F482154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 818 | 374 | 1636 | 286 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2887375801|2887376945 |
| Length | 281 |
| Sequence | RYGPPGEEVPAALDSRDVVRDLSSVCDDITPETLSPQALDRLRAIDLSALPALPAGGRFGVPVRGVSKFIGIGLNYRDHAEEAGMEIPSEPVIFMKTPTSLCGASDNIVQPPHSTKLDYEVELGVVIGTKASHVPEERALDYVAGYCVVNDVSERAFQFQSPSWDKGKGCDTFGPAGPWLVTTDEIADPQQLAMWLDVNGERRQSSDTRNMIFTVQHLVAYCSRYMTLLPGDIIATGTPAGVALGMQSADPWLKVGDRVSLSIAGLGTQSQQVVAWQHPAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 170 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 203 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 204 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 205 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 328 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 329 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 332 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 333 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 334 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 335 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 336 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 337 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 338 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 339 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 340 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 341 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 342 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 343 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 344 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 345 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 346 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 347 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 348 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 349 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 350 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 351 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 352 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 353 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 354 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 355 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 356 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 357 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 358 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 359 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 360 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 361 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 362 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 363 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 364 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 365 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 366 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 367 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 368 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 369 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 370 | 2941479691 | |||
| 371 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 372 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 373 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 374 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.25 |
| Metatranscriptomes | 0.37 |
| Isolates | 5.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.43 |
| Nodule | 0.12 |
| Rhizoplane | 2.2 |
| Rhizosphere | 72.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3045014 | 2162886007 | Bacteria | 3108 |
| 2 | JGI25158J39367_1000072 | 3300002739 | Bacteria | 23033 |
| 3 | JGI25152J39213_1000002 | 3300002773 | Bacteria | 219237 |
| 4 | JGI25152J39213_1002551 | 3300002773 | Bacteria | 6857 |
| 5 | JGI25150J39212_1000038 | 3300002774 | Bacteria | 88070 |
| 6 | JGI25150J39212_1004440 | 3300002774 | Bacteria | 3121 |
| 7 | JGI25150J39212_1014009 | 3300002774 | Bacteria | 1373 |
| 8 | JGI25159J45721_1000185 | 3300002987 | Bacteria | 28695 |
| 9 | JGI25159J45721_1000254 | 3300002987 | Bacteria | 25167 |
| 10 | JGI25153J46596_10002426 | 3300003215 | Bacteria | 10751 |
| 11 | JGI25160J50197_1010928 | 3300003354 | Bacteria | 3253 |
| 12 | JGI25161J50226_1000062 | 3300003374 | Bacteria | 99783 |
| 13 | JGI25161J50226_1001608 | 3300003374 | Bacteria | 6584 |
| 14 | Ga0007417J51691_1037902 | 3300003544 | Bacteria | 1184 |
| 15 | Ga0007416J51690_1048530 | 3300003577 | Bacteria | 2369 |
| 16 | Ga0032354_1067082 | 3300003693 | Bacteria | 1262 |
| 17 | Ga0055525_1000047 | 3300003759 | Bacteria | 261507 |
| 18 | Ga0055529_1000330 | 3300003763 | Bacteria | 53265 |
| 19 | Ga0055526_1000358 | 3300003771 | Bacteria | 37034 |
| 20 | Ga0055526_1000632 | 3300003771 | Bacteria | 27319 |
| 21 | Ga0055537_1010324 | 3300003773 | Bacteria | 1977 |
| 22 | Ga0055524_1000105 | 3300003775 | Bacteria | 104121 |
| 23 | Ga0055524_1000462 | 3300003775 | Bacteria | 32912 |
| 24 | Ga0055534_1006004 | 3300003784 | Bacteria | 3140 |
| 25 | Ga0055530_10000078 | 3300003791 | Bacteria | 83740 |
| 26 | Ga0055530_10006780 | 3300003791 | Bacteria | 4993 |
| 27 | Ga0055530_10015724 | 3300003791 | Bacteria | 2454 |
| 28 | Ga0055531_10001856 | 3300003794 | Bacteria | 14853 |
| 29 | Ga0055531_10007148 | 3300003794 | Bacteria | 6156 |
| 30 | Ga0055531_10014463 | 3300003794 | Bacteria | 3550 |
| 31 | Ga0055543_1000121 | 3300004625 | Bacteria | 66082 |
| 32 | Ga0055543_1018635 | 3300004625 | Bacteria | 1293 |
| 33 | Ga0065165_1000261 | 3300005262 | Bacteria | 90816 |
| 34 | Ga0065165_1018238 | 3300005262 | Bacteria | 2550 |
| 35 | Ga0065165_1022086 | 3300005262 | Bacteria | 2191 |
| 36 | Ga0065704_10075819 | 3300005289 | Bacteria | 5401 |
| 37 | Ga0065707_10087177 | 3300005295 | Bacteria | 5129 |
| 38 | Ga0070658_10090392 | 3300005327 | Bacteria | 2522 |
| 39 | Ga0070658_10147892 | 3300005327 | Bacteria | 1965 |
| 40 | Ga0070676_10128148 | 3300005328 | Bacteria | 1602 |
| 41 | Ga0070690_100040624 | 3300005330 | Bacteria | 2942 |
| 42 | Ga0070670_100394202 | 3300005331 | Bacteria | 1221 |
| 43 | Ga0070677_10061668 | 3300005333 | Bacteria | 1548 |
| 44 | Ga0068869_100014797 | 3300005334 | Bacteria | 5219 |
| 45 | Ga0070666_10001793 | 3300005335 | Bacteria | 13078 |
| 46 | Ga0070666_10117478 | 3300005335 | Bacteria | 1842 |
| 47 | Ga0068868_100000185 | 3300005338 | Bacteria | 41542 |
| 48 | Ga0068868_100039078 | 3300005338 | Bacteria | 3685 |
| 49 | Ga0070660_100005946 | 3300005339 | Bacteria | 8437 |
| 50 | Ga0070660_100057569 | 3300005339 | Bacteria | 3011 |
| 51 | Ga0070689_100010833 | 3300005340 | Bacteria | 6516 |
| 52 | Ga0070661_100062889 | 3300005344 | Bacteria | 2725 |
| 53 | Ga0070661_100116935 | 3300005344 | Bacteria | 1995 |
| 54 | Ga0070668_100088387 | 3300005347 | Bacteria | 2439 |
| 55 | Ga0070675_100001427 | 3300005354 | Bacteria | 17552 |
| 56 | Ga0070671_100015468 | 3300005355 | Bacteria | 6165 |
| 57 | Ga0070671_100032748 | 3300005355 | Bacteria | 4295 |
| 58 | Ga0070671_100065906 | 3300005355 | Bacteria | 3017 |
| 59 | Ga0070674_100013873 | 3300005356 | Bacteria | 4993 |
| 60 | Ga0070673_100002536 | 3300005364 | Bacteria | 11150 |
| 61 | Ga0070659_100460885 | 3300005366 | Bacteria | 1079 |
| 62 | Ga0070667_100004052 | 3300005367 | Bacteria | 12388 |
| 63 | Ga0070667_100020821 | 3300005367 | Bacteria | 5447 |
| 64 | Ga0070667_100102348 | 3300005367 | Bacteria | 2475 |
| 65 | Ga0070713_100017602 | 3300005436 | Bacteria | 5409 |
| 66 | Ga0070713_100127463 | 3300005436 | Bacteria | 2241 |
| 67 | Ga0070713_100428249 | 3300005436 | Bacteria | 1240 |
| 68 | Ga0070663_100003487 | 3300005455 | Bacteria | 9072 |
| 69 | Ga0070678_100007438 | 3300005456 | Bacteria | 6499 |
| 70 | Ga0070678_100031159 | 3300005456 | Bacteria | 3675 |
| 71 | Ga0070662_100023588 | 3300005457 | Bacteria | 4228 |
| 72 | Ga0070662_100073159 | 3300005457 | Bacteria | 2532 |
| 73 | Ga0068867_100000091 | 3300005459 | Bacteria | 57689 |
| 74 | Ga0068867_100000575 | 3300005459 | Bacteria | 24349 |
| 75 | Ga0068867_100030151 | 3300005459 | Bacteria | 3912 |
| 76 | Ga0070706_100053808 | 3300005467 | Bacteria | 3715 |
| 77 | Ga0070707_100037519 | 3300005468 | Bacteria | 4626 |
| 78 | Ga0070707_100053914 | 3300005468 | Bacteria | 3855 |
| 79 | Ga0068853_100450510 | 3300005539 | Bacteria | 1210 |
| 80 | Ga0070665_100067489 | 3300005548 | Bacteria | 3586 |
| 81 | Ga0068855_100007936 | 3300005563 | Bacteria | 12827 |
| 82 | Ga0068855_100028111 | 3300005563 | Bacteria | 6726 |
| 83 | Ga0068855_100243636 | 3300005563 | Bacteria | 2008 |
| 84 | Ga0068855_100732488 | 3300005563 | Bacteria | 1056 |
| 85 | Ga0070664_100044628 | 3300005564 | Bacteria | 3742 |
| 86 | Ga0070664_100045657 | 3300005564 | Bacteria | 3700 |
| 87 | Ga0068857_100072314 | 3300005577 | Bacteria | 3073 |
| 88 | Ga0068854_100038548 | 3300005578 | Bacteria | 3362 |
| 89 | Ga0068852_100002707 | 3300005616 | Bacteria | 12247 |
| 90 | Ga0068852_100039543 | 3300005616 | Bacteria | 3972 |
| 91 | Ga0068852_100527833 | 3300005616 | Bacteria | 1178 |
| 92 | Ga0068859_100001283 | 3300005617 | Bacteria | 25657 |
| 93 | Ga0068859_100003193 | 3300005617 | Bacteria | 16684 |
| 94 | Ga0068859_100470370 | 3300005617 | Bacteria | 1353 |
| 95 | Ga0068864_100001050 | 3300005618 | Bacteria | 23192 |
| 96 | Ga0068864_100012823 | 3300005618 | Bacteria | 6931 |
| 97 | Ga0068864_100079789 | 3300005618 | Bacteria | 2866 |
| 98 | Ga0068866_10009221 | 3300005718 | Bacteria | 4184 |
| 99 | Ga0068863_100004913 | 3300005841 | Bacteria | 13173 |
| 100 | Ga0068863_100052600 | 3300005841 | Bacteria | 3859 |
| 101 | Ga0068858_100000885 | 3300005842 | Bacteria | 31082 |
| 102 | Ga0068858_100039812 | 3300005842 | Bacteria | 4357 |
| 103 | Ga0081455_10191201 | 3300005937 | Bacteria | 1541 |
| 104 | Ga0075368_10034434 | 3300006042 | Bacteria | 1974 |
| 105 | Ga0075363_100065833 | 3300006048 | Bacteria | 1960 |
| 106 | Ga0075362_10039556 | 3300006177 | Bacteria | 2074 |
| 107 | Ga0075367_10007260 | 3300006178 | Bacteria | 5664 |
| 108 | Ga0075367_10035029 | 3300006178 | Bacteria | 2903 |
| 109 | Ga0075367_10044514 | 3300006178 | Bacteria | 2602 |
| 110 | Ga0075369_10014572 | 3300006186 | Bacteria | 3144 |
| 111 | Ga0075366_10001538 | 3300006195 | Bacteria | 11541 |
| 112 | Ga0075366_10028470 | 3300006195 | Bacteria | 3279 |
| 113 | Ga0075366_10038701 | 3300006195 | Bacteria | 2817 |
| 114 | Ga0075366_10166616 | 3300006195 | Bacteria | 1336 |
| 115 | Ga0075366_10174630 | 3300006195 | Bacteria | 1304 |
| 116 | Ga0075366_10208723 | 3300006195 | Bacteria | 1188 |
| 117 | Ga0097621_100032688 | 3300006237 | Bacteria | 4137 |
| 118 | Ga0075370_10001906 | 3300006353 | Bacteria | 9384 |
| 119 | Ga0075370_10026207 | 3300006353 | Bacteria | 3228 |
| 120 | Ga0075370_10097513 | 3300006353 | Bacteria | 1700 |
| 121 | Ga0075370_10147990 | 3300006353 | Bacteria | 1375 |
| 122 | Ga0075430_100349794 | 3300006846 | Bacteria | 1221 |
| 123 | Ga0068865_100027990 | 3300006881 | Bacteria | 3729 |
| 124 | Ga0097620_100001283 | 3300006931 | Bacteria | 25657 |
| 125 | Ga0097620_100003193 | 3300006931 | Bacteria | 16684 |
| 126 | Ga0097620_100470364 | 3300006931 | Bacteria | 1353 |
| 127 | Ga0097620_100521135 | 3300006931 | Bacteria | 1284 |
| 128 | Ga0099794_10102458 | 3300007265 | Bacteria | 1430 |
| 129 | Ga0099795_10000365 | 3300007788 | Bacteria | 8128 |
| 130 | Ga0105240_10033580 | 3300009093 | Bacteria | 6625 |
| 131 | Ga0105240_10285404 | 3300009093 | Bacteria | 1895 |
| 132 | Ga0105240_10347248 | 3300009093 | Bacteria | 1684 |
| 133 | Ga0111539_10534465 | 3300009094 | Bacteria | 1366 |
| 134 | Ga0105243_10002148 | 3300009148 | Bacteria | 16656 |
| 135 | Ga0105243_10004977 | 3300009148 | Bacteria | 10415 |
| 136 | Ga0105243_10300929 | 3300009148 | Bacteria | 1453 |
| 137 | Ga0105241_10041921 | 3300009174 | Bacteria | 3460 |
| 138 | Ga0105248_10015738 | 3300009177 | Bacteria | 8337 |
| 139 | Ga0105248_10029339 | 3300009177 | Bacteria | 6137 |
| 140 | Ga0105248_10133406 | 3300009177 | Bacteria | 2802 |
| 141 | Ga0105237_10006766 | 3300009545 | Bacteria | 12649 |
| 142 | Ga0105237_10007760 | 3300009545 | Bacteria | 11705 |
| 143 | Ga0105237_10008094 | 3300009545 | Bacteria | 11423 |
| 144 | Ga0105237_10023051 | 3300009545 | Bacteria | 6383 |
| 145 | Ga0105237_10038836 | 3300009545 | Bacteria | 4808 |
| 146 | Ga0105237_10119406 | 3300009545 | Bacteria | 2630 |
| 147 | Ga0105237_10515995 | 3300009545 | Bacteria | 1202 |
| 148 | Ga0105238_10010968 | 3300009551 | Bacteria | 9113 |
| 149 | Ga0105238_10537803 | 3300009551 | Bacteria | 1172 |
| 150 | Ga0105249_10003126 | 3300009553 | Bacteria | 14312 |
| 151 | Ga0099796_10004703 | 3300010159 | Bacteria | 3332 |
| 152 | Ga0105239_10000663 | 3300010375 | Bacteria | 49003 |
| 153 | Ga0105239_10004145 | 3300010375 | Bacteria | 17402 |
| 154 | Ga0105239_10021983 | 3300010375 | Bacteria | 7031 |
| 155 | Ga0105239_10150048 | 3300010375 | Bacteria | 2601 |
| 156 | Ga0157370_10008953 | 3300013104 | Bacteria | 10750 |
| 157 | Ga0157370_10099698 | 3300013104 | Bacteria | 2722 |
| 158 | Ga0157374_10021504 | 3300013296 | Bacteria | 5742 |
| 159 | Ga0163162_10009476 | 3300013306 | Bacteria | 9467 |
| 160 | Ga0163162_10044850 | 3300013306 | Bacteria | 4429 |
| 161 | Ga0163162_10141381 | 3300013306 | Bacteria | 2521 |
| 162 | Ga0157372_10139423 | 3300013307 | Bacteria | 2793 |
| 163 | Ga0157375_10053711 | 3300013308 | Bacteria | 3965 |
| 164 | Ga0182008_10000190 | 3300014497 | Bacteria | 48677 |
| 165 | Ga0182008_10000949 | 3300014497 | Bacteria | 20195 |
| 166 | Ga0157377_10000036 | 3300014745 | Bacteria | 116358 |
| 167 | Ga0157377_10000107 | 3300014745 | Bacteria | 57351 |
| 168 | Ga0157379_10002653 | 3300014968 | Bacteria | 15057 |
| 169 | Ga0157379_10045551 | 3300014968 | Bacteria | 3914 |
| 170 | Ga0157379_10214056 | 3300014968 | Bacteria | 1745 |
| 171 | Ga0157376_10652482 | 3300014969 | Bacteria | 1053 |
| 172 | Ga0157376_10731186 | 3300014969 | Bacteria | 997 |
| 173 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 174 | Ga0182007_10000018 | 3300015262 | Bacteria | 198916 |
| 175 | Ga0182007_10001150 | 3300015262 | Bacteria | 14339 |
| 176 | Ga0182005_1000011 | 3300015265 | Bacteria | 420605 |
| 177 | Ga0209436_100005 | 3300025208 | Bacteria | 151087 |
| 178 | Ga0209436_100153 | 3300025208 | Bacteria | 33091 |
| 179 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 180 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 181 | Ga0207425_1000033 | 3300025245 | Bacteria | 245540 |
| 182 | Ga0207425_1000430 | 3300025245 | Bacteria | 27743 |
| 183 | Ga0207425_1000883 | 3300025245 | Bacteria | 14568 |
| 184 | Ga0209646_1000106 | 3300025246 | Bacteria | 163422 |
| 185 | Ga0209677_101295 | 3300025253 | Bacteria | 11132 |
| 186 | Ga0209148_1000871 | 3300025254 | Bacteria | 21034 |
| 187 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 188 | Ga0209129_1000841 | 3300025258 | Bacteria | 19262 |
| 189 | Ga0209129_1010442 | 3300025258 | Bacteria | 2315 |
| 190 | Ga0209565_1001351 | 3300025263 | Bacteria | 11117 |
| 191 | Ga0209565_1006156 | 3300025263 | Bacteria | 3398 |
| 192 | Ga0209565_1006380 | 3300025263 | Bacteria | 3314 |
| 193 | Ga0209565_1013441 | 3300025263 | Bacteria | 1916 |
| 194 | Ga0209565_1020588 | 3300025263 | Bacteria | 1390 |
| 195 | Ga0207666_1004244 | 3300025271 | Bacteria | 1790 |
| 196 | Ga0209455_1000033 | 3300025272 | Bacteria | 504606 |
| 197 | Ga0209130_1000055 | 3300025284 | Bacteria | 211696 |
| 198 | Ga0209130_1000592 | 3300025284 | Bacteria | 35299 |
| 199 | Ga0209675_1005505 | 3300025291 | Bacteria | 5286 |
| 200 | Ga0209676_1000136 | 3300025292 | Bacteria | 181860 |
| 201 | Ga0209676_1004568 | 3300025292 | Bacteria | 7660 |
| 202 | Ga0209025_1016139 | 3300025294 | Bacteria | 4439 |
| 203 | Ga0209564_1000124 | 3300025295 | Bacteria | 202046 |
| 204 | Ga0209564_1000162 | 3300025295 | Bacteria | 162265 |
| 205 | Ga0209564_1006907 | 3300025295 | Bacteria | 5976 |
| 206 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 207 | Ga0209758_1000152 | 3300025297 | Bacteria | 162418 |
| 208 | Ga0209758_1003711 | 3300025297 | Bacteria | 13539 |
| 209 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 210 | Ga0209050_1000238 | 3300025298 | Bacteria | 119729 |
| 211 | Ga0209050_1000313 | 3300025298 | Bacteria | 98580 |
| 212 | Ga0209256_1000028 | 3300025299 | Bacteria | 420213 |
| 213 | Ga0209256_1001270 | 3300025299 | Bacteria | 27521 |
| 214 | Ga0209256_1011459 | 3300025299 | Bacteria | 3541 |
| 215 | Ga0209256_1026092 | 3300025299 | Bacteria | 1690 |
| 216 | Ga0207426_1000818 | 3300025302 | Bacteria | 33399 |
| 217 | Ga0209051_1002074 | 3300025303 | Bacteria | 15151 |
| 218 | Ga0209051_1068898 | 3300025303 | Bacteria | 1074 |
| 219 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 220 | Ga0209257_1000142 | 3300025304 | Bacteria | 200756 |
| 221 | Ga0209257_1000710 | 3300025304 | Bacteria | 51515 |
| 222 | Ga0209257_1003802 | 3300025304 | Bacteria | 12422 |
| 223 | Ga0209257_1016214 | 3300025304 | Bacteria | 3032 |
| 224 | Ga0207655_1017922 | 3300025728 | Bacteria | 3791 |
| 225 | Ga0207642_10002078 | 3300025899 | Bacteria | 6189 |
| 226 | Ga0207680_10000931 | 3300025903 | Bacteria | 13816 |
| 227 | Ga0207645_10134585 | 3300025907 | Bacteria | 1609 |
| 228 | Ga0207645_10217032 | 3300025907 | Bacteria | 1260 |
| 229 | Ga0207705_10000481 | 3300025909 | Bacteria | 34247 |
| 230 | Ga0207705_10008110 | 3300025909 | Bacteria | 7695 |
| 231 | Ga0207705_10105830 | 3300025909 | Bacteria | 2074 |
| 232 | Ga0207705_10267695 | 3300025909 | Bacteria | 1306 |
| 233 | Ga0207684_10011762 | 3300025910 | Bacteria | 7633 |
| 234 | Ga0207684_10045998 | 3300025910 | Bacteria | 3703 |
| 235 | Ga0207654_10032395 | 3300025911 | Bacteria | 2888 |
| 236 | Ga0207695_10006045 | 3300025913 | Bacteria | 15798 |
| 237 | Ga0207695_10015843 | 3300025913 | Bacteria | 8855 |
| 238 | Ga0207695_10022800 | 3300025913 | Bacteria | 7093 |
| 239 | Ga0207695_10153996 | 3300025913 | Bacteria | 2235 |
| 240 | Ga0207695_10305994 | 3300025913 | Bacteria | 1480 |
| 241 | Ga0207671_10006346 | 3300025914 | Bacteria | 10548 |
| 242 | Ga0207671_10007479 | 3300025914 | Bacteria | 9474 |
| 243 | Ga0207671_10016293 | 3300025914 | Bacteria | 5781 |
| 244 | Ga0207671_10037912 | 3300025914 | Bacteria | 3573 |
| 245 | Ga0207657_10001383 | 3300025919 | Bacteria | 25890 |
| 246 | Ga0207657_10003004 | 3300025919 | Bacteria | 18072 |
| 247 | Ga0207657_10051608 | 3300025919 | Bacteria | 3575 |
| 248 | Ga0207649_10017322 | 3300025920 | Bacteria | 4083 |
| 249 | Ga0207649_10281189 | 3300025920 | Bacteria | 1210 |
| 250 | Ga0207652_10012965 | 3300025921 | Bacteria | 6745 |
| 251 | Ga0207652_10026937 | 3300025921 | Bacteria | 4790 |
| 252 | Ga0207681_10004760 | 3300025923 | Bacteria | 8353 |
| 253 | Ga0207681_10124342 | 3300025923 | Bacteria | 1897 |
| 254 | Ga0207694_10005550 | 3300025924 | Bacteria | 9668 |
| 255 | Ga0207694_10306244 | 3300025924 | Bacteria | 1309 |
| 256 | Ga0207659_10007353 | 3300025926 | Bacteria | 6770 |
| 257 | Ga0207687_10136900 | 3300025927 | Bacteria | 1853 |
| 258 | Ga0207700_10063851 | 3300025928 | Bacteria | 2802 |
| 259 | Ga0207700_10238989 | 3300025928 | Bacteria | 1547 |
| 260 | Ga0207644_10000635 | 3300025931 | Bacteria | 22259 |
| 261 | Ga0207644_10073826 | 3300025931 | Bacteria | 2502 |
| 262 | Ga0207644_10213875 | 3300025931 | Bacteria | 1525 |
| 263 | Ga0207690_10115771 | 3300025932 | Bacteria | 1938 |
| 264 | Ga0207690_10150778 | 3300025932 | Bacteria | 1723 |
| 265 | Ga0207706_10002765 | 3300025933 | Bacteria | 17065 |
| 266 | Ga0207706_10091551 | 3300025933 | Bacteria | 2673 |
| 267 | Ga0207706_10194269 | 3300025933 | Bacteria | 1781 |
| 268 | Ga0207706_10272887 | 3300025933 | Bacteria | 1476 |
| 269 | Ga0207709_10002921 | 3300025935 | Bacteria | 10435 |
| 270 | Ga0207709_10014308 | 3300025935 | Bacteria | 4380 |
| 271 | Ga0207709_10076157 | 3300025935 | Bacteria | 2147 |
| 272 | Ga0207709_10111399 | 3300025935 | Bacteria | 1831 |
| 273 | Ga0207709_10399284 | 3300025935 | Bacteria | 1051 |
| 274 | Ga0207669_10489982 | 3300025937 | Bacteria | 981 |
| 275 | Ga0207704_10015573 | 3300025938 | Bacteria | 3880 |
| 276 | Ga0207704_10537849 | 3300025938 | Bacteria | 947 |
| 277 | Ga0207711_10007617 | 3300025941 | Bacteria | 9056 |
| 278 | Ga0207689_10050185 | 3300025942 | Bacteria | 3441 |
| 279 | Ga0207689_10083483 | 3300025942 | Bacteria | 2626 |
| 280 | Ga0207661_10529876 | 3300025944 | Bacteria | 1078 |
| 281 | Ga0207679_10021508 | 3300025945 | Bacteria | 4375 |
| 282 | Ga0207667_10001977 | 3300025949 | Bacteria | 25684 |
| 283 | Ga0207667_10003039 | 3300025949 | Bacteria | 20823 |
| 284 | Ga0207667_10006345 | 3300025949 | Bacteria | 14335 |
| 285 | Ga0207667_10306085 | 3300025949 | Bacteria | 1623 |
| 286 | Ga0207712_10001798 | 3300025961 | Bacteria | 14217 |
| 287 | Ga0207712_10002005 | 3300025961 | Bacteria | 13376 |
| 288 | Ga0207668_10430596 | 3300025972 | Bacteria | 1122 |
| 289 | Ga0207640_10069116 | 3300025981 | Bacteria | 2370 |
| 290 | Ga0207658_10005671 | 3300025986 | Bacteria | 8539 |
| 291 | Ga0207677_10002592 | 3300026023 | Bacteria | 9508 |
| 292 | Ga0207677_10053176 | 3300026023 | Bacteria | 2755 |
| 293 | Ga0207703_10001221 | 3300026035 | Bacteria | 24024 |
| 294 | Ga0207703_10312239 | 3300026035 | Bacteria | 1437 |
| 295 | Ga0207678_10008575 | 3300026067 | Bacteria | 9006 |
| 296 | Ga0207641_10025598 | 3300026088 | Bacteria | 4864 |
| 297 | Ga0207641_10027564 | 3300026088 | Bacteria | 4692 |
| 298 | Ga0207641_10052325 | 3300026088 | Bacteria | 3458 |
| 299 | Ga0207648_10000037 | 3300026089 | Bacteria | 120856 |
| 300 | Ga0207648_10000227 | 3300026089 | Bacteria | 60175 |
| 301 | Ga0207676_10001143 | 3300026095 | Bacteria | 19992 |
| 302 | Ga0207676_10038637 | 3300026095 | Bacteria | 3645 |
| 303 | Ga0207676_10746276 | 3300026095 | Bacteria | 951 |
| 304 | Ga0207674_10018123 | 3300026116 | Bacteria | 7660 |
| 305 | Ga0207674_10139145 | 3300026116 | Bacteria | 2388 |
| 306 | Ga0207674_10144764 | 3300026116 | Bacteria | 2335 |
| 307 | Ga0207674_10193829 | 3300026116 | Bacteria | 1982 |
| 308 | Ga0207674_10325891 | 3300026116 | Bacteria | 1485 |
| 309 | Ga0207675_100008494 | 3300026118 | Bacteria | 9669 |
| 310 | Ga0207683_10006411 | 3300026121 | Bacteria | 10076 |
| 311 | Ga0207683_10017139 | 3300026121 | Bacteria | 6167 |
| 312 | Ga0207698_10002142 | 3300026142 | Bacteria | 11658 |
| 313 | Ga0209179_1004020 | 3300027512 | Bacteria | 2183 |
| 314 | Ga0209813_10022180 | 3300027866 | Bacteria | 1793 |
| 315 | Ga0209974_10003999 | 3300027876 | Bacteria | 5273 |
| 316 | Ga0209974_10051954 | 3300027876 | Bacteria | 1379 |
| 317 | Ga0268266_10014233 | 3300028379 | Bacteria | 6842 |
| 318 | Ga0268266_10195998 | 3300028379 | Bacteria | 1846 |
| 319 | Ga0268266_10347295 | 3300028379 | Bacteria | 1394 |
| 320 | Ga0268265_10051838 | 3300028380 | Bacteria | 3099 |
| 321 | Ga0268265_10091944 | 3300028380 | Bacteria | 2427 |
| 322 | Ga0268264_10005954 | 3300028381 | Bacteria | 10319 |
| 323 | Ga0265337_1026696 | 3300028556 | Bacteria | 1747 |
| 324 | Ga0307517_10002278 | 3300028786 | Bacteria | 30957 |
| 325 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 326 | Ga0307515_10016038 | 3300028794 | Bacteria | 13751 |
| 327 | Ga0307515_10018830 | 3300028794 | Bacteria | 12464 |
| 328 | Ga0307515_10086362 | 3300028794 | Bacteria | 4000 |
| 329 | Ga0307515_10091070 | 3300028794 | Bacteria | 3815 |
| 330 | Ga0307515_10149059 | 3300028794 | Bacteria | 2457 |
| 331 | Ga0307515_10157370 | 3300028794 | Bacteria | 2337 |
| 332 | Ga0316177_1033553 | 3300030731 | Bacteria | 1343 |
| 333 | Ga0316177_1163442 | 3300030731 | Bacteria | 1310 |
| 334 | Ga0316182_1128715 | 3300030745 | Bacteria | 2269 |
| 335 | Ga0265320_10017913 | 3300031240 | Bacteria | 3916 |
| 336 | Ga0265339_10006224 | 3300031249 | Bacteria | 7857 |
| 337 | Ga0265327_10106312 | 3300031251 | Bacteria | 1347 |
| 338 | Ga0307513_10104938 | 3300031456 | Bacteria | 2837 |
| 339 | Ga0307513_10217135 | 3300031456 | Bacteria | 1737 |
| 340 | Ga0307513_10329004 | 3300031456 | Bacteria | 1283 |
| 341 | Ga0307509_10000157 | 3300031507 | Bacteria | 106022 |
| 342 | Ga0307509_10005739 | 3300031507 | Bacteria | 17088 |
| 343 | Ga0307509_10030138 | 3300031507 | Bacteria | 6005 |
| 344 | Ga0307509_10034314 | 3300031507 | Bacteria | 5574 |
| 345 | Ga0307509_10206077 | 3300031507 | Bacteria | 1797 |
| 346 | Ga0307509_10356449 | 3300031507 | Bacteria | 1184 |
| 347 | Ga0307408_100000022 | 3300031548 | Bacteria | 310242 |
| 348 | Ga0307408_100000046 | 3300031548 | Bacteria | 167686 |
| 349 | Ga0307408_100001037 | 3300031548 | Bacteria | 21346 |
| 350 | Ga0307408_100001365 | 3300031548 | Bacteria | 18206 |
| 351 | Ga0307408_100003010 | 3300031548 | Bacteria | 11653 |
| 352 | Ga0307408_100084007 | 3300031548 | Bacteria | 2387 |
| 353 | Ga0307408_100090754 | 3300031548 | Bacteria | 2306 |
| 354 | Ga0307408_100227833 | 3300031548 | Bacteria | 1524 |
| 355 | Ga0307508_10000048 | 3300031616 | Bacteria | 137587 |
| 356 | Ga0307508_10045664 | 3300031616 | Bacteria | 3913 |
| 357 | Ga0307508_10071542 | 3300031616 | Bacteria | 3042 |
| 358 | Ga0307508_10086959 | 3300031616 | Bacteria | 2710 |
| 359 | Ga0307514_10028808 | 3300031649 | Bacteria | 4475 |
| 360 | Ga0307514_10053972 | 3300031649 | Bacteria | 3099 |
| 361 | Ga0265314_10089759 | 3300031711 | Bacteria | 2004 |
| 362 | Ga0307405_10283079 | 3300031731 | Bacteria | 1249 |
| 363 | Ga0307407_10339071 | 3300031903 | Bacteria | 1061 |
| 364 | Ga0307412_10029815 | 3300031911 | Bacteria | 3428 |
| 365 | Ga0307412_10071852 | 3300031911 | Bacteria | 2363 |
| 366 | Ga0307416_100360100 | 3300032002 | Bacteria | 1476 |
| 367 | Ga0307416_100551542 | 3300032002 | Bacteria | 1226 |
| 368 | Ga0307414_10222409 | 3300032004 | Bacteria | 1551 |
| 369 | Ga0307414_10233689 | 3300032004 | Bacteria | 1517 |
| 370 | Ga0307510_10000883 | 3300033180 | Bacteria | 31532 |
| 371 | Ga0307510_10010444 | 3300033180 | Bacteria | 11029 |
| 372 | Ga0373939_0037803 | 3300035114 | Bacteria | 1436 |
| 373 | Ga0373943_0092010 | 3300035170 | Bacteria | 1572 |
| 374 | Ga0373931_0035876 | 3300035691 | Bacteria | 2581 |
| 375 | Ga0373947_0049489 | 3300035725 | Bacteria | 2524 |
| 376 | Ga0373937_0005178 | 3300036401 | Bacteria | 11125 |
| 377 | Ga0373925_0017299 | 3300037068 | Bacteria | 5224 |
| 378 | Ga0373925_0190579 | 3300037068 | Bacteria | 1627 |
| 379 | Ga0373925_0260437 | 3300037068 | Bacteria | 1393 |
| 380 | Ga0395899_0001092 | 3300037312 | Bacteria | 24358 |
| 381 | Ga0395899_0002955 | 3300037312 | Bacteria | 13605 |
| 382 | Ga0395899_0005351 | 3300037312 | Bacteria | 9972 |
| 383 | Ga0395899_0014220 | 3300037312 | Bacteria | 6074 |
| 384 | Ga0395899_0022519 | 3300037312 | Bacteria | 4775 |
| 385 | Ga0395899_0044223 | 3300037312 | Bacteria | 3320 |
| 386 | Ga0395899_0094703 | 3300037312 | Bacteria | 2160 |
| 387 | Ga0395900_0000081 | 3300037418 | Bacteria | 174128 |
| 388 | Ga0395900_0000148 | 3300037418 | Bacteria | 117889 |
| 389 | Ga0395900_0001208 | 3300037418 | Bacteria | 31966 |
| 390 | Ga0395900_0003059 | 3300037418 | Bacteria | 18210 |
| 391 | Ga0395900_0036687 | 3300037418 | Bacteria | 5054 |
| 392 | Ga0395900_0057623 | 3300037418 | Bacteria | 3999 |
| 393 | Ga0395900_0136768 | 3300037418 | Bacteria | 2510 |
| 394 | Ga0395898_0000201 | 3300037466 | Bacteria | 153821 |
| 395 | Ga0395898_0119308 | 3300037466 | Bacteria | 2526 |
| 396 | Ga0395898_0241195 | 3300037466 | Bacteria | 1724 |
| 397 | Ga0395905_0009494 | 3300037471 | Bacteria | 9509 |
| 398 | Ga0395905_0017108 | 3300037471 | Bacteria | 6886 |
| 399 | Ga0395905_0127464 | 3300037471 | Bacteria | 2393 |
| 400 | Ga0395905_0307363 | 3300037471 | Bacteria | 1474 |
| 401 | Ga0436364_0407173 | 3300037853 | Bacteria | 1714 |
| 402 | Ga0395901_0000237 | 3300038443 | Bacteria | 69208 |
| 403 | Ga0395901_0090868 | 3300038443 | Bacteria | 3196 |
| 404 | Ga0395901_0172932 | 3300038443 | Bacteria | 2266 |
| 405 | Ga0395901_0308767 | 3300038443 | Bacteria | 1638 |
| 406 | Ga0436360_0544857 | 3300039438 | Bacteria | 2684 |
| 407 | Ga0436362_0381357 | 3300039453 | Bacteria | 2175 |
| 408 | Ga0439465_0053030 | 3300041413 | Bacteria | 1332 |
| 409 | Ga0451853_2845666 | 3300041512 | Bacteria | 1395 |
| 410 | Ga0439431_0006250 | 3300041997 | Bacteria | 2629 |
| 411 | Ga0439448_0000555 | 3300042005 | Bacteria | 8742 |
| 412 | Ga0439449_0021002 | 3300042007 | Bacteria | 2446 |
| 413 | Ga0450898_006057 | 3300042134 | Bacteria | 1846 |
| 414 | Ga0451577_0051628 | 3300042876 | Bacteria | 3671 |
| 415 | Ga0451577_0094783 | 3300042876 | Bacteria | 2665 |
| 416 | Ga0466969_0000232 | 3300044656 | Bacteria | 30397 |
| 417 | Ga0466969_0006699 | 3300044656 | Bacteria | 6125 |
| 418 | Ga0466969_0014607 | 3300044656 | Bacteria | 4128 |
| 419 | Ga0466969_0035390 | 3300044656 | Bacteria | 2525 |
| 420 | Ga0466972_0000383 | 3300044658 | Bacteria | 23678 |
| 421 | Ga0466972_0000568 | 3300044658 | Bacteria | 18002 |
| 422 | Ga0466972_0006200 | 3300044658 | Bacteria | 6009 |
| 423 | Ga0466972_0036061 | 3300044658 | Bacteria | 2420 |
| 424 | Ga0466965_0000082 | 3300044683 | Bacteria | 27799 |
| 425 | Ga0466965_0001230 | 3300044683 | Bacteria | 10128 |
| 426 | Ga0466965_0005218 | 3300044683 | Bacteria | 5839 |
| 427 | Ga0466965_0085184 | 3300044683 | Bacteria | 1602 |
| 428 | Ga0466966_0000428 | 3300044684 | Bacteria | 27011 |
| 429 | Ga0466966_0002106 | 3300044684 | Bacteria | 12927 |
| 430 | Ga0466966_0004513 | 3300044684 | Bacteria | 9186 |
| 431 | Ga0466966_0005887 | 3300044684 | Bacteria | 8086 |
| 432 | Ga0466966_0009166 | 3300044684 | Bacteria | 6552 |
| 433 | Ga0466966_0023505 | 3300044684 | Bacteria | 4034 |
| 434 | Ga0466966_0032955 | 3300044684 | Bacteria | 3354 |
| 435 | Ga0466966_0072487 | 3300044684 | Bacteria | 2156 |
| 436 | Ga0466966_0254042 | 3300044684 | Bacteria | 1059 |
| 437 | Ga0466961_0000229 | 3300044693 | Bacteria | 37957 |
| 438 | Ga0466961_0006081 | 3300044693 | Bacteria | 7655 |
| 439 | Ga0466961_0019174 | 3300044693 | Bacteria | 4402 |
| 440 | Ga0466961_0151018 | 3300044693 | Bacteria | 1450 |
| 441 | Ga0466961_0203342 | 3300044693 | Bacteria | 1224 |
| 442 | Ga0466963_0005033 | 3300044694 | Bacteria | 7722 |
| 443 | Ga0466963_0069977 | 3300044694 | Bacteria | 2360 |
| 444 | Ga0466964_0000492 | 3300044706 | Bacteria | 12242 |
| 445 | Ga0466964_0002109 | 3300044706 | Bacteria | 7004 |
| 446 | Ga0466964_0013400 | 3300044706 | Bacteria | 3111 |
| 447 | Ga0466971_0035615 | 3300044719 | Bacteria | 2232 |
| 448 | Ga0466968_0000879 | 3300044735 | Bacteria | 10556 |
| 449 | Ga0466968_0013820 | 3300044735 | Bacteria | 3179 |
| 450 | Ga0466970_0008945 | 3300044765 | Bacteria | 5050 |
| 451 | Ga0466970_0040109 | 3300044765 | Bacteria | 2486 |
| 452 | Ga0466970_0054294 | 3300044765 | Bacteria | 2140 |
| 453 | Ga0466970_0087732 | 3300044765 | Bacteria | 1687 |
| 454 | Ga0466957_0000337 | 3300044842 | Bacteria | 22931 |
| 455 | Ga0466957_0005060 | 3300044842 | Bacteria | 7379 |
| 456 | Ga0466957_0010664 | 3300044842 | Bacteria | 5282 |
| 457 | Ga0466960_0061170 | 3300044901 | Bacteria | 1848 |
| 458 | Ga0466959_0013955 | 3300045049 | Bacteria | 5832 |
| 459 | Ga0466959_0018046 | 3300045049 | Bacteria | 5177 |
| 460 | Ga0466959_0076778 | 3300045049 | Bacteria | 2411 |
| 461 | Ga0466959_0113022 | 3300045049 | Bacteria | 1936 |
| 462 | Ga0451576_0089607 | 3300045051 | Bacteria | 3199 |
| 463 | Ga0466958_0005517 | 3300045836 | Bacteria | 6820 |
| 464 | Ga0466958_0021614 | 3300045836 | Bacteria | 3763 |
| 465 | Ga0466958_0148404 | 3300045836 | Bacteria | 1478 |
| 466 | Ga0466967_0693098 | 3300045976 | Bacteria | 1009 |
| 467 | Ga0495592_0000058 | 3300046454 | Bacteria | 101492 |
| 468 | Ga0495590_0000016 | 3300046457 | Bacteria | 225874 |
| 469 | Ga0495590_0044047 | 3300046457 | Bacteria | 1556 |
| 470 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 471 | Ga0495653_0003297 | 3300046463 | Bacteria | 12950 |
| 472 | Ga0495650_0002031 | 3300046471 | Bacteria | 17703 |
| 473 | Ga0495580_0019602 | 3300046472 | Bacteria | 5025 |
| 474 | Ga0495580_0242368 | 3300046472 | Bacteria | 1236 |
| 475 | Ga0495605_0000684 | 3300046474 | Bacteria | 25383 |
| 476 | Ga0495605_0003913 | 3300046474 | Bacteria | 8818 |
| 477 | Ga0495605_0064763 | 3300046474 | Bacteria | 1740 |
| 478 | Ga0495639_0009356 | 3300046475 | Bacteria | 4203 |
| 479 | Ga0495584_0000915 | 3300046491 | Bacteria | 18831 |
| 480 | Ga0495584_0002336 | 3300046491 | Bacteria | 10810 |
| 481 | Ga0495584_0003323 | 3300046491 | Bacteria | 8900 |
| 482 | Ga0495584_0011193 | 3300046491 | Bacteria | 4597 |
| 483 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 484 | Ga0495585_0000162 | 3300046492 | Bacteria | 71606 |
| 485 | Ga0495585_0007241 | 3300046492 | Bacteria | 6813 |
| 486 | Ga0495585_0009385 | 3300046492 | Bacteria | 5868 |
| 487 | Ga0495585_0036768 | 3300046492 | Bacteria | 2759 |
| 488 | Ga0495585_0041772 | 3300046492 | Bacteria | 2571 |
| 489 | Ga0495585_0071056 | 3300046492 | Bacteria | 1897 |
| 490 | Ga0495585_0130399 | 3300046492 | Bacteria | 1323 |
| 491 | Ga0495596_0000013 | 3300046500 | Bacteria | 125228 |
| 492 | Ga0495596_0000833 | 3300046500 | Bacteria | 18653 |
| 493 | Ga0495596_0000901 | 3300046500 | Bacteria | 17803 |
| 494 | Ga0495596_0003244 | 3300046500 | Bacteria | 8321 |
| 495 | Ga0495607_0000316 | 3300046501 | Bacteria | 50215 |
| 496 | Ga0495607_0001702 | 3300046501 | Bacteria | 18913 |
| 497 | Ga0495607_0003182 | 3300046501 | Bacteria | 12691 |
| 498 | Ga0495607_0003268 | 3300046501 | Bacteria | 12466 |
| 499 | Ga0495607_0021859 | 3300046501 | Bacteria | 4023 |
| 500 | Ga0495583_0000189 | 3300046506 | Bacteria | 103518 |
| 501 | Ga0495583_0000655 | 3300046506 | Bacteria | 45614 |
| 502 | Ga0495583_0000688 | 3300046506 | Bacteria | 43737 |
| 503 | Ga0495583_0002721 | 3300046506 | Bacteria | 14634 |
| 504 | Ga0495583_0013411 | 3300046506 | Bacteria | 4571 |
| 505 | Ga0495583_0041851 | 3300046506 | Bacteria | 2143 |
| 506 | Ga0495583_0090147 | 3300046506 | Bacteria | 1321 |
| 507 | Ga0495606_0000070 | 3300046507 | Bacteria | 177343 |
| 508 | Ga0495606_0003081 | 3300046507 | Bacteria | 18174 |
| 509 | Ga0495606_0052909 | 3300046507 | Bacteria | 2637 |
| 510 | Ga0495606_0054698 | 3300046507 | Bacteria | 2584 |
| 511 | Ga0495606_0229514 | 3300046507 | Bacteria | 1041 |
| 512 | Ga0495610_0004252 | 3300046512 | Bacteria | 10662 |
| 513 | Ga0495610_0026614 | 3300046512 | Bacteria | 3087 |
| 514 | Ga0495616_0000646 | 3300046513 | Bacteria | 25901 |
| 515 | Ga0495616_0000799 | 3300046513 | Bacteria | 23070 |
| 516 | Ga0495616_0001668 | 3300046513 | Bacteria | 15169 |
| 517 | Ga0495616_0019559 | 3300046513 | Bacteria | 3693 |
| 518 | Ga0495616_0040554 | 3300046513 | Bacteria | 2378 |
| 519 | Ga0495616_0046894 | 3300046513 | Bacteria | 2179 |
| 520 | Ga0495616_0084619 | 3300046513 | Bacteria | 1511 |
| 521 | Ga0495620_0001634 | 3300046515 | Bacteria | 13278 |
| 522 | Ga0495628_0000109 | 3300046516 | Bacteria | 67425 |
| 523 | Ga0495631_0004026 | 3300046518 | Bacteria | 7909 |
| 524 | Ga0495631_0010136 | 3300046518 | Bacteria | 4677 |
| 525 | Ga0495631_0028238 | 3300046518 | Bacteria | 2560 |
| 526 | Ga0495631_0039780 | 3300046518 | Bacteria | 2084 |
| 527 | Ga0495632_0000118 | 3300046519 | Bacteria | 81183 |
| 528 | Ga0495632_0000321 | 3300046519 | Bacteria | 46253 |
| 529 | Ga0495632_0001878 | 3300046519 | Bacteria | 16853 |
| 530 | Ga0495632_0006806 | 3300046519 | Bacteria | 7295 |
| 531 | Ga0495632_0014187 | 3300046519 | Bacteria | 4518 |
| 532 | Ga0495632_0038404 | 3300046519 | Bacteria | 2424 |
| 533 | Ga0495637_0023384 | 3300046520 | Bacteria | 2810 |
| 534 | Ga0495637_0075744 | 3300046520 | Bacteria | 1349 |
| 535 | Ga0495643_0000236 | 3300046522 | Bacteria | 83225 |
| 536 | Ga0495643_0002480 | 3300046522 | Bacteria | 14537 |
| 537 | Ga0495643_0050575 | 3300046522 | Bacteria | 2238 |
| 538 | Ga0495643_0066689 | 3300046522 | Bacteria | 1898 |
| 539 | Ga0495644_0001385 | 3300046523 | Bacteria | 9910 |
| 540 | Ga0495644_0027680 | 3300046523 | Bacteria | 2147 |
| 541 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 542 | Ga0495648_0000033 | 3300046524 | Bacteria | 199184 |
| 543 | Ga0495648_0007546 | 3300046524 | Bacteria | 8693 |
| 544 | Ga0495648_0043992 | 3300046524 | Bacteria | 2792 |
| 545 | Ga0495663_0001760 | 3300046525 | Bacteria | 6719 |
| 546 | Ga0495663_0067745 | 3300046525 | Bacteria | 1132 |
| 547 | Ga0495642_0000673 | 3300046528 | Bacteria | 17015 |
| 548 | Ga0495642_0005081 | 3300046528 | Bacteria | 5067 |
| 549 | Ga0495642_0008493 | 3300046528 | Bacteria | 3928 |
| 550 | Ga0495652_0082260 | 3300046529 | Bacteria | 2654 |
| 551 | Ga0495652_0123081 | 3300046529 | Bacteria | 2065 |
| 552 | Ga0495654_0014733 | 3300046530 | Bacteria | 4157 |
| 553 | Ga0495654_0050233 | 3300046530 | Bacteria | 2039 |
| 554 | Ga0495640_0140977 | 3300046533 | Bacteria | 1554 |
| 555 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 556 | Ga0495609_0000084 | 3300046538 | Bacteria | 113497 |
| 557 | Ga0495609_0059233 | 3300046538 | Bacteria | 1693 |
| 558 | Ga0495621_0008835 | 3300046539 | Bacteria | 3036 |
| 559 | Ga0495597_0000028 | 3300046542 | Bacteria | 137215 |
| 560 | Ga0495597_0000080 | 3300046542 | Bacteria | 84504 |
| 561 | Ga0495597_0005046 | 3300046542 | Bacteria | 7065 |
| 562 | Ga0495597_0021109 | 3300046542 | Bacteria | 3028 |
| 563 | Ga0495597_0023629 | 3300046542 | Bacteria | 2843 |
| 564 | Ga0495597_0036901 | 3300046542 | Bacteria | 2198 |
| 565 | Ga0495645_0096352 | 3300046543 | Bacteria | 2108 |
| 566 | Ga0495622_0000483 | 3300046557 | Bacteria | 25083 |
| 567 | Ga0495622_0029884 | 3300046557 | Bacteria | 2545 |
| 568 | Ga0495633_0000204 | 3300046558 | Bacteria | 75182 |
| 569 | Ga0495633_0000399 | 3300046558 | Bacteria | 45392 |
| 570 | Ga0495633_0009652 | 3300046558 | Bacteria | 5312 |
| 571 | Ga0495633_0019359 | 3300046558 | Bacteria | 3444 |
| 572 | Ga0495633_0052919 | 3300046558 | Bacteria | 1911 |
| 573 | Ga0495656_0007073 | 3300046615 | Bacteria | 3957 |
| 574 | Ga0495656_0028866 | 3300046615 | Bacteria | 2228 |
| 575 | Ga0495656_0075010 | 3300046615 | Bacteria | 1512 |
| 576 | Ga0495668_0000006 | 3300046616 | Bacteria | 553404 |
| 577 | Ga0495668_0000132 | 3300046616 | Bacteria | 112674 |
| 578 | Ga0495668_0003093 | 3300046616 | Bacteria | 12858 |
| 579 | Ga0495668_0009077 | 3300046616 | Bacteria | 6136 |
| 580 | Ga0495668_0010419 | 3300046616 | Bacteria | 5624 |
| 581 | Ga0495668_0013502 | 3300046616 | Bacteria | 4814 |
| 582 | Ga0495668_0064593 | 3300046616 | Bacteria | 2014 |
| 583 | Ga0495611_0001712 | 3300046648 | Bacteria | 10645 |
| 584 | Ga0495611_0010146 | 3300046648 | Bacteria | 3984 |
| 585 | Ga0495611_0016943 | 3300046648 | Bacteria | 3115 |
| 586 | Ga0495625_0000143 | 3300046660 | Bacteria | 110121 |
| 587 | Ga0495625_0000177 | 3300046660 | Bacteria | 98918 |
| 588 | Ga0495625_0001203 | 3300046660 | Bacteria | 32899 |
| 589 | Ga0495625_0010429 | 3300046660 | Bacteria | 7690 |
| 590 | Ga0495625_0042302 | 3300046660 | Bacteria | 3312 |
| 591 | Ga0495625_0065650 | 3300046660 | Bacteria | 2558 |
| 592 | Ga0495625_0134454 | 3300046660 | Bacteria | 1673 |
| 593 | Ga0495659_0000185 | 3300046664 | Bacteria | 27168 |
| 594 | Ga0495659_0024668 | 3300046664 | Bacteria | 2052 |
| 595 | Ga0495661_0000053 | 3300046665 | Bacteria | 140234 |
| 596 | Ga0495661_0000170 | 3300046665 | Bacteria | 77754 |
| 597 | Ga0495661_0006188 | 3300046665 | Bacteria | 8425 |
| 598 | Ga0495661_0010366 | 3300046665 | Bacteria | 6360 |
| 599 | Ga0495661_0011327 | 3300046665 | Bacteria | 6051 |
| 600 | Ga0495661_0037821 | 3300046665 | Bacteria | 3010 |
| 601 | Ga0495661_0079702 | 3300046665 | Bacteria | 1891 |
| 602 | Ga0495661_0105990 | 3300046665 | Bacteria | 1573 |
| 603 | Ga0495588_0000062 | 3300046674 | Bacteria | 253674 |
| 604 | Ga0495588_0051070 | 3300046674 | Bacteria | 2129 |
| 605 | Ga0495599_0069794 | 3300046678 | Bacteria | 2193 |
| 606 | Ga0495669_0001281 | 3300046684 | Bacteria | 10407 |
| 607 | Ga0495669_0005080 | 3300046684 | Bacteria | 5475 |
| 608 | Ga0495624_0018331 | 3300046690 | Bacteria | 4682 |
| 609 | Ga0495624_0071891 | 3300046690 | Bacteria | 2152 |
| 610 | Ga0495670_0001661 | 3300046691 | Bacteria | 10911 |
| 611 | Ga0495670_0002325 | 3300046691 | Bacteria | 9387 |
| 612 | Ga0495670_0013246 | 3300046691 | Bacteria | 4056 |
| 613 | Ga0495671_0000088 | 3300046692 | Bacteria | 87282 |
| 614 | Ga0495671_0009586 | 3300046692 | Bacteria | 5406 |
| 615 | Ga0495671_0084406 | 3300046692 | Bacteria | 1556 |
| 616 | Ga0495649_0001312 | 3300046694 | Bacteria | 18988 |
| 617 | Ga0495649_0012827 | 3300046694 | Bacteria | 4859 |
| 618 | Ga0495649_0039555 | 3300046694 | Bacteria | 2585 |
| 619 | Ga0495649_0213616 | 3300046694 | Bacteria | 999 |
| 620 | Ga0495589_0000103 | 3300046794 | Bacteria | 81696 |
| 621 | Ga0495589_0001144 | 3300046794 | Bacteria | 15770 |
| 622 | Ga0495589_0024179 | 3300046794 | Bacteria | 3088 |
| 623 | Ga0495589_0024226 | 3300046794 | Bacteria | 3085 |
| 624 | Ga0495589_0040034 | 3300046794 | Bacteria | 2341 |
| 625 | Ga0495660_0000057 | 3300046810 | Bacteria | 133310 |
| 626 | Ga0495660_0000208 | 3300046810 | Bacteria | 60381 |
| 627 | Ga0495660_0001806 | 3300046810 | Bacteria | 14089 |
| 628 | Ga0495660_0024071 | 3300046810 | Bacteria | 3470 |
| 629 | Ga0495660_0048056 | 3300046810 | Bacteria | 2334 |
| 630 | Ga0495660_0093189 | 3300046810 | Bacteria | 1562 |
| 631 | Ga0495636_0000716 | 3300047318 | Bacteria | 12143 |
| 632 | Ga0495636_0028191 | 3300047318 | Bacteria | 2288 |
| 633 | Ga0495672_0000132 | 3300047320 | Bacteria | 111537 |
| 634 | Ga0495672_0000262 | 3300047320 | Bacteria | 73028 |
| 635 | Ga0495672_0029883 | 3300047320 | Bacteria | 3426 |
| 636 | Ga0495680_0011827 | 3300047322 | Bacteria | 7707 |
| 637 | Ga0495683_0000072 | 3300047323 | Bacteria | 104027 |
| 638 | Ga0495683_0007433 | 3300047323 | Bacteria | 5923 |
| 639 | Ga0495683_0033348 | 3300047323 | Bacteria | 2620 |
| 640 | Ga0495683_0039010 | 3300047323 | Bacteria | 2401 |
| 641 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 642 | Ga0495687_000722 | 3300047443 | Bacteria | 36591 |
| 643 | Ga0495687_000740 | 3300047443 | Bacteria | 35582 |
| 644 | Ga0495687_001604 | 3300047443 | Bacteria | 20397 |
| 645 | Ga0495687_003773 | 3300047443 | Bacteria | 10707 |
| 646 | Ga0495687_020008 | 3300047443 | Bacteria | 3271 |
| 647 | Ga0495677_0000009 | 3300047445 | Bacteria | 170927 |
| 648 | Ga0495677_0000217 | 3300047445 | Bacteria | 26216 |
| 649 | Ga0495677_0000873 | 3300047445 | Bacteria | 12174 |
| 650 | Ga0495677_0001907 | 3300047445 | Bacteria | 8336 |
| 651 | Ga0495677_0002104 | 3300047445 | Bacteria | 7919 |
| 652 | Ga0495677_0002684 | 3300047445 | Bacteria | 6948 |
| 653 | Ga0495677_0003892 | 3300047445 | Bacteria | 5773 |
| 654 | Ga0495677_0004159 | 3300047445 | Bacteria | 5584 |
| 655 | Ga0495677_0005946 | 3300047445 | Bacteria | 4621 |
| 656 | Ga0495677_0008922 | 3300047445 | Bacteria | 3709 |
| 657 | Ga0495679_005033 | 3300047446 | Bacteria | 5943 |
| 658 | Ga0495681_0000907 | 3300047470 | Bacteria | 22863 |
| 659 | Ga0495681_0002551 | 3300047470 | Bacteria | 12977 |
| 660 | Ga0495681_0007002 | 3300047470 | Bacteria | 7286 |
| 661 | Ga0495681_0008872 | 3300047470 | Bacteria | 6249 |
| 662 | Ga0495681_0037694 | 3300047470 | Bacteria | 2378 |
| 663 | Ga0495681_0043194 | 3300047470 | Bacteria | 2175 |
| 664 | Ga0495686_0000627 | 3300047472 | Bacteria | 48600 |
| 665 | Ga0495686_0003319 | 3300047472 | Bacteria | 14049 |
| 666 | Ga0495686_0038635 | 3300047472 | Bacteria | 3052 |
| 667 | Ga0495686_0121925 | 3300047472 | Bacteria | 1553 |
| 668 | Ga0495686_0181227 | 3300047472 | Bacteria | 1220 |
| 669 | Ga0495602_0050698 | 3300048088 | Bacteria | 3706 |
| 670 | Ga0495615_0000170 | 3300048090 | Bacteria | 16086 |
| 671 | Ga0495626_0000011 | 3300048091 | Bacteria | 260928 |
| 672 | Ga0495626_0000290 | 3300048091 | Bacteria | 54140 |
| 673 | Ga0495626_0011297 | 3300048091 | Bacteria | 4728 |
| 674 | Ga0495626_0011964 | 3300048091 | Bacteria | 4567 |
| 675 | Ga0495626_0020550 | 3300048091 | Bacteria | 3288 |
| 676 | Ga0495626_0094246 | 3300048091 | Bacteria | 1313 |
| 677 | Ga0496101_0138280 | 3300048904 | Bacteria | 1855 |
| 678 | Ga0496101_0156154 | 3300048904 | Bacteria | 1748 |
| 679 | Ga0496102_0060133 | 3300048905 | Bacteria | 3476 |
| 680 | Ga0496102_0244086 | 3300048905 | Bacteria | 1693 |
| 681 | Ga0496103_0049655 | 3300048906 | Bacteria | 2594 |
| 682 | Ga0496104_0073802 | 3300048907 | Bacteria | 3246 |
| 683 | Ga0496106_0012017 | 3300048909 | Bacteria | 6389 |
| 684 | Ga0496106_0061377 | 3300048909 | Bacteria | 2852 |
| 685 | Ga0496107_0037314 | 3300048910 | Bacteria | 3487 |
| 686 | Ga0496107_0040886 | 3300048910 | Bacteria | 3329 |
| 687 | Ga0496108_0607873 | 3300048911 | Bacteria | 952 |
| 688 | Ga0496111_0016619 | 3300048914 | Bacteria | 5074 |
| 689 | Ga0496113_0014394 | 3300048916 | Bacteria | 5395 |
| 690 | Ga0496114_0214596 | 3300048917 | Bacteria | 1688 |
| 691 | Ga0496114_0355574 | 3300048917 | Bacteria | 1296 |
| 692 | Ga0496116_0031617 | 3300048919 | Bacteria | 3785 |
| 693 | Ga0496116_0048918 | 3300048919 | Bacteria | 2832 |
| 694 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 695 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 696 | Ga0496118_0076880 | 3300048921 | Bacteria | 2370 |
| 697 | Ga0496119_0002111 | 3300048922 | Bacteria | 22397 |
| 698 | Ga0496119_0011802 | 3300048922 | Bacteria | 7177 |
| 699 | Ga0496119_0012354 | 3300048922 | Bacteria | 6944 |
| 700 | Ga0496120_0025916 | 3300048923 | Bacteria | 3631 |
| 701 | Ga0496120_0106982 | 3300048923 | Bacteria | 1468 |
| 702 | Ga0496121_0000490 | 3300048924 | Bacteria | 75983 |
| 703 | Ga0496121_0002266 | 3300048924 | Bacteria | 29939 |
| 704 | Ga0496121_0004661 | 3300048924 | Bacteria | 18211 |
| 705 | Ga0496121_0088627 | 3300048924 | Bacteria | 2425 |
| 706 | Ga0496122_0000821 | 3300048925 | Bacteria | 59417 |
| 707 | Ga0496122_0001042 | 3300048925 | Bacteria | 48555 |
| 708 | Ga0496122_0005095 | 3300048925 | Bacteria | 15854 |
| 709 | Ga0496122_0023924 | 3300048925 | Bacteria | 5364 |
| 710 | Ga0496122_0069721 | 3300048925 | Bacteria | 2516 |
| 711 | Ga0496123_0000872 | 3300048926 | Bacteria | 47911 |
| 712 | Ga0496123_0001273 | 3300048926 | Bacteria | 36130 |
| 713 | Ga0496123_0003879 | 3300048926 | Bacteria | 16268 |
| 714 | Ga0496123_0030777 | 3300048926 | Bacteria | 3921 |
| 715 | Ga0496123_0057754 | 3300048926 | Bacteria | 2523 |
| 716 | Ga0496124_0017647 | 3300048927 | Bacteria | 6720 |
| 717 | Ga0496124_0018875 | 3300048927 | Bacteria | 6440 |
| 718 | Ga0496124_0233659 | 3300048927 | Bacteria | 1372 |
| 719 | Ga0496125_0000884 | 3300048928 | Bacteria | 47543 |
| 720 | Ga0496125_0034167 | 3300048928 | Bacteria | 4486 |
| 721 | Ga0496125_0046007 | 3300048928 | Bacteria | 3666 |
| 722 | Ga0496125_0116580 | 3300048928 | Bacteria | 1918 |
| 723 | Ga0496125_0148245 | 3300048928 | Bacteria | 1617 |
| 724 | Ga0496126_0001786 | 3300048929 | Bacteria | 31736 |
| 725 | Ga0496126_0043152 | 3300048929 | Bacteria | 4162 |
| 726 | Ga0496126_0088424 | 3300048929 | Bacteria | 2729 |
| 727 | Ga0495678_007026 | 3300049459 | Bacteria | 5900 |
| 728 | Ga0495678_053681 | 3300049459 | Bacteria | 1546 |
| 729 | Ga0495678_070702 | 3300049459 | Bacteria | 1280 |
| 730 | Ga0495682_0003951 | 3300049460 | Bacteria | 6467 |
| 731 | Ga0495682_0016442 | 3300049460 | Bacteria | 2801 |
| 732 | Ga0501292_003979 | 3300049515 | Bacteria | 2001 |
| 733 | Ga0501033_0000186 | 3300049570 | Bacteria | 59624 |
| 734 | Ga0501033_0029154 | 3300049570 | Bacteria | 4147 |
| 735 | Ga0501037_0269359 | 3300049573 | Bacteria | 1189 |
| 736 | Ga0501047_0008047 | 3300049581 | Bacteria | 9948 |
| 737 | Ga0501067_0221256 | 3300049583 | Bacteria | 1054 |
| 738 | Ga0501076_0215169 | 3300049592 | Bacteria | 1571 |
| 739 | Ga0501079_0103835 | 3300049741 | Bacteria | 2205 |
| 740 | Ga0501269_000203 | 3300049766 | Bacteria | 17659 |
| 741 | Ga0501035_0000292 | 3300049822 | Bacteria | 59353 |
| 742 | Ga0501035_0001063 | 3300049822 | Bacteria | 28793 |
| 743 | Ga0501035_0028835 | 3300049822 | Bacteria | 5064 |
| 744 | Ga0501044_0005038 | 3300049823 | Bacteria | 14756 |
| 745 | Ga0501044_0118140 | 3300049823 | Bacteria | 2655 |
| 746 | Ga0501044_0171576 | 3300049823 | Bacteria | 2140 |
| 747 | nmdc:mga0k408_1383_c1 | 3300050493 | Bacteria | 13098 |
| 748 | nmdc:mga0k408_189728_c1 | 3300050493 | Bacteria | 1226 |
| 749 | nmdc:mga0k408_34927_c1 | 3300050493 | Bacteria | 2881 |
| 750 | nmdc:mga0k408_48393_c1 | 3300050493 | Bacteria | 2459 |
| 751 | nmdc:mga0k408_53133_c1 | 3300050493 | Bacteria | 2348 |
| 752 | nmdc:mga0k408_6516_c1 | 3300050493 | Bacteria | 6220 |
| 753 | nmdc:mga06z11_52034_c1 | 3300050494 | Bacteria | 2099 |
| 754 | nmdc:mga06z11_8396_c1 | 3300050494 | Bacteria | 4304 |
| 755 | nmdc:mga07m45_100192_c1 | 3300050496 | Bacteria | 1664 |
| 756 | nmdc:mga07m45_3676_c1 | 3300050496 | Bacteria | 7416 |
| 757 | nmdc:mga07m45_4791_c2 | 3300050496 | Bacteria | 6001 |
| 758 | nmdc:mga07m45_6783_c1 | 3300050496 | Bacteria | 5817 |
| 759 | nmdc:mga07m45_88556_c1 | 3300050496 | Bacteria | 1772 |
| 760 | nmdc:mga0sz30_4699_c1 | 3300050516 | Bacteria | 4957 |
| 761 | nmdc:mga0sz30_5171_c1 | 3300050516 | Bacteria | 4138 |
| 762 | Ga0500578_0000028 | 3300053086 | Bacteria | 144081 |
| 763 | Ga0500572_000038 | 3300053111 | Bacteria | 42226 |
| 764 | Ga0500658_0013184 | 3300053134 | Bacteria | 3052 |
| 765 | Ga0500559_0000326 | 3300053136 | Bacteria | 35945 |
| 766 | Ga0500559_0002516 | 3300053136 | Bacteria | 9415 |
| 767 | Ga0500568_0011765 | 3300053139 | Bacteria | 4044 |
| 768 | Ga0500590_024655 | 3300053148 | Bacteria | 3122 |
| 769 | Ga0500622_0003342 | 3300053156 | Bacteria | 10813 |
| 770 | Ga0500645_006464 | 3300053730 | Bacteria | 4179 |
| 771 | Ga0466962_0017319 | 3300061719 | Bacteria | 3469 |
| 772 | Ga0466962_0019076 | 3300061719 | Bacteria | 3294 |
| 773 | Ga0466962_0046904 | 3300061719 | Bacteria | 2065 |
| 774 | Ga0466962_0093047 | 3300061719 | Bacteria | 1445 |
| 775 | 2887376945 | 2887375801 | Bacteria | 5334027 |
| 776 | 2521557198 | 2521172590 | Bacteria | 5047645 |
| 777 | 2524441154 | 2524023205 | Bacteria | 8918781 |
| 778 | 2585395586 | 2582581866 | Bacteria | 6859583 |
| 779 | 2588291951 | 2588253510 | Bacteria | 6901809 |
| 780 | 2599907671 | 2599185292 | Bacteria | 6290804 |
| 781 | 2600225879 | 2599185359 | Bacteria | 4772316 |
| 782 | 2601669511 | 2600255292 | Bacteria | 6300551 |
| 783 | 2643791702 | 2643221554 | Bacteria | 6603920 |
| 784 | 2643798796 | 2643221556 | Bacteria | 7251154 |
| 785 | 2643858729 | 2643221569 | Bacteria | 6064337 |
| 786 | 2643935169 | 2643221585 | Bacteria | 5812563 |
| 787 | 2643982111 | 2643221594 | Bacteria | 5811388 |
| 788 | 2644120501 | 2643221621 | Bacteria | 6212786 |
| 789 | 2644253122 | 2643221645 | Bacteria | 7207331 |
| 790 | 2644303811 | 2643221654 | Bacteria | 5273570 |
| 791 | 2644314933 | 2643221656 | Bacteria | 5809961 |
| 792 | 2644354982 | 2643221664 | Bacteria | 7272945 |
| 793 | 2644471109 | 2643221684 | Bacteria | 7145183 |
| 794 | 2738741760 | 2738541280 | Bacteria | 6630198 |
| 795 | 2738843920 | 2738541300 | Bacteria | 6675882 |
| 796 | 2739274519 | 2738543018 | Bacteria | 6718814 |
| 797 | 2739343563 | 2738543030 | Bacteria | 6719714 |
| 798 | 2808855184 | 2808606361 | Bacteria | 6136259 |
| 799 | 2808922906 | 2808606376 | Bacteria | 6248667 |
| 800 | 2808935240 | 2808606378 | Bacteria | 6177535 |
| 801 | 2808945219 | 2808606380 | Bacteria | 6248705 |
| 802 | 2808963689 | 2808606383 | Bacteria | 6138645 |
| 803 | 2808998577 | 2808606389 | Bacteria | 6138126 |
| 804 | 2809034215 | 2808606395 | Bacteria | 6020352 |
| 805 | 2842712542 | 2842711865 | Bacteria | 7155354 |
| 806 | 2857506541 | 2857504554 | Bacteria | 5369913 |
| 807 | 2857540163 | 2857537821 | Bacteria | 5248181 |
| 808 | 2858954130 | 2858950400 | Bacteria | 6783797 |
| 809 | 2904430445 | 2904424332 | Bacteria | 7633521 |
| 810 | 2919128191 | 2919125081 | Bacteria | 5385106 |
| 811 | 2928529346 | 2928526807 | Bacteria | 4760224 |
| 812 | 2932414780 | 2932410948 | Bacteria | 6312192 |
| 813 | 2932420700 | 2932416698 | Bacteria | 6315112 |
| 814 | 2941480008 | |||
| 815 | 2974323399 | 2974320154 | Bacteria | 4571377 |
| 816 | 8002870213 | 8002869464 | Bacteria | 3588529 |
| 817 | 8019775346 | 8019769354 | Bacteria | 6924660 |
| 818 | 8047678355 | 8047673197 | Bacteria | 7395230 |
| 819 | SwRhRL2b_contig_3045014 | |||
| 820 | JGI25158J39367_1000072 | |||
| 821 | JGI25152J39213_1000002 | |||
| 822 | JGI25152J39213_1002551 | |||
| 823 | JGI25150J39212_1000038 | |||
| 824 | JGI25150J39212_1004440 | |||
| 825 | JGI25150J39212_1014009 | |||
| 826 | JGI25159J45721_1000185 | |||
| 827 | JGI25159J45721_1000254 | |||
| 828 | JGI25153J46596_10002426 | |||
| 829 | JGI25160J50197_1010928 | |||
| 830 | JGI25161J50226_1000062 | |||
| 831 | JGI25161J50226_1001608 | |||
| 832 | Ga0007417J51691_1037902 | |||
| 833 | Ga0007416J51690_1048530 | |||
| 834 | Ga0032354_1067082 | |||
| 835 | Ga0055525_1000047 | |||
| 836 | Ga0055529_1000330 | |||
| 837 | Ga0055526_1000358 | |||
| 838 | Ga0055526_1000632 | |||
| 839 | Ga0055537_1010324 | |||
| 840 | Ga0055524_1000105 | |||
| 841 | Ga0055524_1000462 | |||
| 842 | Ga0055534_1006004 | |||
| 843 | Ga0055530_10000078 | |||
| 844 | Ga0055530_10006780 | |||
| 845 | Ga0055530_10015724 | |||
| 846 | Ga0055531_10001856 | |||
| 847 | Ga0055531_10007148 | |||
| 848 | Ga0055531_10014463 | |||
| 849 | Ga0055543_1000121 | |||
| 850 | Ga0055543_1018635 | |||
| 851 | Ga0065165_1000261 | |||
| 852 | Ga0065165_1018238 | |||
| 853 | Ga0065165_1022086 | |||
| 854 | Ga0065704_10075819 | |||
| 855 | Ga0065707_10087177 | |||
| 856 | Ga0070658_10090392 | |||
| 857 | Ga0070658_10147892 | |||
| 858 | Ga0070676_10128148 | |||
| 859 | Ga0070690_100040624 | |||
| 860 | Ga0070670_100394202 | |||
| 861 | Ga0070677_10061668 | |||
| 862 | Ga0068869_100014797 | |||
| 863 | Ga0070666_10001793 | |||
| 864 | Ga0070666_10117478 | |||
| 865 | Ga0068868_100000185 | |||
| 866 | Ga0068868_100039078 | |||
| 867 | Ga0070660_100005946 | |||
| 868 | Ga0070660_100057569 | |||
| 869 | Ga0070689_100010833 | |||
| 870 | Ga0070661_100062889 | |||
| 871 | Ga0070661_100116935 | |||
| 872 | Ga0070668_100088387 | |||
| 873 | Ga0070675_100001427 | |||
| 874 | Ga0070671_100015468 | |||
| 875 | Ga0070671_100032748 | |||
| 876 | Ga0070671_100065906 | |||
| 877 | Ga0070674_100013873 | |||
| 878 | Ga0070673_100002536 | |||
| 879 | Ga0070659_100460885 | |||
| 880 | Ga0070667_100004052 | |||
| 881 | Ga0070667_100020821 | |||
| 882 | Ga0070667_100102348 | |||
| 883 | Ga0070713_100017602 | |||
| 884 | Ga0070713_100127463 | |||
| 885 | Ga0070713_100428249 | |||
| 886 | Ga0070663_100003487 | |||
| 887 | Ga0070678_100007438 | |||
| 888 | Ga0070678_100031159 | |||
| 889 | Ga0070662_100023588 | |||
| 890 | Ga0070662_100073159 | |||
| 891 | Ga0068867_100000091 | |||
| 892 | Ga0068867_100000575 | |||
| 893 | Ga0068867_100030151 | |||
| 894 | Ga0070706_100053808 | |||
| 895 | Ga0070707_100037519 | |||
| 896 | Ga0070707_100053914 | |||
| 897 | Ga0068853_100450510 | |||
| 898 | Ga0070665_100067489 | |||
| 899 | Ga0068855_100007936 | |||
| 900 | Ga0068855_100028111 | |||
| 901 | Ga0068855_100243636 | |||
| 902 | Ga0068855_100732488 | |||
| 903 | Ga0070664_100044628 | |||
| 904 | Ga0070664_100045657 | |||
| 905 | Ga0068857_100072314 | |||
| 906 | Ga0068854_100038548 | |||
| 907 | Ga0068852_100002707 | |||
| 908 | Ga0068852_100039543 | |||
| 909 | Ga0068852_100527833 | |||
| 910 | Ga0068859_100001283 | |||
| 911 | Ga0068859_100003193 | |||
| 912 | Ga0068859_100470370 | |||
| 913 | Ga0068864_100001050 | |||
| 914 | Ga0068864_100012823 | |||
| 915 | Ga0068864_100079789 | |||
| 916 | Ga0068866_10009221 | |||
| 917 | Ga0068863_100004913 | |||
| 918 | Ga0068863_100052600 | |||
| 919 | Ga0068858_100000885 | |||
| 920 | Ga0068858_100039812 | |||
| 921 | Ga0081455_10191201 | |||
| 922 | Ga0075368_10034434 | |||
| 923 | Ga0075363_100065833 | |||
| 924 | Ga0075362_10039556 | |||
| 925 | Ga0075367_10007260 | |||
| 926 | Ga0075367_10035029 | |||
| 927 | Ga0075367_10044514 | |||
| 928 | Ga0075369_10014572 | |||
| 929 | Ga0075366_10001538 | |||
| 930 | Ga0075366_10028470 | |||
| 931 | Ga0075366_10038701 | |||
| 932 | Ga0075366_10166616 | |||
| 933 | Ga0075366_10174630 | |||
| 934 | Ga0075366_10208723 | |||
| 935 | Ga0097621_100032688 | |||
| 936 | Ga0075370_10001906 | |||
| 937 | Ga0075370_10026207 | |||
| 938 | Ga0075370_10097513 | |||
| 939 | Ga0075370_10147990 | |||
| 940 | Ga0075430_100349794 | |||
| 941 | Ga0068865_100027990 | |||
| 942 | Ga0097620_100001283 | |||
| 943 | Ga0097620_100003193 | |||
| 944 | Ga0097620_100470364 | |||
| 945 | Ga0097620_100521135 | |||
| 946 | Ga0099794_10102458 | |||
| 947 | Ga0099795_10000365 | |||
| 948 | Ga0105240_10033580 | |||
| 949 | Ga0105240_10285404 | |||
| 950 | Ga0105240_10347248 | |||
| 951 | Ga0111539_10534465 | |||
| 952 | Ga0105243_10002148 | |||
| 953 | Ga0105243_10004977 | |||
| 954 | Ga0105243_10300929 | |||
| 955 | Ga0105241_10041921 | |||
| 956 | Ga0105248_10015738 | |||
| 957 | Ga0105248_10029339 | |||
| 958 | Ga0105248_10133406 | |||
| 959 | Ga0105237_10006766 | |||
| 960 | Ga0105237_10007760 | |||
| 961 | Ga0105237_10008094 | |||
| 962 | Ga0105237_10023051 | |||
| 963 | Ga0105237_10038836 | |||
| 964 | Ga0105237_10119406 | |||
| 965 | Ga0105237_10515995 | |||
| 966 | Ga0105238_10010968 | |||
| 967 | Ga0105238_10537803 | |||
| 968 | Ga0105249_10003126 | |||
| 969 | Ga0099796_10004703 | |||
| 970 | Ga0105239_10000663 | |||
| 971 | Ga0105239_10004145 | |||
| 972 | Ga0105239_10021983 | |||
| 973 | Ga0105239_10150048 | |||
| 974 | Ga0157370_10008953 | |||
| 975 | Ga0157370_10099698 | |||
| 976 | Ga0157374_10021504 | |||
| 977 | Ga0163162_10009476 | |||
| 978 | Ga0163162_10044850 | |||
| 979 | Ga0163162_10141381 | |||
| 980 | Ga0157372_10139423 | |||
| 981 | Ga0157375_10053711 | |||
| 982 | Ga0182008_10000190 | |||
| 983 | Ga0182008_10000949 | |||
| 984 | Ga0157377_10000036 | |||
| 985 | Ga0157377_10000107 | |||
| 986 | Ga0157379_10002653 | |||
| 987 | Ga0157379_10045551 | |||
| 988 | Ga0157379_10214056 | |||
| 989 | Ga0157376_10652482 | |||
| 990 | Ga0157376_10731186 | |||
| 991 | Ga0182006_1000004 | |||
| 992 | Ga0182007_10000018 | |||
| 993 | Ga0182007_10001150 | |||
| 994 | Ga0182005_1000011 | |||
| 995 | Ga0209436_100005 | |||
| 996 | Ga0209436_100153 | |||
| 997 | Ga0209563_100003 | |||
| 998 | Ga0207425_1000001 | |||
| 999 | Ga0207425_1000033 | |||
| 1000 | Ga0207425_1000430 | |||
| 1001 | Ga0207425_1000883 | |||
| 1002 | Ga0209646_1000106 | |||
| 1003 | Ga0209677_101295 | |||
| 1004 | Ga0209148_1000871 | |||
| 1005 | Ga0209129_1000001 | |||
| 1006 | Ga0209129_1000841 | |||
| 1007 | Ga0209129_1010442 | |||
| 1008 | Ga0209565_1001351 | |||
| 1009 | Ga0209565_1006156 | |||
| 1010 | Ga0209565_1006380 | |||
| 1011 | Ga0209565_1013441 | |||
| 1012 | Ga0209565_1020588 | |||
| 1013 | Ga0207666_1004244 | |||
| 1014 | Ga0209455_1000033 | |||
| 1015 | Ga0209130_1000055 | |||
| 1016 | Ga0209130_1000592 | |||
| 1017 | Ga0209675_1005505 | |||
| 1018 | Ga0209676_1000136 | |||
| 1019 | Ga0209676_1004568 | |||
| 1020 | Ga0209025_1016139 | |||
| 1021 | Ga0209564_1000124 | |||
| 1022 | Ga0209564_1000162 | |||
| 1023 | Ga0209564_1006907 | |||
| 1024 | Ga0209758_1000020 | |||
| 1025 | Ga0209758_1000152 | |||
| 1026 | Ga0209758_1003711 | |||
| 1027 | Ga0209050_1000011 | |||
| 1028 | Ga0209050_1000238 | |||
| 1029 | Ga0209050_1000313 | |||
| 1030 | Ga0209256_1000028 | |||
| 1031 | Ga0209256_1001270 | |||
| 1032 | Ga0209256_1011459 | |||
| 1033 | Ga0209256_1026092 | |||
| 1034 | Ga0207426_1000818 | |||
| 1035 | Ga0209051_1002074 | |||
| 1036 | Ga0209051_1068898 | |||
| 1037 | Ga0209257_1000003 | |||
| 1038 | Ga0209257_1000142 | |||
| 1039 | Ga0209257_1000710 | |||
| 1040 | Ga0209257_1003802 | |||
| 1041 | Ga0209257_1016214 | |||
| 1042 | Ga0207655_1017922 | |||
| 1043 | Ga0207642_10002078 | |||
| 1044 | Ga0207680_10000931 | |||
| 1045 | Ga0207645_10134585 | |||
| 1046 | Ga0207645_10217032 | |||
| 1047 | Ga0207705_10000481 | |||
| 1048 | Ga0207705_10008110 | |||
| 1049 | Ga0207705_10105830 | |||
| 1050 | Ga0207705_10267695 | |||
| 1051 | Ga0207684_10011762 | |||
| 1052 | Ga0207684_10045998 | |||
| 1053 | Ga0207654_10032395 | |||
| 1054 | Ga0207695_10006045 | |||
| 1055 | Ga0207695_10015843 | |||
| 1056 | Ga0207695_10022800 | |||
| 1057 | Ga0207695_10153996 | |||
| 1058 | Ga0207695_10305994 | |||
| 1059 | Ga0207671_10006346 | |||
| 1060 | Ga0207671_10007479 | |||
| 1061 | Ga0207671_10016293 | |||
| 1062 | Ga0207671_10037912 | |||
| 1063 | Ga0207657_10001383 | |||
| 1064 | Ga0207657_10003004 | |||
| 1065 | Ga0207657_10051608 | |||
| 1066 | Ga0207649_10017322 | |||
| 1067 | Ga0207649_10281189 | |||
| 1068 | Ga0207652_10012965 | |||
| 1069 | Ga0207652_10026937 | |||
| 1070 | Ga0207681_10004760 | |||
| 1071 | Ga0207681_10124342 | |||
| 1072 | Ga0207694_10005550 | |||
| 1073 | Ga0207694_10306244 | |||
| 1074 | Ga0207659_10007353 | |||
| 1075 | Ga0207687_10136900 | |||
| 1076 | Ga0207700_10063851 | |||
| 1077 | Ga0207700_10238989 | |||
| 1078 | Ga0207644_10000635 | |||
| 1079 | Ga0207644_10073826 | |||
| 1080 | Ga0207644_10213875 | |||
| 1081 | Ga0207690_10115771 | |||
| 1082 | Ga0207690_10150778 | |||
| 1083 | Ga0207706_10002765 | |||
| 1084 | Ga0207706_10091551 | |||
| 1085 | Ga0207706_10194269 | |||
| 1086 | Ga0207706_10272887 | |||
| 1087 | Ga0207709_10002921 | |||
| 1088 | Ga0207709_10014308 | |||
| 1089 | Ga0207709_10076157 | |||
| 1090 | Ga0207709_10111399 | |||
| 1091 | Ga0207709_10399284 | |||
| 1092 | Ga0207669_10489982 | |||
| 1093 | Ga0207704_10015573 | |||
| 1094 | Ga0207704_10537849 | |||
| 1095 | Ga0207711_10007617 | |||
| 1096 | Ga0207689_10050185 | |||
| 1097 | Ga0207689_10083483 | |||
| 1098 | Ga0207661_10529876 | |||
| 1099 | Ga0207679_10021508 | |||
| 1100 | Ga0207667_10001977 | |||
| 1101 | Ga0207667_10003039 | |||
| 1102 | Ga0207667_10006345 | |||
| 1103 | Ga0207667_10306085 | |||
| 1104 | Ga0207712_10001798 | |||
| 1105 | Ga0207712_10002005 | |||
| 1106 | Ga0207668_10430596 | |||
| 1107 | Ga0207640_10069116 | |||
| 1108 | Ga0207658_10005671 | |||
| 1109 | Ga0207677_10002592 | |||
| 1110 | Ga0207677_10053176 | |||
| 1111 | Ga0207703_10001221 | |||
| 1112 | Ga0207703_10312239 | |||
| 1113 | Ga0207678_10008575 | |||
| 1114 | Ga0207641_10025598 | |||
| 1115 | Ga0207641_10027564 | |||
| 1116 | Ga0207641_10052325 | |||
| 1117 | Ga0207648_10000037 | |||
| 1118 | Ga0207648_10000227 | |||
| 1119 | Ga0207676_10001143 | |||
| 1120 | Ga0207676_10038637 | |||
| 1121 | Ga0207676_10746276 | |||
| 1122 | Ga0207674_10018123 | |||
| 1123 | Ga0207674_10139145 | |||
| 1124 | Ga0207674_10144764 | |||
| 1125 | Ga0207674_10193829 | |||
| 1126 | Ga0207674_10325891 | |||
| 1127 | Ga0207675_100008494 | |||
| 1128 | Ga0207683_10006411 | |||
| 1129 | Ga0207683_10017139 | |||
| 1130 | Ga0207698_10002142 | |||
| 1131 | Ga0209179_1004020 | |||
| 1132 | Ga0209813_10022180 | |||
| 1133 | Ga0209974_10003999 | |||
| 1134 | Ga0209974_10051954 | |||
| 1135 | Ga0268266_10014233 | |||
| 1136 | Ga0268266_10195998 | |||
| 1137 | Ga0268266_10347295 | |||
| 1138 | Ga0268265_10051838 | |||
| 1139 | Ga0268265_10091944 | |||
| 1140 | Ga0268264_10005954 | |||
| 1141 | Ga0265337_1026696 | |||
| 1142 | Ga0307517_10002278 | |||
| 1143 | Ga0307515_10000525 | |||
| 1144 | Ga0307515_10016038 | |||
| 1145 | Ga0307515_10018830 | |||
| 1146 | Ga0307515_10086362 | |||
| 1147 | Ga0307515_10091070 | |||
| 1148 | Ga0307515_10149059 | |||
| 1149 | Ga0307515_10157370 | |||
| 1150 | Ga0316177_1033553 | |||
| 1151 | Ga0316177_1163442 | |||
| 1152 | Ga0316182_1128715 | |||
| 1153 | Ga0265320_10017913 | |||
| 1154 | Ga0265339_10006224 | |||
| 1155 | Ga0265327_10106312 | |||
| 1156 | Ga0307513_10104938 | |||
| 1157 | Ga0307513_10217135 | |||
| 1158 | Ga0307513_10329004 | |||
| 1159 | Ga0307509_10000157 | |||
| 1160 | Ga0307509_10005739 | |||
| 1161 | Ga0307509_10030138 | |||
| 1162 | Ga0307509_10034314 | |||
| 1163 | Ga0307509_10206077 | |||
| 1164 | Ga0307509_10356449 | |||
| 1165 | Ga0307408_100000022 | |||
| 1166 | Ga0307408_100000046 | |||
| 1167 | Ga0307408_100001037 | |||
| 1168 | Ga0307408_100001365 | |||
| 1169 | Ga0307408_100003010 | |||
| 1170 | Ga0307408_100084007 | |||
| 1171 | Ga0307408_100090754 | |||
| 1172 | Ga0307408_100227833 | |||
| 1173 | Ga0307508_10000048 | |||
| 1174 | Ga0307508_10045664 | |||
| 1175 | Ga0307508_10071542 | |||
| 1176 | Ga0307508_10086959 | |||
| 1177 | Ga0307514_10028808 | |||
| 1178 | Ga0307514_10053972 | |||
| 1179 | Ga0265314_10089759 | |||
| 1180 | Ga0307405_10283079 | |||
| 1181 | Ga0307407_10339071 | |||
| 1182 | Ga0307412_10029815 | |||
| 1183 | Ga0307412_10071852 | |||
| 1184 | Ga0307416_100360100 | |||
| 1185 | Ga0307416_100551542 | |||
| 1186 | Ga0307414_10222409 | |||
| 1187 | Ga0307414_10233689 | |||
| 1188 | Ga0307510_10000883 | |||
| 1189 | Ga0307510_10010444 | |||
| 1190 | Ga0373939_0037803 | |||
| 1191 | Ga0373943_0092010 | |||
| 1192 | Ga0373931_0035876 | |||
| 1193 | Ga0373947_0049489 | |||
| 1194 | Ga0373937_0005178 | |||
| 1195 | Ga0373925_0017299 | |||
| 1196 | Ga0373925_0190579 | |||
| 1197 | Ga0373925_0260437 | |||
| 1198 | Ga0395899_0001092 | |||
| 1199 | Ga0395899_0002955 | |||
| 1200 | Ga0395899_0005351 | |||
| 1201 | Ga0395899_0014220 | |||
| 1202 | Ga0395899_0022519 | |||
| 1203 | Ga0395899_0044223 | |||
| 1204 | Ga0395899_0094703 | |||
| 1205 | Ga0395900_0000081 | |||
| 1206 | Ga0395900_0000148 | |||
| 1207 | Ga0395900_0001208 | |||
| 1208 | Ga0395900_0003059 | |||
| 1209 | Ga0395900_0036687 | |||
| 1210 | Ga0395900_0057623 | |||
| 1211 | Ga0395900_0136768 | |||
| 1212 | Ga0395898_0000201 | |||
| 1213 | Ga0395898_0119308 | |||
| 1214 | Ga0395898_0241195 | |||
| 1215 | Ga0395905_0009494 | |||
| 1216 | Ga0395905_0017108 | |||
| 1217 | Ga0395905_0127464 | |||
| 1218 | Ga0395905_0307363 | |||
| 1219 | Ga0436364_0407173 | |||
| 1220 | Ga0395901_0000237 | |||
| 1221 | Ga0395901_0090868 | |||
| 1222 | Ga0395901_0172932 | |||
| 1223 | Ga0395901_0308767 | |||
| 1224 | Ga0436360_0544857 | |||
| 1225 | Ga0436362_0381357 | |||
| 1226 | Ga0439465_0053030 | |||
| 1227 | Ga0451853_2845666 | |||
| 1228 | Ga0439431_0006250 | |||
| 1229 | Ga0439448_0000555 | |||
| 1230 | Ga0439449_0021002 | |||
| 1231 | Ga0450898_006057 | |||
| 1232 | Ga0451577_0051628 | |||
| 1233 | Ga0451577_0094783 | |||
| 1234 | Ga0466969_0000232 | |||
| 1235 | Ga0466969_0006699 | |||
| 1236 | Ga0466969_0014607 | |||
| 1237 | Ga0466969_0035390 | |||
| 1238 | Ga0466972_0000383 | |||
| 1239 | Ga0466972_0000568 | |||
| 1240 | Ga0466972_0006200 | |||
| 1241 | Ga0466972_0036061 | |||
| 1242 | Ga0466965_0000082 | |||
| 1243 | Ga0466965_0001230 | |||
| 1244 | Ga0466965_0005218 | |||
| 1245 | Ga0466965_0085184 | |||
| 1246 | Ga0466966_0000428 | |||
| 1247 | Ga0466966_0002106 | |||
| 1248 | Ga0466966_0004513 | |||
| 1249 | Ga0466966_0005887 | |||
| 1250 | Ga0466966_0009166 | |||
| 1251 | Ga0466966_0023505 | |||
| 1252 | Ga0466966_0032955 | |||
| 1253 | Ga0466966_0072487 | |||
| 1254 | Ga0466966_0254042 | |||
| 1255 | Ga0466961_0000229 | |||
| 1256 | Ga0466961_0006081 | |||
| 1257 | Ga0466961_0019174 | |||
| 1258 | Ga0466961_0151018 | |||
| 1259 | Ga0466961_0203342 | |||
| 1260 | Ga0466963_0005033 | |||
| 1261 | Ga0466963_0069977 | |||
| 1262 | Ga0466964_0000492 | |||
| 1263 | Ga0466964_0002109 | |||
| 1264 | Ga0466964_0013400 | |||
| 1265 | Ga0466971_0035615 | |||
| 1266 | Ga0466968_0000879 | |||
| 1267 | Ga0466968_0013820 | |||
| 1268 | Ga0466970_0008945 | |||
| 1269 | Ga0466970_0040109 | |||
| 1270 | Ga0466970_0054294 | |||
| 1271 | Ga0466970_0087732 | |||
| 1272 | Ga0466957_0000337 | |||
| 1273 | Ga0466957_0005060 | |||
| 1274 | Ga0466957_0010664 | |||
| 1275 | Ga0466960_0061170 | |||
| 1276 | Ga0466959_0013955 | |||
| 1277 | Ga0466959_0018046 | |||
| 1278 | Ga0466959_0076778 | |||
| 1279 | Ga0466959_0113022 | |||
| 1280 | Ga0451576_0089607 | |||
| 1281 | Ga0466958_0005517 | |||
| 1282 | Ga0466958_0021614 | |||
| 1283 | Ga0466958_0148404 | |||
| 1284 | Ga0466967_0693098 | |||
| 1285 | Ga0495592_0000058 | |||
| 1286 | Ga0495590_0000016 | |||
| 1287 | Ga0495590_0044047 | |||
| 1288 | Ga0495638_0000057 | |||
| 1289 | Ga0495653_0003297 | |||
| 1290 | Ga0495650_0002031 | |||
| 1291 | Ga0495580_0019602 | |||
| 1292 | Ga0495580_0242368 | |||
| 1293 | Ga0495605_0000684 | |||
| 1294 | Ga0495605_0003913 | |||
| 1295 | Ga0495605_0064763 | |||
| 1296 | Ga0495639_0009356 | |||
| 1297 | Ga0495584_0000915 | |||
| 1298 | Ga0495584_0002336 | |||
| 1299 | Ga0495584_0003323 | |||
| 1300 | Ga0495584_0011193 | |||
| 1301 | Ga0495585_0000005 | |||
| 1302 | Ga0495585_0000162 | |||
| 1303 | Ga0495585_0007241 | |||
| 1304 | Ga0495585_0009385 | |||
| 1305 | Ga0495585_0036768 | |||
| 1306 | Ga0495585_0041772 | |||
| 1307 | Ga0495585_0071056 | |||
| 1308 | Ga0495585_0130399 | |||
| 1309 | Ga0495596_0000013 | |||
| 1310 | Ga0495596_0000833 | |||
| 1311 | Ga0495596_0000901 | |||
| 1312 | Ga0495596_0003244 | |||
| 1313 | Ga0495607_0000316 | |||
| 1314 | Ga0495607_0001702 | |||
| 1315 | Ga0495607_0003182 | |||
| 1316 | Ga0495607_0003268 | |||
| 1317 | Ga0495607_0021859 | |||
| 1318 | Ga0495583_0000189 | |||
| 1319 | Ga0495583_0000655 | |||
| 1320 | Ga0495583_0000688 | |||
| 1321 | Ga0495583_0002721 | |||
| 1322 | Ga0495583_0013411 | |||
| 1323 | Ga0495583_0041851 | |||
| 1324 | Ga0495583_0090147 | |||
| 1325 | Ga0495606_0000070 | |||
| 1326 | Ga0495606_0003081 | |||
| 1327 | Ga0495606_0052909 | |||
| 1328 | Ga0495606_0054698 | |||
| 1329 | Ga0495606_0229514 | |||
| 1330 | Ga0495610_0004252 | |||
| 1331 | Ga0495610_0026614 | |||
| 1332 | Ga0495616_0000646 | |||
| 1333 | Ga0495616_0000799 | |||
| 1334 | Ga0495616_0001668 | |||
| 1335 | Ga0495616_0019559 | |||
| 1336 | Ga0495616_0040554 | |||
| 1337 | Ga0495616_0046894 | |||
| 1338 | Ga0495616_0084619 | |||
| 1339 | Ga0495620_0001634 | |||
| 1340 | Ga0495628_0000109 | |||
| 1341 | Ga0495631_0004026 | |||
| 1342 | Ga0495631_0010136 | |||
| 1343 | Ga0495631_0028238 | |||
| 1344 | Ga0495631_0039780 | |||
| 1345 | Ga0495632_0000118 | |||
| 1346 | Ga0495632_0000321 | |||
| 1347 | Ga0495632_0001878 | |||
| 1348 | Ga0495632_0006806 | |||
| 1349 | Ga0495632_0014187 | |||
| 1350 | Ga0495632_0038404 | |||
| 1351 | Ga0495637_0023384 | |||
| 1352 | Ga0495637_0075744 | |||
| 1353 | Ga0495643_0000236 | |||
| 1354 | Ga0495643_0002480 | |||
| 1355 | Ga0495643_0050575 | |||
| 1356 | Ga0495643_0066689 | |||
| 1357 | Ga0495644_0001385 | |||
| 1358 | Ga0495644_0027680 | |||
| 1359 | Ga0495648_0000002 | |||
| 1360 | Ga0495648_0000033 | |||
| 1361 | Ga0495648_0007546 | |||
| 1362 | Ga0495648_0043992 | |||
| 1363 | Ga0495663_0001760 | |||
| 1364 | Ga0495663_0067745 | |||
| 1365 | Ga0495642_0000673 | |||
| 1366 | Ga0495642_0005081 | |||
| 1367 | Ga0495642_0008493 | |||
| 1368 | Ga0495652_0082260 | |||
| 1369 | Ga0495652_0123081 | |||
| 1370 | Ga0495654_0014733 | |||
| 1371 | Ga0495654_0050233 | |||
| 1372 | Ga0495640_0140977 | |||
| 1373 | Ga0495609_0000001 | |||
| 1374 | Ga0495609_0000084 | |||
| 1375 | Ga0495609_0059233 | |||
| 1376 | Ga0495621_0008835 | |||
| 1377 | Ga0495597_0000028 | |||
| 1378 | Ga0495597_0000080 | |||
| 1379 | Ga0495597_0005046 | |||
| 1380 | Ga0495597_0021109 | |||
| 1381 | Ga0495597_0023629 | |||
| 1382 | Ga0495597_0036901 | |||
| 1383 | Ga0495645_0096352 | |||
| 1384 | Ga0495622_0000483 | |||
| 1385 | Ga0495622_0029884 | |||
| 1386 | Ga0495633_0000204 | |||
| 1387 | Ga0495633_0000399 | |||
| 1388 | Ga0495633_0009652 | |||
| 1389 | Ga0495633_0019359 | |||
| 1390 | Ga0495633_0052919 | |||
| 1391 | Ga0495656_0007073 | |||
| 1392 | Ga0495656_0028866 | |||
| 1393 | Ga0495656_0075010 | |||
| 1394 | Ga0495668_0000006 | |||
| 1395 | Ga0495668_0000132 | |||
| 1396 | Ga0495668_0003093 | |||
| 1397 | Ga0495668_0009077 | |||
| 1398 | Ga0495668_0010419 | |||
| 1399 | Ga0495668_0013502 | |||
| 1400 | Ga0495668_0064593 | |||
| 1401 | Ga0495611_0001712 | |||
| 1402 | Ga0495611_0010146 | |||
| 1403 | Ga0495611_0016943 | |||
| 1404 | Ga0495625_0000143 | |||
| 1405 | Ga0495625_0000177 | |||
| 1406 | Ga0495625_0001203 | |||
| 1407 | Ga0495625_0010429 | |||
| 1408 | Ga0495625_0042302 | |||
| 1409 | Ga0495625_0065650 | |||
| 1410 | Ga0495625_0134454 | |||
| 1411 | Ga0495659_0000185 | |||
| 1412 | Ga0495659_0024668 | |||
| 1413 | Ga0495661_0000053 | |||
| 1414 | Ga0495661_0000170 | |||
| 1415 | Ga0495661_0006188 | |||
| 1416 | Ga0495661_0010366 | |||
| 1417 | Ga0495661_0011327 | |||
| 1418 | Ga0495661_0037821 | |||
| 1419 | Ga0495661_0079702 | |||
| 1420 | Ga0495661_0105990 | |||
| 1421 | Ga0495588_0000062 | |||
| 1422 | Ga0495588_0051070 | |||
| 1423 | Ga0495599_0069794 | |||
| 1424 | Ga0495669_0001281 | |||
| 1425 | Ga0495669_0005080 | |||
| 1426 | Ga0495624_0018331 | |||
| 1427 | Ga0495624_0071891 | |||
| 1428 | Ga0495670_0001661 | |||
| 1429 | Ga0495670_0002325 | |||
| 1430 | Ga0495670_0013246 | |||
| 1431 | Ga0495671_0000088 | |||
| 1432 | Ga0495671_0009586 | |||
| 1433 | Ga0495671_0084406 | |||
| 1434 | Ga0495649_0001312 | |||
| 1435 | Ga0495649_0012827 | |||
| 1436 | Ga0495649_0039555 | |||
| 1437 | Ga0495649_0213616 | |||
| 1438 | Ga0495589_0000103 | |||
| 1439 | Ga0495589_0001144 | |||
| 1440 | Ga0495589_0024179 | |||
| 1441 | Ga0495589_0024226 | |||
| 1442 | Ga0495589_0040034 | |||
| 1443 | Ga0495660_0000057 | |||
| 1444 | Ga0495660_0000208 | |||
| 1445 | Ga0495660_0001806 | |||
| 1446 | Ga0495660_0024071 | |||
| 1447 | Ga0495660_0048056 | |||
| 1448 | Ga0495660_0093189 | |||
| 1449 | Ga0495636_0000716 | |||
| 1450 | Ga0495636_0028191 | |||
| 1451 | Ga0495672_0000132 | |||
| 1452 | Ga0495672_0000262 | |||
| 1453 | Ga0495672_0029883 | |||
| 1454 | Ga0495680_0011827 | |||
| 1455 | Ga0495683_0000072 | |||
| 1456 | Ga0495683_0007433 | |||
| 1457 | Ga0495683_0033348 | |||
| 1458 | Ga0495683_0039010 | |||
| 1459 | Ga0495687_000019 | |||
| 1460 | Ga0495687_000722 | |||
| 1461 | Ga0495687_000740 | |||
| 1462 | Ga0495687_001604 | |||
| 1463 | Ga0495687_003773 | |||
| 1464 | Ga0495687_020008 | |||
| 1465 | Ga0495677_0000009 | |||
| 1466 | Ga0495677_0000217 | |||
| 1467 | Ga0495677_0000873 | |||
| 1468 | Ga0495677_0001907 | |||
| 1469 | Ga0495677_0002104 | |||
| 1470 | Ga0495677_0002684 | |||
| 1471 | Ga0495677_0003892 | |||
| 1472 | Ga0495677_0004159 | |||
| 1473 | Ga0495677_0005946 | |||
| 1474 | Ga0495677_0008922 | |||
| 1475 | Ga0495679_005033 | |||
| 1476 | Ga0495681_0000907 | |||
| 1477 | Ga0495681_0002551 | |||
| 1478 | Ga0495681_0007002 | |||
| 1479 | Ga0495681_0008872 | |||
| 1480 | Ga0495681_0037694 | |||
| 1481 | Ga0495681_0043194 | |||
| 1482 | Ga0495686_0000627 | |||
| 1483 | Ga0495686_0003319 | |||
| 1484 | Ga0495686_0038635 | |||
| 1485 | Ga0495686_0121925 | |||
| 1486 | Ga0495686_0181227 | |||
| 1487 | Ga0495602_0050698 | |||
| 1488 | Ga0495615_0000170 | |||
| 1489 | Ga0495626_0000011 | |||
| 1490 | Ga0495626_0000290 | |||
| 1491 | Ga0495626_0011297 | |||
| 1492 | Ga0495626_0011964 | |||
| 1493 | Ga0495626_0020550 | |||
| 1494 | Ga0495626_0094246 | |||
| 1495 | Ga0496101_0138280 | |||
| 1496 | Ga0496101_0156154 | |||
| 1497 | Ga0496102_0060133 | |||
| 1498 | Ga0496102_0244086 | |||
| 1499 | Ga0496103_0049655 | |||
| 1500 | Ga0496104_0073802 | |||
| 1501 | Ga0496106_0012017 | |||
| 1502 | Ga0496106_0061377 | |||
| 1503 | Ga0496107_0037314 | |||
| 1504 | Ga0496107_0040886 | |||
| 1505 | Ga0496108_0607873 | |||
| 1506 | Ga0496111_0016619 | |||
| 1507 | Ga0496113_0014394 | |||
| 1508 | Ga0496114_0214596 | |||
| 1509 | Ga0496114_0355574 | |||
| 1510 | Ga0496116_0031617 | |||
| 1511 | Ga0496116_0048918 | |||
| 1512 | Ga0496117_0000011 | |||
| 1513 | Ga0496118_0000010 | |||
| 1514 | Ga0496118_0076880 | |||
| 1515 | Ga0496119_0002111 | |||
| 1516 | Ga0496119_0011802 | |||
| 1517 | Ga0496119_0012354 | |||
| 1518 | Ga0496120_0025916 | |||
| 1519 | Ga0496120_0106982 | |||
| 1520 | Ga0496121_0000490 | |||
| 1521 | Ga0496121_0002266 | |||
| 1522 | Ga0496121_0004661 | |||
| 1523 | Ga0496121_0088627 | |||
| 1524 | Ga0496122_0000821 | |||
| 1525 | Ga0496122_0001042 | |||
| 1526 | Ga0496122_0005095 | |||
| 1527 | Ga0496122_0023924 | |||
| 1528 | Ga0496122_0069721 | |||
| 1529 | Ga0496123_0000872 | |||
| 1530 | Ga0496123_0001273 | |||
| 1531 | Ga0496123_0003879 | |||
| 1532 | Ga0496123_0030777 | |||
| 1533 | Ga0496123_0057754 | |||
| 1534 | Ga0496124_0017647 | |||
| 1535 | Ga0496124_0018875 | |||
| 1536 | Ga0496124_0233659 | |||
| 1537 | Ga0496125_0000884 | |||
| 1538 | Ga0496125_0034167 | |||
| 1539 | Ga0496125_0046007 | |||
| 1540 | Ga0496125_0116580 | |||
| 1541 | Ga0496125_0148245 | |||
| 1542 | Ga0496126_0001786 | |||
| 1543 | Ga0496126_0043152 | |||
| 1544 | Ga0496126_0088424 | |||
| 1545 | Ga0495678_007026 | |||
| 1546 | Ga0495678_053681 | |||
| 1547 | Ga0495678_070702 | |||
| 1548 | Ga0495682_0003951 | |||
| 1549 | Ga0495682_0016442 | |||
| 1550 | Ga0501292_003979 | |||
| 1551 | Ga0501033_0000186 | |||
| 1552 | Ga0501033_0029154 | |||
| 1553 | Ga0501037_0269359 | |||
| 1554 | Ga0501047_0008047 | |||
| 1555 | Ga0501067_0221256 | |||
| 1556 | Ga0501076_0215169 | |||
| 1557 | Ga0501079_0103835 | |||
| 1558 | Ga0501269_000203 | |||
| 1559 | Ga0501035_0000292 | |||
| 1560 | Ga0501035_0001063 | |||
| 1561 | Ga0501035_0028835 | |||
| 1562 | Ga0501044_0005038 | |||
| 1563 | Ga0501044_0118140 | |||
| 1564 | Ga0501044_0171576 | |||
| 1565 | nmdc:mga0k408_1383_c1 | |||
| 1566 | nmdc:mga0k408_189728_c1 | |||
| 1567 | nmdc:mga0k408_34927_c1 | |||
| 1568 | nmdc:mga0k408_48393_c1 | |||
| 1569 | nmdc:mga0k408_53133_c1 | |||
| 1570 | nmdc:mga0k408_6516_c1 | |||
| 1571 | nmdc:mga06z11_52034_c1 | |||
| 1572 | nmdc:mga06z11_8396_c1 | |||
| 1573 | nmdc:mga07m45_100192_c1 | |||
| 1574 | nmdc:mga07m45_3676_c1 | |||
| 1575 | nmdc:mga07m45_4791_c2 | |||
| 1576 | nmdc:mga07m45_6783_c1 | |||
| 1577 | nmdc:mga07m45_88556_c1 | |||
| 1578 | nmdc:mga0sz30_4699_c1 | |||
| 1579 | nmdc:mga0sz30_5171_c1 | |||
| 1580 | Ga0500578_0000028 | |||
| 1581 | Ga0500572_000038 | |||
| 1582 | Ga0500658_0013184 | |||
| 1583 | Ga0500559_0000326 | |||
| 1584 | Ga0500559_0002516 | |||
| 1585 | Ga0500568_0011765 | |||
| 1586 | Ga0500590_024655 | |||
| 1587 | Ga0500622_0003342 | |||
| 1588 | Ga0500645_006464 | |||
| 1589 | Ga0466962_0017319 | |||
| 1590 | Ga0466962_0019076 | |||
| 1591 | Ga0466962_0046904 | |||
| 1592 | Ga0466962_0093047 | |||
| 1593 | 2887376945 | |||
| 1594 | 2521557198 | |||
| 1595 | 2524441154 | |||
| 1596 | 2585395586 | |||
| 1597 | 2588291951 | |||
| 1598 | 2599907671 | |||
| 1599 | 2600225879 | |||
| 1600 | 2601669511 | |||
| 1601 | 2643791702 | |||
| 1602 | 2643798796 | |||
| 1603 | 2643858729 | |||
| 1604 | 2643935169 | |||
| 1605 | 2643982111 | |||
| 1606 | 2644120501 | |||
| 1607 | 2644253122 | |||
| 1608 | 2644303811 | |||
| 1609 | 2644314933 | |||
| 1610 | 2644354982 | |||
| 1611 | 2644471109 | |||
| 1612 | 2738741760 | |||
| 1613 | 2738843920 | |||
| 1614 | 2739274519 | |||
| 1615 | 2739343563 | |||
| 1616 | 2808855184 | |||
| 1617 | 2808922906 | |||
| 1618 | 2808935240 | |||
| 1619 | 2808945219 | |||
| 1620 | 2808963689 | |||
| 1621 | 2808998577 | |||
| 1622 | 2809034215 | |||
| 1623 | 2842712542 | |||
| 1624 | 2857506541 | |||
| 1625 | 2857540163 | |||
| 1626 | 2858954130 | |||
| 1627 | 2904430445 | |||
| 1628 | 2919128191 | |||
| 1629 | 2928529346 | |||
| 1630 | 2932414780 | |||
| 1631 | 2932420700 | |||
| 1632 | 2941480008 | |||
| 1633 | 2974323399 | |||
| 1634 | 8002870213 | |||
| 1635 | 8019775346 | |||
| 1636 | 8047678355 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gst-assembly2.cif.gz_D | crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) | 0.9689 | 1 | 280 |
| 8gst-assembly2.cif.gz_D | crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) | 0.9553 | 1 | 280 |
| 6fog-assembly4.cif.gz_D | x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. | 0.9443 | 71 | 280 |
| 6sbi-assembly2.cif.gz_C | x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate | 0.9292 | 71 | 279 |
| 1wzo-assembly1.cif.gz_C | crystal structure of the hpce from thermus thermophilus hb8 | 0.9291 | 1 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9788 | 68 | 280 | 3.90.850.10 |
| af_A0A1D8PI10_75_291_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9767 | 69 | 277 | 3.90.850.10 |
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.965 | 68 | 280 | 3.90.850.10 |
| af_Q96GK7_51_314_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9625 | 27 | 277 | 3.90.850.10 |
| af_Q2FZT4_90_300_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9613 | 70 | 277 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V1SP07-F1-model_v4 | FAA hydrolase family protein | 0.9942 | 75 | 280 |
GO:0016787
GO:0044281 |
| AF-A0A7C7BQ93-F1-model_v4 | deleted | 0.994 | 102 | 279 |
|
| AF-A0A6J5CQM4-F1-model_v4 | 2-keto-4-pentenoate hydratase (EC 4.2.1.80) | 0.9939 | 1 | 280 |
GO:0008684
GO:0044281 |
| AF-A0A0Q4TVS1-F1-model_v4 | 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase | 0.9938 | 1 | 278 |
GO:0016853
GO:0044281 |
| AF-A0A1M5XN10-F1-model_v4 | 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) | 0.9935 | 1 | 280 |
GO:0003824
GO:0044281 |