063425 3300025911 Bacteria 2169
335 Ga0207654_10071741 3300025911 Bacteria 2060
336 Ga0207707_10000578 3300025912 Bacteria 37213
337 Ga0207707_10045794 3300025912 Bacteria 3811
338 Ga0207707_10242082 3300025912 Bacteria 1568
339 Ga0207695_10000040 3300025913 Bacteria 452787
340 Ga0207695_10000772 3300025913 Bacteria 60706
341 Ga0207695_10006223 3300025913 Bacteria 15542
342 Ga0207695_10015003 3300025913 Bacteria 9141
343 Ga0207695_10042105 3300025913 Bacteria 4883
344 Ga0207695_10048332 3300025913 Bacteria 4494
345 Ga0207671_10007551 3300025914 Bacteria 9414
346 Ga0207671_10009290 3300025914 Bacteria 8235
347 Ga0207671_10011332 3300025914 Bacteria 7263
348 Ga0207671_10030679 3300025914 Bacteria 4008
349 Ga0207671_10043030 3300025914 Bacteria 3341
350 Ga0207671_10071007 3300025914 Bacteria 2597
351 Ga0207671_10171438 3300025914 Bacteria 1685
352 Ga0207663_10175468 3300025916 Bacteria 1526
353 Ga0207657_10002547 3300025919 Bacteria 19710
354 Ga0207657_10170713 3300025919 Bacteria 1762
355 Ga0207657_10366742 3300025919 Bacteria 1135
356 Ga0207649_10004292 3300025920 Bacteria 7757
357 Ga0207649_10012167 3300025920 Bacteria 4764
358 Ga0207652_10150244 3300025921 Bacteria 2085
359 Ga0207681_10046931 3300025923 Bacteria 2907
360 Ga0207681_10273924 3300025923 Bacteria 1326
361 Ga0207694_10000257 3300025924 Bacteria 50545
362 Ga0207694_10001852 3300025924 Bacteria 17610
363 Ga0207694_10003883 3300025924 Bacteria 11817
364 Ga0207694_10006803 3300025924 Bacteria 8679
365 Ga0207694_10024311 3300025924 Bacteria 4599
366 Ga0207694_10056309 3300025924 Bacteria 3053
367 Ga0207694_10143318 3300025924 Bacteria 1922
368 Ga0207650_10001926 3300025925 Bacteria 14613
369 Ga0207650_10104287 3300025925 Bacteria 2187
370 Ga0207650_10112978 3300025925 Bacteria 2105
371 Ga0207650_10168174 3300025925 Bacteria 1741
372 Ga0207644_10017204 3300025931 Bacteria 4877
373 Ga0207644_10166932 3300025931 Bacteria 1715
374 Ga0207690_10019109 3300025932 Bacteria 4211
375 Ga0207690_10042976 3300025932 Bacteria 2972
376 Ga0207690_10191206 3300025932 Bacteria 1548
377 Ga0207706_10000876 3300025933 Bacteria 30901
378 Ga0207706_10028883 3300025933 Bacteria 4950
379 Ga0207709_10000527 3300025935 Bacteria 33281
380 Ga0207709_10002230 3300025935 Bacteria 12353
381 Ga0207669_10014325 3300025937 Bacteria 3971
382 Ga0207704_10053643 3300025938 Bacteria 2452
383 Ga0207704_10082336 3300025938 Bacteria 2085
384 Ga0207691_10007233 3300025940 Bacteria 10709
385 Ga0207691_10007375 3300025940 Bacteria 10597
386 Ga0207691_10009099 3300025940 Bacteria 9532
387 Ga0207711_10010606 3300025941 Bacteria 7662
388 Ga0207711_10149769 3300025941 Bacteria 2105
389 Ga0207689_10017785 3300025942 Bacteria 6007
390 Ga0207689_10034224 3300025942 Bacteria 4219
391 Ga0207689_10080295 3300025942 Bacteria 2681
392 Ga0207689_10093372 3300025942 Bacteria 2472
393 Ga0207689_10130781 3300025942 Bacteria 2066
394 Ga0207689_10217979 3300025942 Bacteria 1577
395 Ga0207661_10071965 3300025944 Bacteria 2828
396 Ga0207661_10113455 3300025944 Bacteria 2296
397 Ga0207679_10026576 3300025945 Bacteria 3993
398 Ga0207667_10012090 3300025949 Bacteria 9979
399 Ga0207667_10019912 3300025949 Bacteria 7477
400 Ga0207667_10038594 3300025949 Bacteria 5098
401 Ga0207667_10049542 3300025949 Bacteria 4436
402 Ga0207667_10164835 3300025949 Bacteria 2278
403 Ga0207667_10258218 3300025949 Bacteria 1782
404 Ga0207667_10264415 3300025949 Bacteria 1759
405 Ga0207667_10287852 3300025949 Bacteria 1679
406 Ga0207651_10097067 3300025960 Bacteria 2175
407 Ga0207651_10321806 3300025960 Bacteria 1293
408 Ga0207712_10000120 3300025961 Bacteria 84214
409 Ga0207712_10000305 3300025961 Bacteria 45213
410 Ga0207712_10024220 3300025961 Bacteria 4017
411 Ga0207712_10279439 3300025961 Bacteria 1362
412 Ga0207668_10019101 3300025972 Bacteria 4326
413 Ga0207668_10056198 3300025972 Bacteria 2740
414 Ga0207668_10130946 3300025972 Bacteria 1915
415 Ga0207640_10019306 3300025981 Bacteria 4025
416 Ga0207658_10000033 3300025986 Bacteria 158540
417 Ga0207658_10004845 3300025986 Bacteria 9300
418 Ga0207658_10009244 3300025986 Bacteria 6684
419 Ga0207658_10090619 3300025986 Bacteria 2370
420 Ga0207658_10124864 3300025986 Bacteria 2058
421 Ga0207658_10253279 3300025986 Bacteria 1497
422 Ga0207658_10262455 3300025986 Bacteria 1472
423 Ga0207677_10008057 3300026023 Bacteria 5868
424 Ga0207677_10095502 3300026023 Bacteria 2173
425 Ga0207703_10028041 3300026035 Bacteria 4435
426 Ga0207703_10109403 3300026035 Bacteria 2356
427 Ga0207703_10116118 3300026035 Bacteria 2291
428 Ga0207703_10235448 3300026035 Bacteria 1643
429 Ga0207703_10326770 3300026035 Bacteria 1406
430 Ga0207639_10000236 3300026041 Bacteria 41381
431 Ga0207639_10000437 3300026041 Bacteria 28831
432 Ga0207639_10000514 3300026041 Bacteria 26656
433 Ga0207639_10003146 3300026041 Bacteria 11096
434 Ga0207639_10019356 3300026041 Bacteria 4854
435 Ga0207639_10057841 3300026041 Bacteria 2980
436 Ga0207639_10119482 3300026041 Bacteria 2163
437 Ga0207639_10140881 3300026041 Bacteria 2009
438 Ga0207639_10191740 3300026041 Bacteria 1746
439 Ga0207639_10230228 3300026041 Bacteria 1606
440 Ga0207678_10012827 3300026067 Bacteria 7357
441 Ga0207678_10171560 3300026067 Bacteria 1852
442 Ga0207678_10175178 3300026067 Bacteria 1831
443 Ga0207702_10003377 3300026078 Bacteria 14632
444 Ga0207702_10027084 3300026078 Bacteria 4759
445 Ga0207702_10027877 3300026078 Bacteria 4692
446 Ga0207641_10042543 3300026088 Bacteria 3811
447 Ga0207641_10045468 3300026088 Bacteria 3697
448 Ga0207641_10060657 3300026088 Bacteria 3224
449 Ga0207641_10165970 3300026088 Bacteria 2011
450 Ga0207641_10214292 3300026088 Bacteria 1782
451 Ga0207648_10038304 3300026089 Bacteria 4220
452 Ga0207648_10071014 3300026089 Bacteria 3035
453 Ga0207676_10005524 3300026095 Bacteria 8947
454 Ga0207674_10008389 3300026116 Bacteria 11948
455 Ga0207674_10059733 3300026116 Bacteria 3857
456 Ga0207674_10135861 3300026116 Bacteria 2421
457 Ga0207675_100070634 3300026118 Bacteria 3264
458 Ga0207698_10041061 3300026142 Bacteria 3444
459 Ga0207698_10142520 3300026142 Bacteria 2067
460 Ga0207698_10223440 3300026142 Bacteria 1704
461 Ga0209371_1000018 3300027312 Bacteria 614700
462 Ga0209371_1000025 3300027312 Bacteria 450640
463 Ga0209983_1001045 3300027665 Bacteria 6100
464 Ga0209971_1006224 3300027682 Bacteria 2826
465 Ga0209974_10004142 3300027876 Bacteria 5181
466 Ga0268266_10000007 3300028379 Bacteria 1372921
467 Ga0268266_10000017 3300028379 Bacteria 607272
468 Ga0268266_10000091 3300028379 Bacteria 195002
469 Ga0268266_10042299 3300028379 Bacteria 3891
470 Ga0268266_10080274 3300028379 Bacteria 2842
471 Ga0268266_10196408 3300028379 Bacteria 1845
472 Ga0268265_10000376 3300028380 Bacteria 48178
473 Ga0268264_10096469 3300028381 Bacteria 2561
474 Ga0268264_10153509 3300028381 Bacteria 2067
475 Ga0307517_10113675 3300028786 Bacteria 2042
476 Ga0307515_10125655 3300028794 Bacteria 2868
477 Ga0268256_1000016 3300030500 Bacteria 614700
478 Ga0268256_1000027 3300030500 Bacteria 450640
479 Ga0316177_1045917 3300030731 Bacteria 6532
480 Ga0314311_1009359 3300030733 Bacteria 5847
481 Ga0316181_1160836 3300030744 Bacteria 1305
482 Ga0316182_1299775 3300030745 Bacteria 2931
483 Ga0307513_10006814 3300031456 Bacteria 14893
484 Ga0307408_100193051 3300031548 Bacteria 1642
485 Ga0307508_10027818 3300031616 Bacteria 5116
486 Ga0316575_10014957 3300031665 Bacteria 2921
487 Ga0316575_10079546 3300031665 Bacteria 1322
488 Ga0316579_10002710 3300031691 Bacteria 6743
489 Ga0316576_10006785 3300031727 Bacteria 7154
490 Ga0316576_10060931 3300031727 Bacteria 2765
491 Ga0316576_10182135 3300031727 Bacteria 1584
492 Ga0316578_10046275 3300031728 Bacteria 2535
493 Ga0307516_10068264 3300031730 Bacteria 3424
494 Ga0307516_10101976 3300031730 Bacteria 2685
495 Ga0307516_10176328 3300031730 Bacteria 1874
496 Ga0316577_10019739 3300031733 Bacteria 3733
497 Ga0316577_10056979 3300031733 Bacteria 2182
498 Ga0316577_10064644 3300031733 Bacteria 2042
499 Ga0307413_10021709 3300031824 Bacteria 3443
500 Ga0307413_10226927 3300031824 Bacteria 1368
501 Ga0307406_10003433 3300031901 Bacteria 8623
502 Ga0307407_10141410 3300031903 Bacteria 1553
503 Ga0307412_10103765 3300031911 Bacteria 2016
504 Ga0307412_10164312 3300031911 Bacteria 1653
505 Ga0307416_100024526 3300032002 Bacteria 4405
506 Ga0307414_10000883 3300032004 Bacteria 15349
507 Ga0307414_10000928 3300032004 Bacteria 15008
508 Ga0307414_10002330 3300032004 Bacteria 9920
509 Ga0307414_10003632 3300032004 Bacteria 8265
510 Ga0307414_10035418 3300032004 Bacteria 3321
511 Ga0307414_10043563 3300032004 Bacteria 3058
512 Ga0307414_10102681 3300032004 Bacteria 2155
513 Ga0307414_10128603 3300032004 Bacteria 1962
514 Ga0307414_10146111 3300032004 Bacteria 1858
515 Ga0307414_10321320 3300032004 Bacteria 1317
516 Ga0307411_10327448 3300032005 Bacteria 1240
517 Ga0307411_10390328 3300032005 Bacteria 1147
518 Ga0307507_10191851 3300033179 Bacteria 1434
519 Ga0307507_10216035 3300033179 Bacteria 1298
520 Ga0307510_10006402 3300033180 Bacteria 14038
521 Ga0373957_0028125 3300035120 Bacteria 2047
522 Ga0316574_0008265 3300035398 Bacteria 5769
523 Ga0316574_0058217 3300035398 Bacteria 2420
524 Ga0316574_0066006 3300035398 Bacteria 2279
525 Ga0316574_0098537 3300035398 Bacteria 1869
526 Ga0373933_0179551 3300035724 Bacteria 1350
527 Ga0373937_0007519 3300036401 Bacteria 9431
528 Ga0373937_0519868 3300036401 Bacteria 1131
529 Ga0316584_0004592 3300036712 Bacteria 9152
530 Ga0316584_0189592 3300036712 Bacteria 1520
531 Ga0395900_0000163 3300037418 Bacteria 109199
532 Ga0395900_0078437 3300037418 Bacteria 3393
533 Ga0395900_0391702 3300037418 Bacteria 1355
534 Ga0395898_0137307 3300037466 Bacteria 2341
535 Ga0395905_0002925 3300037471 Bacteria 18608
536 Ga0395905_0115628 3300037471 Bacteria 2521
537 Ga0395901_0006253 3300038443 Bacteria 12068
538 Ga0237819_00598 3300038705 Bacteria 12061
539 Ga0237819_04072 3300038705 Bacteria 2466
540 Ga0237816_00007 3300039145 Bacteria 13042
541 Ga0439436_0000009 3300041404 Bacteria 108375
542 Ga0439436_0010843 3300041404 Bacteria 2776
543 Ga0439436_0032731 3300041404 Bacteria 1507
544 Ga0439447_000276 3300041407 Bacteria 18194
545 Ga0439465_0001199 3300041413 Bacteria 8345
546 Ga0439465_0002680 3300041413 Bacteria 5821
547 Ga0451793_0608164 3300041452 Bacteria 2909
548 Ga0451806_117351 3300041462 Bacteria 8065
549 Ga0451833_0665795 3300041491 Bacteria 1670
550 Ga0451837_0845588 3300041494 Bacteria 1483
551 Ga0451841_0688799 3300041498 Bacteria 1462
552 Ga0451843_0273968 3300041509 Bacteria 2245
553 Ga0451853_3774819 3300041512 Bacteria 1455
554 Ga0439445_0027556 3300042004 Bacteria 1460
555 Ga0439449_0000582 3300042007 Bacteria 13681
556 Ga0439449_0005572 3300042007 Bacteria 4820
557 Ga0439457_014730 3300042014 Bacteria 1748
558 Ga0439462_0022440 3300042015 Bacteria 1652
559 Ga0451577_0016708 3300042876 Bacteria 6787
560 Ga0466972_0001414 3300044658 Bacteria 11634
561 Ga0453684_0000531 3300044712 Bacteria 145390
562 Ga0466970_0001522 3300044765 Bacteria 11158
563 Ga0466959_0012881 3300045049 Bacteria 6053
564 Ga0451576_0000212 3300045051 Bacteria 145396
565 Ga0495638_0000526 3300046460 Bacteria 44654
566 Ga0495638_0052794 3300046460 Bacteria 2531
567 Ga0495650_0000469 3300046471 Bacteria 62135
568 Ga0495582_0009245 3300046473 Bacteria 5436
569 Ga0495607_0079949 3300046501 Bacteria 1799
570 Ga0495606_0005893 3300046507 Bacteria 11529
571 Ga0495606_0204894 3300046507 Bacteria 1122
572 Ga0495610_0002419 3300046512 Bacteria 15714
573 Ga0495631_0003548 3300046518 Bacteria 8529
574 Ga0495643_0010311 3300046522 Bacteria 5754
575 Ga0495663_0003392 3300046525 Bacteria 4604
576 Ga0495663_0007926 3300046525 Bacteria 2936
577 Ga0495663_0017245 3300046525 Bacteria 2047
578 Ga0495665_0054589 3300046531 Bacteria 2111
579 Ga0495587_0125298 3300046536 Bacteria 1470
580 Ga0495598_0004631 3300046537 Bacteria 2992
581 Ga0495621_0020577 3300046539 Bacteria 2167
582 Ga0495633_0053967 3300046558 Bacteria 1891
583 Ga0495656_0003859 3300046615 Bacteria 5098
584 Ga0495625_0007542 3300046660 Bacteria 9451
585 Ga0495625_0107781 3300046660 Bacteria 1906
586 Ga0495635_0085671 3300046663 Bacteria 2156
587 Ga0495659_0017398 3300046664 Bacteria 2382
588 Ga0495659_0042025 3300046664 Bacteria 1635
589 Ga0495658_0011054 3300046683 Bacteria 4529
590 Ga0495670_0006739 3300046691 Bacteria 5651
591 Ga0495649_0030572 3300046694 Bacteria 2974
592 Ga0495636_0004749 3300047318 Bacteria 5331
593 Ga0495636_0006456 3300047318 Bacteria 4607
594 Ga0495636_0030269 3300047318 Bacteria 2212
595 Ga0495672_0000087 3300047320 Bacteria 154275
596 Ga0495684_0078978 3300047471 Bacteria 2498
597 Ga0495686_0004214 3300047472 Bacteria 11939
598 Ga0495686_0038417 3300047472 Bacteria 3061
599 Ga0495686_0145793 3300047472 Bacteria 1393
600 Ga0495615_0003458 3300048090 Bacteria 2648
601 Ga0496101_0109743 3300048904 Bacteria 2076
602 Ga0496103_0081056 3300048906 Bacteria 2041
603 Ga0496104_0000005 3300048907 Bacteria 620360
604 Ga0496105_0000106 3300048908 Bacteria 56944
605 Ga0496105_0029746 3300048908 Bacteria 4472
606 Ga0496112_0324194 3300048915 Bacteria 1484
607 Ga0496115_0000077 3300048918 Bacteria 89885
608 Ga0496116_0078873 3300048919 Bacteria 2051
609 Ga0496117_0001430 3300048920 Bacteria 34487
610 Ga0496117_0007883 3300048920 Bacteria 10239
611 Ga0496117_0009829 3300048920 Bacteria 8812
612 Ga0496117_0018836 3300048920 Bacteria 5697
613 Ga0496117_0028737 3300048920 Bacteria 4301
614 Ga0496117_0091047 3300048920 Bacteria 1963
615 Ga0496118_0001349 3300048921 Bacteria 37069
616 Ga0496118_0001867 3300048921 Bacteria 30139
617 Ga0496118_0003009 3300048921 Bacteria 21768
618 Ga0496118_0006523 3300048921 Bacteria 12777
619 Ga0496118_0009851 3300048921 Bacteria 9560
620 Ga0496118_0030781 3300048921 Bacteria 4467
621 Ga0496118_0035939 3300048921 Bacteria 4014
622 Ga0496118_0120660 3300048921 Bacteria 1710
623 Ga0496119_0000711 3300048922 Bacteria 44692
624 Ga0496119_0001836 3300048922 Bacteria 24586
625 Ga0496120_0000273 3300048923 Bacteria 86248
626 Ga0496120_0000727 3300048923 Bacteria 48259
627 Ga0496121_0009703 3300048924 Bacteria 11019
628 Ga0496121_0177607 3300048924 Bacteria 1540
629 Ga0496122_0000417 3300048925 Bacteria 90401
630 Ga0496122_0001517 3300048925 Bacteria 37011
631 Ga0496122_0008629 3300048925 Bacteria 10938
632 Ga0496122_0009264 3300048925 Bacteria 10414
633 Ga0496123_0000137 3300048926 Bacteria 152169
634 Ga0496123_0000323 3300048926 Bacteria 91212
635 Ga0496124_0000006 3300048927 Bacteria 904259
636 Ga0496124_0001552 3300048927 Bacteria 33193
637 Ga0496124_0003391 3300048927 Bacteria 19565
638 Ga0496124_0003834 3300048927 Bacteria 18012
639 Ga0496124_0019869 3300048927 Bacteria 6231
640 Ga0496124_0030860 3300048927 Bacteria 4748
641 Ga0496124_0034545 3300048927 Bacteria 4435
642 Ga0496124_0038566 3300048927 Bacteria 4147
643 Ga0496124_0127669 3300048927 Bacteria 2024
644 Ga0496125_0014536 3300048928 Bacteria 7662
645 Ga0496125_0030941 3300048928 Bacteria 4778
646 Ga0496125_0077822 3300048928 Bacteria 2553
647 Ga0496125_0110368 3300048928 Bacteria 1994
648 Ga0496126_0000047 3300048929 Bacteria 322212
649 Ga0496126_0003861 3300048929 Bacteria 18507
650 Ga0496126_0093660 3300048929 Bacteria 2637
651 Ga0496126_0150106 3300048929 Bacteria 1998
652 Ga0496126_0269868 3300048929 Bacteria 1412
653 Ga0501031_0011342 3300049568 Bacteria 5804
654 Ga0501032_0009391 3300049569 Bacteria 7085
655 Ga0501032_0058995 3300049569 Bacteria 2575
656 Ga0501032_0115088 3300049569 Bacteria 1778
657 Ga0501033_0000648 3300049570 Bacteria 32231
658 Ga0501033_0011737 3300049570 Bacteria 6699
659 Ga0501033_0111712 3300049570 Bacteria 1988
660 Ga0501034_0000404 3300049571 Bacteria 72780
661 Ga0501034_0002782 3300049571 Bacteria 20512
662 Ga0501034_0004087 3300049571 Bacteria 16376
663 Ga0501034_0011508 3300049571 Bacteria 9169
664 Ga0501034_0030969 3300049571 Bacteria 5436
665 Ga0501034_0039821 3300049571 Bacteria 4759
666 Ga0501034_0065145 3300049571 Bacteria 3656
667 Ga0501036_0008180 3300049572 Bacteria 8573
668 Ga0501036_0031163 3300049572 Bacteria 4506
669 Ga0501036_0078118 3300049572 Bacteria 2800
670 Ga0501037_0001193 3300049573 Bacteria 19215
671 Ga0501037_0002066 3300049573 Bacteria 14559
672 Ga0501037_0010898 3300049573 Bacteria 6680
673 Ga0501038_0002825 3300049574 Bacteria 16162
674 Ga0501039_0017656 3300049575 Bacteria 5473
675 Ga0501040_0028881 3300049576 Bacteria 3740
676 Ga0501042_0088828 3300049578 Bacteria 2217
677 Ga0501043_0001302 3300049579 Bacteria 21839
678 Ga0501043_0004836 3300049579 Bacteria 10896
679 Ga0501043_0016644 3300049579 Bacteria 5762
680 Ga0501043_0033628 3300049579 Bacteria 4034
681 Ga0501043_0034199 3300049579 Bacteria 3998
682 Ga0501043_0045909 3300049579 Bacteria 3434
683 Ga0501046_0002835 3300049580 Bacteria 16129
684 Ga0501046_0048382 3300049580 Bacteria 3367
685 Ga0501046_0110201 3300049580 Bacteria 2104
686 Ga0501047_0001828 3300049581 Bacteria 20569
687 Ga0501047_0012857 3300049581 Bacteria 7931
688 Ga0501047_0015935 3300049581 Bacteria 7165
689 Ga0501047_0018902 3300049581 Bacteria 6608
690 Ga0501047_0029824 3300049581 Bacteria 5258
691 Ga0501047_0185728 3300049581 Bacteria 1944
692 Ga0501047_0400771 3300049581 Bacteria 1205
693 Ga0501048_0005076 3300049582 Bacteria 10027
694 Ga0501067_0000857 3300049583 Bacteria 16400
695 Ga0501067_0070404 3300049583 Bacteria 1937
696 Ga0501068_0041232 3300049584 Bacteria 2773
697 Ga0501069_0002885 3300049585 Bacteria 8823
698 Ga0501069_0004343 3300049585 Bacteria 7320
699 Ga0501070_0005876 3300049586 Bacteria 10464
700 Ga0501070_0013142 3300049586 Bacteria 6977
701 Ga0501070_0015006 3300049586 Bacteria 6518
702 Ga0501070_0053490 3300049586 Bacteria 3349
703 Ga0501070_0157575 3300049586 Bacteria 1872
704 Ga0501071_0071996 3300049587 Bacteria 2520
705 Ga0501072_0000573 3300049588 Bacteria 26511
706 Ga0501073_0000434 3300049589 Bacteria 28757
707 Ga0501073_0006243 3300049589 Bacteria 8891
708 Ga0501073_0021629 3300049589 Bacteria 4635
709 Ga0501073_0044889 3300049589 Bacteria 3114
710 Ga0501074_0003202 3300049590 Bacteria 11546
711 Ga0501074_0004731 3300049590 Bacteria 9756
712 Ga0501074_0050760 3300049590 Bacteria 2994
713 Ga0501074_0054530 3300049590 Bacteria 2882
714 Ga0501074_0091798 3300049590 Bacteria 2175
715 Ga0501225_0007795 3300049705 Bacteria 3091
716 Ga0501079_0004962 3300049741 Bacteria 9869
717 Ga0501079_0011079 3300049741 Bacteria 6877
718 Ga0501080_0000764 3300049742 Bacteria 26124
719 Ga0501080_0029198 3300049742 Bacteria 5133
720 Ga0501080_0040656 3300049742 Bacteria 4336
721 Ga0501080_0182486 3300049742 Bacteria 1930
722 Ga0501080_0245214 3300049742 Bacteria 1634
723 Ga0501080_0303139 3300049742 Bacteria 1448
724 Ga0501081_0063341 3300049743 Bacteria 2566
725 Ga0501083_0000246 3300049744 Bacteria 34511
726 Ga0501083_0156733 3300049744 Bacteria 1490
727 Ga0501266_001423 3300049763 Bacteria 3052
728 Ga0501275_000512 3300049772 Bacteria 4353
729 Ga0501035_0013478 3300049822 Bacteria 7546
730 Ga0501035_0062096 3300049822 Bacteria 3324
731 Ga0501035_0062673 3300049822 Bacteria 3309
732 Ga0501044_0004071 3300049823 Bacteria 16399
733 Ga0501044_0015664 3300049823 Bacteria 8165
734 Ga0501044_0017726 3300049823 Bacteria 7638
735 Ga0501044_0051173 3300049823 Bacteria 4259
736 Ga0501044_0081743 3300049823 Bacteria 3269
737 Ga0501044_0104618 3300049823 Bacteria 2844
738 Ga0501044_0133983 3300049823 Bacteria 2470
739 Ga0501044_0149448 3300049823 Bacteria 2319
740 Ga0501045_0074346 3300049824 Bacteria 2502
741 nmdc:mga00v17_2252_c1 3300050491 Bacteria 9886
742 Ga0500610_0000365 3300053079 Bacteria 13645
743 Ga0500643_000012 3300053087 Bacteria 369839
744 Ga0500651_0003309 3300053093 Bacteria 8779
745 Ga0500651_0006630 3300053093 Bacteria 6696
746 Ga0500651_0034171 3300053093 Bacteria 3206
747 Ga0500597_000088 3300053120 Bacteria 19053
748 Ga0500559_0018767 3300053136 Bacteria 2921
749 Ga0500568_0000233 3300053139 Bacteria 47567
750 Ga0500634_0000377 3300053161 Bacteria 14223
751 Ga0501084_0121189 3300054114 Bacteria 2199
752 Ga0501084_0138315 3300054114 Bacteria 2050
753 Ga0500661_008171 3300055283 Bacteria 1924
754 Ga0501082_0000107 3300060353 Bacteria 65178
755 Ga0501082_0151352 3300060353 Bacteria 2015
756 2525556568 2524614729 Bacteria 3091755
757 2547503588 2547132130 Bacteria 4660562
758 2572254306 2571042365 Bacteria 3289345
759 2578456968 2576861471 Bacteria 4648976
760 2630649797 2627854209 Bacteria 3093011
761 2643818264 2643221559 Bacteria 4424915
762 2643880456 2643221573 Bacteria 4784121
763 2643897016 2643221577 Bacteria 3710843
764 2643905851 2643221579 Bacteria 4443405
765 2643914735 2643221581 Bacteria 3893603
766 2643937933 2643221586 Bacteria 4446529
767 2643973375 2643221593 Bacteria 6296053
768 2644078842 2643221612 Bacteria 4361984
769 2644479221 2643221685 Bacteria 3673288
770 2644528196 2643221695 Bacteria 3441323
771 2644661031 2643221720 Bacteria 4694283
772 2644693619 2643221727 Bacteria 4415595
773 2644699113 2643221728 Bacteria 4797149
774 2747949942 2747842428 Bacteria 4689383
775 2748018807 2747842501 Bacteria 5293829
776 2765580538 2765235840 Bacteria 4663337
777 2816518438 2816332141 Bacteria 4436036
778 2819661327 2818991457 Bacteria 5323295
779 2842394453 2842391507 Bacteria 4486072
780 2842758985 2842757796 Bacteria 3981385
781 2842782584 2842780639 Bacteria 4337790
782 2842921935 2842918807 Bacteria 4289178
783 2852652120 2852649853 Bacteria 4036942
784 2852687198 2852684882 Bacteria 5463342
785 2857446999 2857442823 Bacteria 4562550
786 2874223201 2874220319 Bacteria 4594709
787 2894414281 2894414249 Bacteria 4405451
788 2895499871 2895498888 Bacteria 5283788
789 2895512847 2895511927 Bacteria 6802080
790 2895522856 2895522137 Bacteria 3284416
791 2895525372 2895525241 Bacteria 3388457
792 2919093236 2919089067 Bacteria 4560942
793 2919131045 2919130084 Bacteria 5301837
794 2919138751 2919134579 Bacteria 4480386
795 2919517140 2919513703 Bacteria 3844312
796 2919677595 2919675420 Bacteria 3969095
797 2923517194 2923516293 Bacteria 3716336
798 2928499867 2928496128 Bacteria 4631123
799 2929196284 2929195423 Bacteria 5325372
800 2931383362 2931380184 Bacteria 4455911
801 2937614335 2937610967 Bacteria 4618818
802 2939589839 2939589442 Bacteria 4214238
803 2939624952 2939622612 Bacteria 4698046
804 2939630925 2939626828 Bacteria 4695272
805 2941478743 2941475908 Bacteria 4145589
806 2941494605 2941489479 Bacteria 6313767
807 2953997027 2953994433 Bacteria 4303959
808 2961049965 2961047084 Bacteria 4594415
809 2961064872 2961064222 Bacteria 4749990
810 2974307616 2974307012 Bacteria 4172388
811 2977248327 2977247770 Bacteria 4160543
812 2984517180 2984514374 Bacteria 4172479
813 2987608826 2987605356 Bacteria 4187822
814 2995949630 2995948881 Bacteria 6358104
815 8002870948 8002869464 Bacteria 3588529
816 8003015464 8003014200 Bacteria 4059994
817 8021625553 8021622325 Bacteria 4844743
818 8021649750 8021648035 Bacteria 4772378
819 Ga0501290_001810
820 SwRhRL2b_contig_1097717
821 JGI24736J21556_1013961
822 JGI25152J39213_1000103
823 JGI25150J39212_1000183
824 JGI25151J46595_10000102
825 JGI25151J46595_10000271
826 JGI25151J46595_10003508
827 JGI25153J46596_10000190
828 Ga0055526_1000014
829 Ga0055526_1006479
830 Ga0055526_1017503
831 Ga0055537_1000059
832 Ga0055537_1001365
833 Ga0055524_1000019
834 Ga0055524_1036000
835 Ga0055524_1036005
836 Ga0055536_1000773
837 Ga0055536_1010813
838 Ga0055536_1016739
839 Ga0055536_1028308
840 Ga0055534_1000012
841 Ga0055534_1000112
842 Ga0055528_1000007
843 Ga0055528_1001337
844 Ga0055530_10001674
845 Ga0055530_10002094
846 Ga0055530_10008584
847 Ga0055540_1034558
848 Ga0055531_10013881
849 Ga0055531_10015740
850 Ga0055531_10018425
851 Ga0055531_10035979
852 Ga0055531_10041479
853 Ga0058692_1000053
854 Ga0058692_1000065
855 Ga0065714_10017440
856 Ga0065704_10070850
857 Ga0065704_10072499
858 Ga0065715_10001991
859 Ga0065715_10008446
860 Ga0070658_10007622
861 Ga0070658_10061938
862 Ga0070683_100207011
863 Ga0070670_100001962
864 Ga0070670_100147541
865 Ga0070670_100197263
866 Ga0068869_100079398
867 Ga0068869_100355130
868 Ga0070666_10000022
869 Ga0070666_10000442
870 Ga0070666_10086043
871 Ga0070666_10118619
872 Ga0070666_10260359
873 Ga0070682_100000806
874 Ga0070682_100053517
875 Ga0070682_100088428
876 Ga0068868_100006535
877 Ga0068868_100128293
878 Ga0070661_100009383
879 Ga0070661_100015590
880 Ga0070661_100124692
881 Ga0070668_100004046
882 Ga0070668_100156977
883 Ga0070669_100039609
884 Ga0070669_100180249
885 Ga0070675_100387590
886 Ga0070671_100045193
887 Ga0070671_100069039
888 Ga0070671_100082960
889 Ga0070674_100082237
890 Ga0070673_100111799
891 Ga0070659_100011336
892 Ga0070659_100018023
893 Ga0070659_100067261
894 Ga0070667_100000049
895 Ga0070667_100005400
896 Ga0070667_100022905
897 Ga0070667_100023232
898 Ga0070667_100041398
899 Ga0070667_100050689
900 Ga0070667_100081048
901 Ga0070667_100082066
902 Ga0070667_100139793
903 Ga0070667_100155273
904 Ga0070667_100447199
905 Ga0070705_100173054
906 Ga0070663_100000042
907 Ga0070663_100006318
908 Ga0070663_100105609
909 Ga0070663_100319566
910 Ga0070678_100108757
911 Ga0070662_100001452
912 Ga0070681_10009167
913 Ga0070681_10013412
914 Ga0068867_100032307
915 Ga0068867_100090251
916 Ga0068867_100140107
917 Ga0070685_10007386
918 Ga0070679_100175899
919 Ga0070684_100024537
920 Ga0070684_100048363
921 Ga0068853_100000720
922 Ga0068853_100004195
923 Ga0068853_100007213
924 Ga0068853_100011114
925 Ga0068853_100028892
926 Ga0068853_100033305
927 Ga0068853_100148770
928 Ga0068853_100294941
929 Ga0070672_100003657
930 Ga0070672_100004334
931 Ga0070693_100005405
932 Ga0070693_100012299
933 Ga0070665_100000028
934 Ga0070665_100000394
935 Ga0070665_100008261
936 Ga0070665_100010878
937 Ga0070665_100027661
938 Ga0070665_100050597
939 Ga0070665_100067472
940 Ga0070665_100159083
941 Ga0070665_100168154
942 Ga0068855_100005951
943 Ga0068855_100105650
944 Ga0068855_100268834
945 Ga0068855_100497865
946 Ga0068857_100053558
947 Ga0068857_100168752
948 Ga0068854_100080020
949 Ga0068854_100128325
950 Ga0068856_100007098
951 Ga0068856_100229373
952 Ga0068852_100005973
953 Ga0068852_100014146
954 Ga0068852_100029267
955 Ga0068852_100055732
956 Ga0068859_100000280
957 Ga0068859_100308584
958 Ga0068859_100343091
959 Ga0068864_100020044
960 Ga0068866_10129171
961 Ga0068861_100061050
962 Ga0068851_10000308
963 Ga0068851_10032986
964 Ga0068851_10087320
965 Ga0068863_100018882
966 Ga0068863_100024540
967 Ga0068863_100066084
968 Ga0068863_100077761
969 Ga0068858_100008594
970 Ga0068858_100160243
971 Ga0068860_100002386
972 Ga0068860_100107390
973 Ga0068860_100124956
974 Ga0068862_100000215
975 Ga0068862_100099430
976 Ga0081540_1008082
977 Ga0081539_10008186
978 Ga0075365_10216007
979 Ga0075364_10002739
980 Ga0075367_10028635
981 Ga0075369_10020023
982 Ga0097621_100012950
983 Ga0097621_100083770
984 Ga0097621_100164034
985 Ga0097621_100326759
986 Ga0068871_100039983
987 Ga0068871_100190334
988 Ga0068865_100001586
989 Ga0068865_100027085
990 Ga0068865_100053746
991 Ga0097620_100000280
992 Ga0097620_100308555
993 Ga0097620_100343093
994 Ga0105251_10000205
995 Ga0105251_10002055
996 Ga0105244_10021621
997 Ga0105244_10106462
998 Ga0105240_10001002
999 Ga0105240_10004247
1000 Ga0105240_10152371
1001 Ga0105240_10424643
1002 Ga0105240_10489488
1003 Ga0105245_10083715
1004 Ga0105245_10165864
1005 Ga0105243_10002435
1006 Ga0105243_10013395
1007 Ga0105241_10055846
1008 Ga0105241_10122713
1009 Ga0105242_10079196
1010 Ga0105248_10000120
1011 Ga0105248_10117468
1012 Ga0105237_10010356
1013 Ga0105237_10011173
1014 Ga0105237_10035094
1015 Ga0105237_10053179
1016 Ga0105237_10118736
1017 Ga0105237_10298437
1018 Ga0105237_10388462
1019 Ga0105238_10000175
1020 Ga0105238_10006626
1021 Ga0105238_10009039
1022 Ga0105238_10011923
1023 Ga0105238_10030434
1024 Ga0105238_10030657
1025 Ga0105238_10041838
1026 Ga0105249_10000898
1027 Ga0105249_10001097
1028 Ga0105249_10173073
1029 Ga0105249_10355553
1030 Ga0105032_100317
1031 Ga0105239_10005391
1032 Ga0105239_10010309
1033 Ga0105239_10107680
1034 Ga0105239_10331311
1035 Ga0105239_10472879
1036 Ga0105246_10020817
1037 Ga0105246_10064583
1038 Ga0157373_10009800
1039 Ga0157373_10012798
1040 Ga0157373_10042694
1041 Ga0157373_10087870
1042 Ga0157371_10000397
1043 Ga0157371_10010395
1044 Ga0157371_10053932
1045 Ga0157370_10000918
1046 Ga0157370_10001260
1047 Ga0157370_10044732
1048 Ga0157370_10131797
1049 Ga0157369_10002250
1050 Ga0157369_10004413
1051 Ga0157369_10169167
1052 Ga0157369_10263395
1053 Ga0157369_10273993
1054 Ga0157378_10254634
1055 Ga0163162_10018817
1056 Ga0163162_10028377
1057 Ga0163162_10151246
1058 Ga0163162_10280900
1059 Ga0157372_10000344
1060 Ga0157372_10028390
1061 Ga0157372_10051825
1062 Ga0157372_10057810
1063 Ga0157375_10004149
1064 Ga0157375_10019950
1065 Ga0163163_10000029
1066 Ga0163163_10000564
1067 Ga0163163_10286193
1068 Ga0182008_10000076
1069 Ga0182008_10008822
1070 Ga0182008_10020566
1071 Ga0182008_10126418
1072 Ga0157379_10001942
1073 Ga0157379_10153983
1074 Ga0157379_10220782
1075 Ga0157376_10005280
1076 Ga0157376_10007306
1077 Ga0157376_10063340
1078 Ga0182006_1004720
1079 Ga0182007_10000079
1080 Ga0182005_1000166
1081 Ga0182005_1002582
1082 Ga0183360_10002
1083 Ga0163161_10002679
1084 Ga0163161_10013517
1085 Ga0163161_10021626
1086 Ga0206349_1121353
1087 Ga0207427_100349
1088 Ga0209437_100886
1089 Ga0207425_1000148
1090 Ga0207425_1017410
1091 Ga0209129_1000239
1092 Ga0209129_1001622
1093 Ga0209233_1000715
1094 Ga0209233_1000998
1095 Ga0209565_1000001
1096 Ga0209565_1000060
1097 Ga0209565_1004771
1098 Ga0209673_1000001
1099 Ga0209673_1000047
1100 Ga0209673_1004700
1101 Ga0209130_1002163
1102 Ga0209675_1000001
1103 Ga0209675_1000007
1104 Ga0209676_1000018
1105 Ga0209676_1000360
1106 Ga0209676_1000411
1107 Ga0209676_1001983
1108 Ga0209676_1003671
1109 Ga0209676_1010297
1110 Ga0209025_1000006
1111 Ga0209025_1000048
1112 Ga0209025_1002898
1113 Ga0209025_1011601
1114 Ga0209564_1000001
1115 Ga0209564_1000252
1116 Ga0209564_1008800
1117 Ga0209758_1000056
1118 Ga0209758_1006577
1119 Ga0209758_1009524
1120 Ga0209050_1000146
1121 Ga0209050_1000592
1122 Ga0209050_1003938
1123 Ga0209256_1000006
1124 Ga0209256_1005338
1125 Ga0209256_1005932
1126 Ga0209256_1010244
1127 Ga0209256_1013376
1128 Ga0209256_1013442
1129 Ga0209051_1003638
1130 Ga0209257_1000035
1131 Ga0209257_1000078
1132 Ga0209257_1000414
1133 Ga0209257_1000642
1134 Ga0209257_1001448
1135 Ga0209257_1003369
1136 Ga0209257_1006510
1137 Ga0209257_1010878
1138 Ga0209257_1013090
1139 Ga0207656_10000283
1140 Ga0207656_10054810
1141 Ga0207713_1000196
1142 Ga0207713_1002516
1143 Ga0207680_10000001
1144 Ga0207680_10000529
1145 Ga0207680_10011565
1146 Ga0207647_10001336
1147 Ga0207647_10001796
1148 Ga0207705_10001049
1149 Ga0207705_10096042
1150 Ga0207654_10000458
1151 Ga0207654_10031499
1152 Ga0207654_10063425
1153 Ga0207654_10071741
1154 Ga0207707_10000578
1155 Ga0207707_10045794
1156 Ga0207707_10242082
1157 Ga0207695_10000040
1158 Ga0207695_10000772
1159 Ga0207695_10006223
1160 Ga0207695_10015003
1161 Ga0207695_10042105
1162 Ga0207695_10048332
1163 Ga0207671_10007551
1164 Ga0207671_10009290
1165 Ga0207671_10011332
1166 Ga0207671_10030679
1167 Ga0207671_10043030
1168 Ga0207671_10071007
1169 Ga0207671_10171438
1170 Ga0207663_10175468
1171 Ga0207657_10002547
1172 Ga0207657_10170713
1173 Ga0207657_10366742
1174 Ga0207649_10004292
1175 Ga0207649_10012167
1176 Ga0207652_10150244
1177 Ga0207681_10046931
1178 Ga0207681_10273924
1179 Ga0207694_10000257
1180 Ga0207694_10001852
1181 Ga0207694_10003883
1182 Ga0207694_10006803
1183 Ga0207694_10024311
1184 Ga0207694_10056309
1185 Ga0207694_10143318
1186 Ga0207650_10001926
1187 Ga0207650_10104287
1188 Ga0207650_10112978
1189 Ga0207650_10168174
1190 Ga0207644_10017204
1191 Ga0207644_10166932
1192 Ga0207690_10019109
1193 Ga0207690_10042976
1194 Ga0207690_10191206
1195 Ga0207706_10000876
1196 Ga0207706_10028883
1197 Ga0207709_10000527
1198 Ga0207709_10002230
1199 Ga0207669_10014325
1200 Ga0207704_10053643
1201 Ga0207704_10082336
1202 Ga0207691_10007233
1203 Ga0207691_10007375
1204 Ga0207691_10009099
1205 Ga0207711_10010606
1206 Ga0207711_10149769
1207 Ga0207689_10017785
1208 Ga0207689_10034224
1209 Ga0207689_10080295
1210 Ga0207689_10093372
1211 Ga0207689_10130781
1212 Ga0207689_10217979
1213 Ga0207661_10071965
1214 Ga0207661_10113455
1215 Ga0207679_10026576
1216 Ga0207667_10012090
1217 Ga0207667_10019912
1218 Ga0207667_10038594
1219 Ga0207667_10049542
1220 Ga0207667_10164835
1221 Ga0207667_10258218
1222 Ga0207667_10264415
1223 Ga0207667_10287852
1224 Ga0207651_10097067
1225 Ga0207651_10321806
1226 Ga0207712_10000120
1227 Ga0207712_10000305
1228 Ga0207712_10024220
1229 Ga0207712_10279439
1230 Ga0207668_10019101
1231 Ga0207668_10056198
1232 Ga0207668_10130946
1233 Ga0207640_10019306
1234 Ga0207658_10000033
1235 Ga0207658_10004845
1236 Ga0207658_10009244
1237 Ga0207658_10090619
1238 Ga0207658_10124864
1239 Ga0207658_10253279
1240 Ga0207658_10262455
1241 Ga0207677_10008057
1242 Ga0207677_10095502
1243 Ga0207703_10028041
1244 Ga0207703_10109403
1245 Ga0207703_10116118
1246 Ga0207703_10235448
1247 Ga0207703_10326770
1248 Ga0207639_10000236
1249 Ga0207639_10000437
1250 Ga0207639_10000514
1251 Ga0207639_10003146
1252 Ga0207639_10019356
1253 Ga0207639_10057841
1254 Ga0207639_10119482
1255 Ga0207639_10140881
1256 Ga0207639_10191740
1257 Ga0207639_10230228
1258 Ga0207678_10012827
1259 Ga0207678_10171560
1260 Ga0207678_10175178
1261 Ga0207702_10003377
1262 Ga0207702_10027084
1263 Ga0207702_10027877
1264 Ga0207641_10042543
1265 Ga0207641_10045468
1266 Ga0207641_10060657
1267 Ga0207641_10165970
1268 Ga0207641_10214292
1269 Ga0207648_10038304
1270 Ga0207648_10071014
1271 Ga0207676_10005524
1272 Ga0207674_10008389
1273 Ga0207674_10059733
1274 Ga0207674_10135861
1275 Ga0207675_100070634
1276 Ga0207698_10041061
1277 Ga0207698_10142520
1278 Ga0207698_10223440
1279 Ga0209371_1000018
1280 Ga0209371_1000025
1281 Ga0209983_1001045
1282 Ga0209971_1006224
1283 Ga0209974_10004142
1284 Ga0268266_10000007
1285 Ga0268266_10000017
1286 Ga0268266_10000091
1287 Ga0268266_10042299
1288 Ga0268266_10080274
1289 Ga0268266_10196408
1290 Ga0268265_10000376
1291 Ga0268264_10096469
1292 Ga0268264_10153509
1293 Ga0307517_10113675
1294 Ga0307515_10125655
1295 Ga0268256_1000016
1296 Ga0268256_1000027
1297 Ga0316177_1045917
1298 Ga0314311_1009359
1299 Ga0316181_1160836
1300 Ga0316182_1299775
1301 Ga0307513_10006814
1302 Ga0307408_100193051
1303 Ga0307508_10027818
1304 Ga0316575_10014957
1305 Ga0316575_10079546
1306 Ga0316579_10002710
1307 Ga0316576_10006785
1308 Ga0316576_10060931
1309 Ga0316576_10182135
1310 Ga0316578_10046275
1311 Ga0307516_10068264
1312 Ga0307516_10101976
1313 Ga0307516_10176328
1314 Ga0316577_10019739
1315 Ga0316577_10056979
1316 Ga0316577_10064644
1317 Ga0307413_10021709
1318 Ga0307413_10226927
1319 Ga0307406_10003433
1320 Ga0307407_10141410
1321 Ga0307412_10103765
1322 Ga0307412_10164312
1323 Ga0307416_100024526
1324 Ga0307414_10000883
1325 Ga0307414_10000928
1326 Ga0307414_10002330
1327 Ga0307414_10003632
1328 Ga0307414_10035418
1329 Ga0307414_10043563
1330 Ga0307414_10102681
1331 Ga0307414_10128603
1332 Ga0307414_10146111
1333 Ga0307414_10321320
1334 Ga0307411_10327448
1335 Ga0307411_10390328
1336 Ga0307507_10191851
1337 Ga0307507_10216035
1338 Ga0307510_10006402
1339 Ga0373957_0028125
1340 Ga0316574_0008265
1341 Ga0316574_0058217
1342 Ga0316574_0066006
1343 Ga0316574_0098537
1344 Ga0373933_0179551
1345 Ga0373937_0007519
1346 Ga0373937_0519868
1347 Ga0316584_0004592
1348 Ga0316584_0189592
1349 Ga0395900_0000163
1350 Ga0395900_0078437
1351 Ga0395900_0391702
1352 Ga0395898_0137307
1353 Ga0395905_0002925
1354 Ga0395905_0115628
1355 Ga0395901_0006253
1356 Ga0237819_00598
1357 Ga0237819_04072
1358 Ga0237816_00007
1359 Ga0439436_0000009
1360 Ga0439436_0010843
1361 Ga0439436_0032731
1362 Ga0439447_000276
1363 Ga0439465_0001199
1364 Ga0439465_0002680
1365 Ga0451793_0608164
1366 Ga0451806_117351
1367 Ga0451833_0665795
1368 Ga0451837_0845588
1369 Ga0451841_0688799
1370 Ga0451843_0273968
1371 Ga0451853_3774819
1372 Ga0439445_0027556
1373 Ga0439449_0000582
1374 Ga0439449_0005572
1375 Ga0439457_014730
1376 Ga0439462_0022440
1377 Ga0451577_0016708
1378 Ga0466972_0001414
1379 Ga0453684_0000531
1380 Ga0466970_0001522
1381 Ga0466959_0012881
1382 Ga0451576_0000212
1383 Ga0495638_0000526
1384 Ga0495638_0052794
1385 Ga0495650_0000469
1386 Ga0495582_0009245
1387 Ga0495607_0079949
1388 Ga0495606_0005893
1389 Ga0495606_0204894
1390 Ga0495610_0002419
1391 Ga0495631_0003548
1392 Ga0495643_0010311
1393 Ga0495663_0003392
1394 Ga0495663_0007926
1395 Ga0495663_0017245
1396 Ga0495665_0054589
1397 Ga0495587_0125298
1398 Ga0495598_0004631
1399 Ga0495621_0020577
1400 Ga0495633_0053967
1401 Ga0495656_0003859
1402 Ga0495625_0007542
1403 Ga0495625_0107781
1404 Ga0495635_0085671
1405 Ga0495659_0017398
1406 Ga0495659_0042025
1407 Ga0495658_0011054
1408 Ga0495670_0006739
1409 Ga0495649_0030572
1410 Ga0495636_0004749
1411 Ga0495636_0006456
1412 Ga0495636_0030269
1413 Ga0495672_0000087
1414 Ga0495684_0078978
1415 Ga0495686_0004214
1416 Ga0495686_0038417
1417 Ga0495686_0145793
1418 Ga0495615_0003458
1419 Ga0496101_0109743
1420 Ga0496103_0081056
1421 Ga0496104_0000005
1422 Ga0496105_0000106
1423 Ga0496105_0029746
1424 Ga0496112_0324194
1425 Ga0496115_0000077
1426 Ga0496116_0078873
1427 Ga0496117_0001430
1428 Ga0496117_0007883
1429 Ga0496117_0009829
1430 Ga0496117_0018836
1431 Ga0496117_0028737
1432 Ga0496117_0091047
1433 Ga0496118_0001349
1434 Ga0496118_0001867
1435 Ga0496118_0003009
1436 Ga0496118_0006523
1437 Ga0496118_0009851
1438 Ga0496118_0030781
1439 Ga0496118_0035939
1440 Ga0496118_0120660
1441 Ga0496119_0000711
1442 Ga0496119_0001836
1443 Ga0496120_0000273
1444 Ga0496120_0000727
1445 Ga0496121_0009703
1446 Ga0496121_0177607
1447 Ga0496122_0000417
1448 Ga0496122_0001517
1449 Ga0496122_0008629
1450 Ga0496122_0009264
1451 Ga0496123_0000137
1452 Ga0496123_0000323
1453 Ga0496124_0000006
1454 Ga0496124_0001552
1455 Ga0496124_0003391
1456 Ga0496124_0003834
1457 Ga0496124_0019869
1458 Ga0496124_0030860
1459 Ga0496124_0034545
1460 Ga0496124_0038566
1461 Ga0496124_0127669
1462 Ga0496125_0014536
1463 Ga0496125_0030941
1464 Ga0496125_0077822
1465 Ga0496125_0110368
1466 Ga0496126_0000047
1467 Ga0496126_0003861
1468 Ga0496126_0093660
1469 Ga0496126_0150106
1470 Ga0496126_0269868
1471 Ga0501031_0011342
1472 Ga0501032_0009391
1473 Ga0501032_0058995
1474 Ga0501032_0115088
1475 Ga0501033_0000648
1476 Ga0501033_0011737
1477 Ga0501033_0111712
1478 Ga0501034_0000404
1479 Ga0501034_0002782
1480 Ga0501034_0004087
1481 Ga0501034_0011508
1482 Ga0501034_0030969
1483 Ga0501034_0039821
1484 Ga0501034_0065145
1485 Ga0501036_0008180
1486 Ga0501036_0031163
1487 Ga0501036_0078118
1488 Ga0501037_0001193
1489 Ga0501037_0002066
1490 Ga0501037_0010898
1491 Ga0501038_0002825
1492 Ga0501039_0017656
1493 Ga0501040_0028881
1494 Ga0501042_0088828
1495 Ga0501043_0001302
1496 Ga0501043_0004836
1497 Ga0501043_0016644
1498 Ga0501043_0033628
1499 Ga0501043_0034199
1500 Ga0501043_0045909
1501 Ga0501046_0002835
1502 Ga0501046_0048382
1503 Ga0501046_0110201
1504 Ga0501047_0001828
1505 Ga0501047_0012857
1506 Ga0501047_0015935
1507 Ga0501047_0018902
1508 Ga0501047_0029824
1509 Ga0501047_0185728
1510 Ga0501047_0400771
1511 Ga0501048_0005076
1512 Ga0501067_0000857
1513 Ga0501067_0070404
1514 Ga0501068_0041232
1515 Ga0501069_0002885
1516 Ga0501069_0004343
1517 Ga0501070_0005876
1518 Ga0501070_0013142
1519 Ga0501070_0015006
1520 Ga0501070_0053490
1521 Ga0501070_0157575
1522 Ga0501071_0071996
1523 Ga0501072_0000573
1524 Ga0501073_0000434
1525 Ga0501073_0006243
1526 Ga0501073_0021629
1527 Ga0501073_0044889
1528 Ga0501074_0003202
1529 Ga0501074_0004731
1530 Ga0501074_0050760
1531 Ga0501074_0054530
1532 Ga0501074_0091798
1533 Ga0501225_0007795
1534 Ga0501079_0004962
1535 Ga0501079_0011079
1536 Ga0501080_0000764
1537 Ga0501080_0029198
1538 Ga0501080_0040656
1539 Ga0501080_0182486
1540 Ga0501080_0245214
1541 Ga0501080_0303139
1542 Ga0501081_0063341
1543 Ga0501083_0000246
1544 Ga0501083_0156733
1545 Ga0501266_001423
1546 Ga0501275_000512
1547 Ga0501035_0013478
1548 Ga0501035_0062096
1549 Ga0501035_0062673
1550 Ga0501044_0004071
1551 Ga0501044_0015664
1552 Ga0501044_0017726
1553 Ga0501044_0051173
1554 Ga0501044_0081743
1555 Ga0501044_0104618
1556 Ga0501044_0133983
1557 Ga0501044_0149448
1558 Ga0501045_0074346
1559 nmdc:mga00v17_2252_c1
1560 Ga0500610_0000365
1561 Ga0500643_000012
1562 Ga0500651_0003309
1563 Ga0500651_0006630
1564 Ga0500651_0034171
1565 Ga0500597_000088
1566 Ga0500559_0018767
1567 Ga0500568_0000233
1568 Ga0500634_0000377
1569 Ga0501084_0121189
1570 Ga0501084_0138315
1571 Ga0500661_008171
1572 Ga0501082_0000107
1573 Ga0501082_0151352
1574 2525556568
1575 2547503588
1576 2572254306
1577 2578456968
1578 2630649797
1579 2643818264
1580 2643880456
1581 2643897016
1582 2643905851
1583 2643914735
1584 2643937933
1585 2643973375
1586 2644078842
1587 2644479221
1588 2644528196
1589 2644661031
1590 2644693619
1591 2644699113
1592 2747949942
1593 2748018807
1594 2765580538
1595 2816518438
1596 2819661327
1597 2842394453
1598 2842758985
1599 2842782584
1600 2842921935
1601 2852652120
1602 2852687198
1603 2857446999
1604 2874223201
1605 2894414281
1606 2895499871
1607 2895512847
1608 2895522856
1609 2895525372
1610 2919093236
1611 2919131045
1612 2919138751
1613 2919517140
1614 2919677595
1615 2923517194
1616 2928499867
1617 2929196284
1618 2931383362
1619 2937614335
1620 2939589839
1621 2939624952
1622 2939630925
1623 2941478743
1624 2941494605
1625 2953997027
1626 2961049965
1627 2961064872
1628 2974307616
1629 2977248327
1630 2984517180
1631 2987608826
1632 2995949630
1633 8002870948
1634 8003015464
1635 8021625553
1636 8021649750

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

95

259

0.94

PF16881

LIAS_N

N-terminal domain of lipoyl synthase of Radical_SAM family

28

80

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9124 49 323
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9072 47 323
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9038 44 329
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9028 49 323
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.8828 47 323
ID Description Score Start End Superfamily
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9409 92 310 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9367 92 310 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.927 40 303 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9202 40 303 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9081 94 298 3.20.20.70
ID Description Score Start End GO Terms
AF-T1A2Y7-F1-model_v4 Lipoyl synthase 0.9831 162 296 GO:0016992
GO:0046872
GO:0051539
AF-A0A8A7QWW1-F1-model_v4 deleted 0.9764 189 305
AF-T1A2Y7-F1-model_v4 Lipoyl synthase 0.9759 162 296 GO:0016992
GO:0046872
GO:0051539
AF-A0A367LWG9-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) 0.9758 161 279 GO:0016992
GO:0046872
GO:0051539
AF-A0A1B1TG46-F1-model_v4 Radical SAM core domain-containing protein 0.968 222 320 GO:0016992
GO:0046872
GO:0051539

Map