F482172

General Info

Members Datasets Scaffolds Average Seq Length
819 454 1638 588

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10010424|Ga0207639_100104243
Length 650
Sequence VVLATNVFGGGAIRLPEVAGLTSSCAKGCLAHSNSKPDTTEESITICGIAGEIGRDRPADLAAVAAMTNCMVPRGPDGAGAWADRSVALGHRRLAIIDLSSSGHQPMHDPDLGLTVAFNGCIYNYPELRQQLLGKGYRFFSHSDTEVILKGYREWGERVVDHLKGMFAFAVAERDTGRVVLARDRLGVKPLYWCDVSDGDGAGAMRFASSLPALVAAGGVDTDLDPVALSHYLSFHSVVPAPRTILRGVRKLEPGTIMRVEPDGTRTQETYWEPVLERSQERAGWAEQDWEEAILASLRTAVERRLVADVPVGCLLSGGLDSSLIVGLLAEAGQHGLKTFSIGFEAAGGEEGDEFKYSDVIARHFGTDHHQIRIDTARMLPALSGAIGAMSEPMMSHDCVAFYLLSQEVSKHVKVVQSGQGADEIFAGYHWYPPMAHAGDDDPRAALSQYRKAFFDRDHEALNRLLQPRWRLDADVAGDYVLEHFSHPGAATATDRALRLDTTVMLVDDPVKRVDNMTMAWGLEGRVPFLDHELVELAATCPPELKTAYEGKGVLKEAARKVIPHEVIDRPKGYFPVPALKHLAGPYLELVNDALHGSAARDRGLFAKDAVDGLLADPNGSLTPLRGNPLWQIGLLELWLARHVDGVKSS

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
155 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
164 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
189 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
190 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
191 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
192 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
193 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
194 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
195 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
211 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
212 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
310 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
311 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
316 2508501039 Frankia saprophytica CN3 Isolate Nodule
317 2511231024 Pseudomonas sp. GM84 Isolate Nodule
318 2517572101 Frankia sp. DC12 Isolate Nodule
319 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
320 2527291627 Frankia casuarinae Thr Isolate Nodule
321 2527291629 Frankia sp. BMG5.23 Isolate Nodule
322 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
323 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
324 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
325 2576861822 Frankia sp. CeD Isolate Nodule
326 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
327 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
328 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
329 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
330 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
331 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
332 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
333 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
334 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
335 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
336 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
337 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
338 2619618881 Frankia sp. ACN1ag Isolate Unclassified
339 2619619003 Frankia sp. CpI1-P Isolate Nodule
340 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
341 2626541554 Frankia sp. AvcI.1 Isolate Nodule
342 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
343 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
344 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
345 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
346 2643221714 Streptomyces sp. Root264 Isolate Unclassified
347 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
348 2671180195 Frankia sp. CcI49 Isolate Nodule
349 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
350 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
351 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
352 2684623036 Frankia sp. CgIM4 Isolate Nodule
353 2687453737 Frankia sp. BMG5.36 Isolate Nodule
354 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
355 2710264753 Frankia sp. KB5 Isolate Nodule
356 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
357 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
358 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
359 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
360 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
361 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
362 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
363 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
364 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
365 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
366 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
367 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
368 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
369 2773857922 Frankia sp. CcI49 Isolate Nodule
370 2773857924 Frankia sp. CgIS1 Isolate Nodule
371 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
372 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
373 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
374 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
375 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
376 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
377 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
378 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
379 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
380 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
381 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
382 2842694124 Methylopila sp. R-72369 Isolate Unclassified
383 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
384 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
385 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
386 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
387 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
388 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
389 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
390 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
391 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
392 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
393 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
394 2858882152 Micromonospora noduli MED15 Isolate Nodule
395 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
396 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
397 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
398 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
399 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
400 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
401 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
402 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
403 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
404 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
405 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
406 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
407 2891562705 Microbispora tritici MT50 Isolate Unclassified
408 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
409 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
410 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
411 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
412 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
413 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
414 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
415 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
416 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
417 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
418 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
419 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
420 2920879853 Kocuria salina CV6 Isolate Unclassified
421 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
422 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
423 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
424 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
425 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
426 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
427 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
428 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
429 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
430 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
431 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
432 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
433 637000116 Frankia casuarinae CcI3 Isolate Nodule
434 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
435 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
436 8002775197 Frankia nepalensis CN7 Isolate Nodule
437 8002784119 Frankia sp. AgB1.9 Isolate Nodule
438 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
439 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
440 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
441 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
442 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
443 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
444 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
445 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
446 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
447 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
448 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
449 8054920844 Frankia tisae Agncl-8 Isolate Nodule
450 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
451 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
452 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
453 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
454 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.78
Metatranscriptomes 0.12
Isolates 17.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 7.2
Nodule 4.03
Rhizoplane 7.94
Rhizosphere 57.75
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10010424 3300026041 Bacteria 6437
2 rootH2_10015241 3300003320 Bacteria 50279
3 Ga0055538_1000079 3300003751 Bacteria 85355
4 Ga0055539_1000120 3300003752 Bacteria 85355
5 Ga0055533_1000128 3300003756 Bacteria 85355
6 Ga0055532_1000116 3300003758 Bacteria 85351
7 Ga0055525_1000165 3300003759 Bacteria 85355
8 Ga0055540_1000024 3300003792 Bacteria 199164
9 Ga0055540_1002431 3300003792 Bacteria 9835
10 Ga0055540_1004520 3300003792 Bacteria 6222
11 Ga0055540_1007661 3300003792 Bacteria 4027
12 Ga0055541_1000080 3300003841 Bacteria 85355
13 Ga0065714_10002472 3300005288 Bacteria 23443
14 Ga0070658_10035015 3300005327 Bacteria 4042
15 Ga0070676_10017874 3300005328 Bacteria 3926
16 Ga0070683_100172717 3300005329 Bacteria 2052
17 Ga0070670_100000045 3300005331 Bacteria 140180
18 Ga0070670_100148774 3300005331 Bacteria 2026
19 Ga0070682_100007253 3300005337 Bacteria 6248
20 Ga0070682_100067347 3300005337 Bacteria 2280
21 Ga0070687_100030946 3300005343 Bacteria 2620
22 Ga0070661_100006754 3300005344 Bacteria 7909
23 Ga0070692_10048048 3300005345 Bacteria 2210
24 Ga0070668_100000449 3300005347 Bacteria 27220
25 Ga0070668_100001342 3300005347 Bacteria 17578
26 Ga0070668_100019915 3300005347 Bacteria 5056
27 Ga0070668_100028001 3300005347 Bacteria 4277
28 Ga0070668_100084310 3300005347 Bacteria 2496
29 Ga0070669_100025937 3300005353 Bacteria 4214
30 Ga0070671_100003104 3300005355 Bacteria 12936
31 Ga0070671_100028821 3300005355 Bacteria 4576
32 Ga0070671_100044515 3300005355 Bacteria 3689
33 Ga0070674_100001298 3300005356 Bacteria 13129
34 Ga0070674_100024358 3300005356 Bacteria 3927
35 Ga0070659_100035434 3300005366 Bacteria 3886
36 Ga0070659_100087211 3300005366 Bacteria 2498
37 Ga0070667_100000063 3300005367 Bacteria 138777
38 Ga0070667_100039611 3300005367 Bacteria 3950
39 Ga0070667_100116471 3300005367 Bacteria 2321
40 Ga0070714_100006996 3300005435 Bacteria 8746
41 Ga0070714_100033136 3300005435 Bacteria 4317
42 Ga0070711_100002490 3300005439 Bacteria 10513
43 Ga0070705_100009653 3300005440 Bacteria 4805
44 Ga0070700_100009255 3300005441 Bacteria 5401
45 Ga0070663_100005931 3300005455 Bacteria 7311
46 Ga0070663_100092463 3300005455 Bacteria 2243
47 Ga0070678_100001418 3300005456 Bacteria 12751
48 Ga0070662_100048435 3300005457 Bacteria 3061
49 Ga0070662_100066836 3300005457 Bacteria 2639
50 Ga0068867_100005596 3300005459 Bacteria 8903
51 Ga0070685_10009916 3300005466 Bacteria 4939
52 Ga0068853_100000144 3300005539 Bacteria 48463
53 Ga0068853_100014791 3300005539 Bacteria 6404
54 Ga0070665_100000979 3300005548 Bacteria 36153
55 Ga0070665_100008785 3300005548 Bacteria 10223
56 Ga0070665_100012648 3300005548 Bacteria 8499
57 Ga0070665_100017721 3300005548 Bacteria 7152
58 Ga0070664_100009176 3300005564 Bacteria 8030
59 Ga0068854_100021764 3300005578 Bacteria 4356
60 Ga0068854_100037486 3300005578 Bacteria 3404
61 Ga0070702_100014451 3300005615 Bacteria 4005
62 Ga0068859_100000184 3300005617 Bacteria 61340
63 Ga0068859_100001979 3300005617 Bacteria 20907
64 Ga0068859_100006882 3300005617 Bacteria 11541
65 Ga0068859_100012750 3300005617 Bacteria 8448
66 Ga0068859_100102861 3300005617 Bacteria 2914
67 Ga0068866_10001173 3300005718 Bacteria 11464
68 Ga0068866_10021990 3300005718 Bacteria 2945
69 Ga0068851_10000040 3300005834 Bacteria 93172
70 Ga0068863_100000159 3300005841 Bacteria 71831
71 Ga0068863_100000739 3300005841 Bacteria 32639
72 Ga0068863_100008258 3300005841 Bacteria 10172
73 Ga0068863_100009338 3300005841 Bacteria 9571
74 Ga0068858_100000141 3300005842 Bacteria 76388
75 Ga0068858_100010221 3300005842 Bacteria 8905
76 Ga0068858_100031984 3300005842 Bacteria 4888
77 Ga0068860_100000065 3300005843 Bacteria 186634
78 Ga0068860_100014977 3300005843 Bacteria 7579
79 Ga0068862_100000028 3300005844 Bacteria 184197
80 Ga0068862_100000496 3300005844 Bacteria 41859
81 Ga0068862_100021504 3300005844 Bacteria 5391
82 Ga0081455_10052913 3300005937 Bacteria 3472
83 Ga0081540_1021753 3300005983 Bacteria 3808
84 Ga0081539_10000889 3300005985 Bacteria 57153
85 Ga0081539_10003849 3300005985 Bacteria 17594
86 Ga0081539_10005545 3300005985 Bacteria 12794
87 Ga0081539_10008604 3300005985 Bacteria 8816
88 Ga0075365_10003226 3300006038 Bacteria 8347
89 Ga0075365_10004832 3300006038 Bacteria 7190
90 Ga0075368_10003971 3300006042 Bacteria 4980
91 Ga0075368_10006832 3300006042 Bacteria 4008
92 Ga0075363_100001644 3300006048 Bacteria 8631
93 Ga0075363_100007787 3300006048 Bacteria 4950
94 Ga0075364_10004962 3300006051 Bacteria 7712
95 Ga0075364_10005195 3300006051 Bacteria 7552
96 Ga0075364_10018758 3300006051 Bacteria 4337
97 Ga0075364_10028339 3300006051 Bacteria 3584
98 Ga0070712_100005495 3300006175 Bacteria 7847
99 Ga0075367_10006245 3300006178 Bacteria 6003
100 Ga0075369_10000241 3300006186 Bacteria 16255
101 Ga0075369_10002872 3300006186 Bacteria 6212
102 Ga0075369_10026792 3300006186 Bacteria 2405
103 Ga0097621_100130240 3300006237 Bacteria 2141
104 Ga0075370_10013757 3300006353 Bacteria 4306
105 Ga0075370_10049387 3300006353 Bacteria 2385
106 Ga0068871_100075218 3300006358 Bacteria 2788
107 Ga0075428_100003910 3300006844 Bacteria 16373
108 Ga0075430_100040168 3300006846 Bacteria 3960
109 Ga0075430_100079384 3300006846 Bacteria 2750
110 Ga0068865_100000662 3300006881 Bacteria 19431
111 Ga0097620_100000184 3300006931 Bacteria 61340
112 Ga0097620_100001979 3300006931 Bacteria 20907
113 Ga0097620_100006882 3300006931 Bacteria 11541
114 Ga0097620_100012750 3300006931 Bacteria 8448
115 Ga0097620_100102859 3300006931 Bacteria 2914
116 Ga0105251_10001487 3300009011 Bacteria 20109
117 Ga0105244_10005906 3300009036 Bacteria 8036
118 Ga0105250_10000381 3300009092 Bacteria 33174
119 Ga0105240_10115972 3300009093 Bacteria 3232
120 Ga0111539_10001058 3300009094 Bacteria 36236
121 Ga0105245_10006009 3300009098 Bacteria 10671
122 Ga0105247_10000232 3300009101 Bacteria 53113
123 Ga0105247_10000606 3300009101 Bacteria 29002
124 Ga0105247_10000653 3300009101 Bacteria 27504
125 Ga0105247_10003188 3300009101 Bacteria 10809
126 Ga0114129_10028015 3300009147 Bacteria 7979
127 Ga0105243_10000916 3300009148 Bacteria 27666
128 Ga0105242_10000321 3300009176 Bacteria 38554
129 Ga0105248_10000074 3300009177 Bacteria 114554
130 Ga0105248_10000812 3300009177 Bacteria 35031
131 Ga0105248_10002879 3300009177 Bacteria 19095
132 Ga0105248_10022807 3300009177 Bacteria 6949
133 Ga0105237_10001244 3300009545 Bacteria 33989
134 Ga0105237_10015275 3300009545 Bacteria 7997
135 Ga0105237_10033771 3300009545 Bacteria 5183
136 Ga0105238_10033151 3300009551 Bacteria 5255
137 Ga0105249_10000011 3300009553 Bacteria 292812
138 Ga0105249_10087755 3300009553 Bacteria 2903
139 Ga0105239_10027928 3300010375 Bacteria 6208
140 Ga0105239_10030661 3300010375 Bacteria 5915
141 Ga0105239_10088169 3300010375 Bacteria 3421
142 Ga0105246_10000513 3300011119 Bacteria 21097
143 Ga0105246_10013913 3300011119 Bacteria 5051
144 Ga0157373_10001051 3300013100 Bacteria 21283
145 Ga0157373_10004203 3300013100 Bacteria 10860
146 Ga0157373_10015031 3300013100 Bacteria 5662
147 Ga0157371_10001356 3300013102 Bacteria 25744
148 Ga0157371_10094442 3300013102 Bacteria 2119
149 Ga0157370_10000649 3300013104 Bacteria 43350
150 Ga0157370_10070452 3300013104 Bacteria 3300
151 Ga0157370_10156697 3300013104 Bacteria 2119
152 Ga0157369_10008322 3300013105 Bacteria 11889
153 Ga0157369_10009567 3300013105 Bacteria 11087
154 Ga0157378_10005790 3300013297 Bacteria 10830
155 Ga0157372_10078811 3300013307 Bacteria 3723
156 Ga0157372_10131802 3300013307 Bacteria 2876
157 Ga0157375_10000539 3300013308 Bacteria 33984
158 Ga0157375_10006212 3300013308 Bacteria 10403
159 Ga0163163_10000528 3300014325 Bacteria 34012
160 Ga0163163_10034600 3300014325 Bacteria 4895
161 Ga0157380_10004453 3300014326 Bacteria 9700
162 Ga0182008_10005229 3300014497 Bacteria 7432
163 Ga0157379_10000730 3300014968 Bacteria 26590
164 Ga0157379_10018275 3300014968 Bacteria 6179
165 Ga0157379_10078828 3300014968 Bacteria 2950
166 Ga0157376_10050752 3300014969 Bacteria 3443
167 Ga0182006_1000561 3300015261 Bacteria 27855
168 Ga0182007_10000945 3300015262 Bacteria 15982
169 Ga0163161_10011606 3300017792 Bacteria 6117
170 Ga0213872_10000559 3300021361 Bacteria 28845
171 Ga0213872_10000896 3300021361 Bacteria 21421
172 Ga0213872_10001399 3300021361 Bacteria 15889
173 Ga0213874_10000129 3300021377 Bacteria 12670
174 Ga0213876_10000839 3300021384 Bacteria 20663
175 Ga0213876_10023512 3300021384 Bacteria 3256
176 Ga0213875_10030200 3300021388 Bacteria 2567
177 Ga0224712_10031778 3300022467 Bacteria 1918
178 Ga0209784_100017 3300025224 Bacteria 472003
179 Ga0209566_100014 3300025225 Bacteria 472003
180 Ga0209674_100028 3300025226 Bacteria 472003
181 Ga0209147_100105 3300025229 Bacteria 157437
182 Ga0209563_100032 3300025230 Bacteria 472003
183 Ga0209258_100194 3300025242 Bacteria 124587
184 Ga0209646_1000416 3300025246 Bacteria 24235
185 Ga0209677_100018 3300025253 Bacteria 472003
186 Ga0209051_1000021 3300025303 Bacteria 507633
187 Ga0209051_1002711 3300025303 Bacteria 12317
188 Ga0209051_1012203 3300025303 Bacteria 4169
189 Ga0209051_1015472 3300025303 Bacteria 3506
190 Ga0207656_10000047 3300025321 Bacteria 46771
191 Ga0207696_1000043 3300025711 Bacteria 307112
192 Ga0207655_1000407 3300025728 Bacteria 59248
193 Ga0207713_1001287 3300025735 Bacteria 20678
194 Ga0207692_10006494 3300025898 Bacteria 4744
195 Ga0207642_10002300 3300025899 Bacteria 5952
196 Ga0207710_10000022 3300025900 Bacteria 335632
197 Ga0207710_10000175 3300025900 Bacteria 65485
198 Ga0207710_10000427 3300025900 Bacteria 27512
199 Ga0207688_10026388 3300025901 Bacteria 3194
200 Ga0207680_10023956 3300025903 Bacteria 3342
201 Ga0207680_10064718 3300025903 Bacteria 2243
202 Ga0207647_10034064 3300025904 Bacteria 3255
203 Ga0207671_10001896 3300025914 Bacteria 23245
204 Ga0207671_10007963 3300025914 Bacteria 9078
205 Ga0207671_10035963 3300025914 Bacteria 3672
206 Ga0207693_10004928 3300025915 Bacteria 11215
207 Ga0207663_10013385 3300025916 Bacteria 4458
208 Ga0207649_10000237 3300025920 Bacteria 45073
209 Ga0207681_10001233 3300025923 Bacteria 16482
210 Ga0207694_10038868 3300025924 Bacteria 3659
211 Ga0207650_10000135 3300025925 Bacteria 90396
212 Ga0207650_10000425 3300025925 Bacteria 37178
213 Ga0207687_10035703 3300025927 Bacteria 3383
214 Ga0207664_10003061 3300025929 Bacteria 11113
215 Ga0207664_10028828 3300025929 Bacteria 4222
216 Ga0207644_10003823 3300025931 Bacteria 9749
217 Ga0207644_10048597 3300025931 Bacteria 3034
218 Ga0207706_10000460 3300025933 Bacteria 43393
219 Ga0207706_10002365 3300025933 Bacteria 18429
220 Ga0207706_10058048 3300025933 Bacteria 3410
221 Ga0207669_10001460 3300025937 Bacteria 10076
222 Ga0207704_10001025 3300025938 Bacteria 12409
223 Ga0207665_10002351 3300025939 Bacteria 12764
224 Ga0207665_10028753 3300025939 Bacteria 3674
225 Ga0207665_10032302 3300025939 Bacteria 3466
226 Ga0207691_10099235 3300025940 Bacteria 2600
227 Ga0207711_10000149 3300025941 Bacteria 74062
228 Ga0207711_10000182 3300025941 Bacteria 67307
229 Ga0207711_10017686 3300025941 Bacteria 5922
230 Ga0207679_10000005 3300025945 Bacteria 525011
231 Ga0207712_10000020 3300025961 Bacteria 292796
232 Ga0207658_10000661 3300025986 Bacteria 30096
233 Ga0207658_10000705 3300025986 Bacteria 29012
234 Ga0207703_10000147 3300026035 Bacteria 82822
235 Ga0207703_10025897 3300026035 Bacteria 4615
236 Ga0207639_10002316 3300026041 Bacteria 12782
237 Ga0207639_10025141 3300026041 Bacteria 4317
238 Ga0207678_10005859 3300026067 Bacteria 10955
239 Ga0207678_10047531 3300026067 Bacteria 3711
240 Ga0207708_10005631 3300026075 Bacteria 9247
241 Ga0207641_10000156 3300026088 Bacteria 97171
242 Ga0207641_10004176 3300026088 Bacteria 12581
243 Ga0207641_10008873 3300026088 Bacteria 8302
244 Ga0207641_10115382 3300026088 Bacteria 2388
245 Ga0207648_10005870 3300026089 Bacteria 12283
246 Ga0207648_10012427 3300026089 Bacteria 7971
247 Ga0207648_10022324 3300026089 Bacteria 5686
248 Ga0207675_100004842 3300026118 Bacteria 12969
249 Ga0207675_100080124 3300026118 Bacteria 3061
250 Ga0209371_1002155 3300027312 Bacteria 11562
251 Ga0209983_1001711 3300027665 Bacteria 4851
252 Ga0209971_1000393 3300027682 Bacteria 11931
253 Ga0207428_10004305 3300027907 Bacteria 13594
254 Ga0268266_10002989 3300028379 Bacteria 17433
255 Ga0268265_10000004 3300028380 Bacteria 648376
256 Ga0268265_10000413 3300028380 Bacteria 45876
257 Ga0268265_10008623 3300028380 Bacteria 6890
258 Ga0268264_10000024 3300028381 Bacteria 470081
259 Ga0268264_10020535 3300028381 Bacteria 5397
260 Ga0268264_10150495 3300028381 Bacteria 2086
261 Ga0265334_10006625 3300028573 Bacteria 4980
262 Ga0265336_10001076 3300028666 Bacteria 13243
263 Ga0307515_10000478 3300028794 Bacteria 95304
264 Ga0307515_10013912 3300028794 Bacteria 14979
265 Ga0307515_10088731 3300028794 Bacteria 3904
266 Ga0265324_10000006 3300029957 Bacteria 267048
267 Ga0307511_10035520 3300030521 Bacteria 4350
268 Ga0307512_10009183 3300030522 Bacteria 9555
269 Ga0307512_10036044 3300030522 Bacteria 4202
270 Ga0265325_10000389 3300031241 Bacteria 31049
271 Ga0265340_10006669 3300031247 Bacteria 6326
272 Ga0265331_10019738 3300031250 Bacteria 3475
273 Ga0265327_10002866 3300031251 Bacteria 17361
274 Ga0307513_10000354 3300031456 Bacteria 66910
275 Ga0307513_10013021 3300031456 Bacteria 10232
276 Ga0307513_10034534 3300031456 Bacteria 5673
277 Ga0307509_10117635 3300031507 Bacteria 2644
278 Ga0307508_10009642 3300031616 Bacteria 8870
279 Ga0307508_10017511 3300031616 Bacteria 6514
280 Ga0316575_10004993 3300031665 Bacteria 4694
281 Ga0316575_10032784 3300031665 Bacteria 2036
282 Ga0316579_10003353 3300031691 Bacteria 6227
283 Ga0316579_10004069 3300031691 Bacteria 5773
284 Ga0316579_10017411 3300031691 Bacteria 3149
285 Ga0316579_10023098 3300031691 Bacteria 2788
286 Ga0316576_10000081 3300031727 Bacteria 32958
287 Ga0316576_10000785 3300031727 Bacteria 15940
288 Ga0316576_10003569 3300031727 Bacteria 9160
289 Ga0316576_10003570 3300031727 Bacteria 9160
290 Ga0316576_10024306 3300031727 Bacteria 4229
291 Ga0316576_10061297 3300031727 Bacteria 2757
292 Ga0316578_10000343 3300031728 Bacteria 14685
293 Ga0316578_10001427 3300031728 Bacteria 9687
294 Ga0316578_10002325 3300031728 Bacteria 8274
295 Ga0316578_10002609 3300031728 Bacteria 7987
296 Ga0316578_10003048 3300031728 Bacteria 7556
297 Ga0316578_10035391 3300031728 Bacteria 2871
298 Ga0316578_10051782 3300031728 Bacteria 2405
299 Ga0307516_10000433 3300031730 Bacteria 54987
300 Ga0307516_10040295 3300031730 Bacteria 4651
301 Ga0307516_10043788 3300031730 Bacteria 4433
302 Ga0307516_10064937 3300031730 Bacteria 3527
303 Ga0307405_10006782 3300031731 Bacteria 5666
304 Ga0307405_10019490 3300031731 Bacteria 3770
305 Ga0316577_10000205 3300031733 Bacteria 19951
306 Ga0316577_10000819 3300031733 Bacteria 13539
307 Ga0316577_10002280 3300031733 Bacteria 9450
308 Ga0316577_10002634 3300031733 Bacteria 8909
309 Ga0307410_10012605 3300031852 Bacteria 4897
310 Ga0307410_10077164 3300031852 Bacteria 2328
311 Ga0326468_10000068 3300031889 Bacteria 8456
312 Ga0307406_10032212 3300031901 Bacteria 3199
313 Ga0307406_10033170 3300031901 Bacteria 3158
314 Ga0307406_10070434 3300031901 Bacteria 2290
315 Ga0307407_10003980 3300031903 Bacteria 6175
316 Ga0307407_10033356 3300031903 Bacteria 2809
317 Ga0307409_100005183 3300031995 Bacteria 7454
318 Ga0307409_100007127 3300031995 Bacteria 6657
319 Ga0307409_100026708 3300031995 Bacteria 4077
320 Ga0307416_100036002 3300032002 Bacteria 3789
321 Ga0307416_100056126 3300032002 Bacteria 3176
322 Ga0307416_100087235 3300032002 Bacteria 2663
323 Ga0307414_10062673 3300032004 Bacteria 2640
324 Ga0307415_100005072 3300032126 Bacteria 6935
325 Ga0307415_100014478 3300032126 Bacteria 4639
326 Ga0307415_100086577 3300032126 Bacteria 2255
327 Ga0316583_10000620 3300032133 Bacteria 10846
328 Ga0316583_10000654 3300032133 Bacteria 10633
329 Ga0316583_10001929 3300032133 Bacteria 7088
330 Ga0316583_10004646 3300032133 Bacteria 4902
331 Ga0316585_10000314 3300032137 Bacteria 10861
332 Ga0373951_0000033 3300035091 Bacteria 54195
333 Ga0316574_0001916 3300035398 Bacteria 10187
334 Ga0316574_0023265 3300035398 Bacteria 3699
335 Ga0316574_0027430 3300035398 Bacteria 3431
336 Ga0316574_0035073 3300035398 Bacteria 3064
337 Ga0316574_0035884 3300035398 Bacteria 3033
338 Ga0316574_0072459 3300035398 Bacteria 2177
339 Ga0316582_0001990 3300036647 Bacteria 9366
340 Ga0316582_0004202 3300036647 Bacteria 7224
341 Ga0316582_0013534 3300036647 Bacteria 4596
342 Ga0316582_0019043 3300036647 Bacteria 4010
343 Ga0316582_0025264 3300036647 Bacteria 3565
344 Ga0316582_0068815 3300036647 Bacteria 2287
345 Ga0316584_0000228 3300036712 Bacteria 27809
346 Ga0316584_0006308 3300036712 Bacteria 8031
347 Ga0316584_0013448 3300036712 Bacteria 5792
348 Ga0316584_0016479 3300036712 Bacteria 5296
349 Ga0316584_0047828 3300036712 Bacteria 3196
350 Ga0316584_0050913 3300036712 Bacteria 3097
351 Ga0316584_0066774 3300036712 Bacteria 2695
352 Ga0395898_0050215 3300037466 Bacteria 4083
353 Ga0395905_0043769 3300037471 Bacteria 4200
354 Ga0436364_0001062 3300037853 Bacteria 1952
355 Ga0436364_0256774 3300037853 Bacteria 34884
356 Ga0436364_0873566 3300037853 Bacteria 7188
357 Ga0436364_1208595 3300037853 Unclassified 2848
358 Ga0395901_0034137 3300038443 Bacteria 5253
359 Ga0400484_00882 3300038725 Bacteria 4884
360 Ga0400484_05567 3300038725 Bacteria 13433
361 Ga0400490_02928 3300038726 Bacteria 4438
362 Ga0400485_05559 3300038735 Bacteria 72885
363 Ga0400485_13786 3300038735 Bacteria 18010
364 Ga0400488_02552 3300038741 Bacteria 6726
365 Ga0400488_15424 3300038741 Bacteria 5471
366 Ga0400488_16979 3300038741 Bacteria 10596
367 Ga0400488_19971 3300038741 Bacteria 3284
368 Ga0400488_35558 3300038741 Bacteria 3307
369 Ga0400486_06092 3300038742 Bacteria 9406
370 Ga0400486_08934 3300038742 Bacteria 14468
371 Ga0400486_19627 3300038742 Bacteria 369894
372 Ga0400483_036359 3300039062 Bacteria 6602
373 Ga0400483_046106 3300039062 Bacteria 3526
374 Ga0400483_068223 3300039062 Bacteria 3095
375 Ga0400483_133356 3300039062 Bacteria 4137
376 Ga0400483_157927 3300039062 Bacteria 3039
377 Ga0400483_164641 3300039062 Bacteria 2216
378 Ga0400483_183708 3300039062 Bacteria 3757
379 Ga0400483_287287 3300039062 Bacteria 8379
380 Ga0400489_77073 3300039093 Bacteria 3416
381 Ga0400489_87471 3300039093 Bacteria 26149
382 Ga0400487_04208 3300039110 Bacteria 3634
383 Ga0400487_09727 3300039110 Bacteria 45843
384 Ga0400487_22364 3300039110 Bacteria 3406
385 Ga0400487_27920 3300039110 Bacteria 22272
386 Ga0400487_38476 3300039110 Bacteria 8668
387 Ga0400487_59567 3300039110 Bacteria 21421
388 Ga0436365_0015250 3300039437 Bacteria 5764
389 Ga0436365_0350974 3300039437 Bacteria 14303
390 Ga0436365_0529637 3300039437 Bacteria 32938
391 Ga0436365_1823845 3300039437 Bacteria 75216
392 Ga0436361_0020532 3300039447 Bacteria 44080
393 Ga0436361_0142459 3300039447 Bacteria 45175
394 Ga0436361_0450698 3300039447 Bacteria 8556
395 Ga0436361_0572145 3300039447 Bacteria 42313
396 Ga0436361_0884959 3300039447 Bacteria 2874
397 Ga0436361_0889231 3300039447 Bacteria 2189
398 Ga0436363_0370824 3300039450 Bacteria 44745
399 Ga0436362_0832574 3300039453 Bacteria 2961
400 Ga0439461_0004639 3300041410 Bacteria 2304
401 Ga0439466_0006798 3300041411 Bacteria 4338
402 Ga0439465_0003836 3300041413 Bacteria 4904
403 Ga0439465_0020559 3300041413 Bacteria 2068
404 Ga0451791_0014186 3300041451 Bacteria 8314
405 Ga0451793_0408605 3300041452 Bacteria 20799
406 Ga0451795_1123441 3300041456 Bacteria 2495
407 Ga0451807_1611397 3300041486 Bacteria 2593
408 Ga0451847_0303602 3300041503 Bacteria 2099
409 Ga0451853_0247559 3300041512 Bacteria 4709
410 Ga0451853_2525222 3300041512 Bacteria 6680
411 Ga0439432_000002 3300042006 Bacteria 117808
412 Ga0439432_001309 3300042006 Bacteria 9425
413 Ga0450911_000007 3300042115 Bacteria 212322
414 Ga0450903_000224 3300042138 Bacteria 12598
415 Ga0450904_000573 3300042139 Bacteria 6883
416 Ga0439434_0002295 3300042435 Bacteria 5557
417 Ga0439435_0005161 3300042436 Bacteria 2859
418 Ga0439459_0000372 3300042438 Bacteria 5580
419 Ga0451577_0000002 3300042876 Bacteria 1731375
420 Ga0451577_0002234 3300042876 Bacteria 23544
421 Ga0451577_0010358 3300042876 Bacteria 8920
422 Ga0451577_0042406 3300042876 Bacteria 4081
423 Ga0451577_0062387 3300042876 Bacteria 3324
424 Ga0466972_0007425 3300044658 Bacteria 5511
425 Ga0453683_0000003 3300044673 Bacteria 942572
426 Ga0466965_0001172 3300044683 Bacteria 10315
427 Ga0466965_0004675 3300044683 Bacteria 6104
428 Ga0466965_0006938 3300044683 Bacteria 5182
429 Ga0466966_0021386 3300044684 Bacteria 4247
430 Ga0466966_0050249 3300044684 Bacteria 2653
431 Ga0466966_0087701 3300044684 Bacteria 1934
432 Ga0466961_0022978 3300044693 Bacteria 4011
433 Ga0466961_0064401 3300044693 Bacteria 2329
434 Ga0466964_0015739 3300044706 Bacteria 2879
435 Ga0453684_0000002 3300044712 Bacteria 1731375
436 Ga0453684_0000029 3300044712 Bacteria 757969
437 Ga0453684_0000163 3300044712 Bacteria 296196
438 Ga0453684_0005489 3300044712 Bacteria 25077
439 Ga0453684_0006674 3300044712 Bacteria 21779
440 Ga0466971_0004692 3300044719 Bacteria 5907
441 Ga0466968_0001457 3300044735 Bacteria 8493
442 Ga0466970_0007319 3300044765 Bacteria 5530
443 Ga0466970_0025262 3300044765 Bacteria 3110
444 Ga0466970_0065875 3300044765 Bacteria 1944
445 Ga0466957_0001918 3300044842 Bacteria 11039
446 Ga0466957_0004044 3300044842 Bacteria 8119
447 Ga0466960_0000590 3300044901 Bacteria 12546
448 Ga0466960_0000674 3300044901 Bacteria 11863
449 Ga0466960_0005162 3300044901 Bacteria 5163
450 Ga0466960_0007616 3300044901 Bacteria 4407
451 Ga0466960_0007720 3300044901 Bacteria 4381
452 Ga0466960_0008993 3300044901 Bacteria 4106
453 Ga0466960_0009846 3300044901 Bacteria 3953
454 Ga0466959_0004025 3300045049 Bacteria 9766
455 Ga0466959_0028893 3300045049 Bacteria 4109
456 Ga0466959_0035720 3300045049 Bacteria 3673
457 Ga0451576_0000004 3300045051 Bacteria 1312238
458 Ga0451576_0000304 3300045051 Bacteria 119160
459 Ga0451576_0002902 3300045051 Bacteria 24467
460 Ga0451576_0004546 3300045051 Bacteria 17966
461 Ga0451576_0004616 3300045051 Bacteria 17777
462 Ga0451576_0022990 3300045051 Bacteria 6756
463 Ga0451576_0035808 3300045051 Bacteria 5264
464 Ga0451576_0039541 3300045051 Bacteria 4992
465 Ga0451576_0053617 3300045051 Bacteria 4223
466 Ga0451576_0117151 3300045051 Bacteria 2773
467 Ga0466958_0000314 3300045836 Bacteria 19212
468 Ga0466958_0077465 3300045836 Bacteria 2042
469 Ga0466967_0001537 3300045976 Bacteria 13501
470 Ga0466967_0028981 3300045976 Bacteria 4628
471 Ga0466967_0029651 3300045976 Bacteria 4582
472 Ga0466967_0042705 3300045976 Bacteria 3920
473 Ga0466967_0044720 3300045976 Bacteria 3843
474 Ga0466967_0119127 3300045976 Bacteria 2436
475 Ga0495627_001093 3300046453 Bacteria 17709
476 Ga0495638_0000853 3300046460 Bacteria 31744
477 Ga0495607_0003237 3300046501 Bacteria 12550
478 Ga0495583_0002227 3300046506 Bacteria 17109
479 Ga0495606_0005869 3300046507 Bacteria 11562
480 Ga0495606_0036423 3300046507 Bacteria 3351
481 Ga0495610_0002466 3300046512 Bacteria 15539
482 Ga0495648_0008982 3300046524 Bacteria 7805
483 Ga0495654_0000631 3300046530 Bacteria 27787
484 Ga0495625_0056797 3300046660 Bacteria 2785
485 Ga0495661_0001357 3300046665 Bacteria 20682
486 Ga0495649_0025811 3300046694 Bacteria 3272
487 Ga0495581_0024166 3300047315 Bacteria 3522
488 Ga0495672_0001067 3300047320 Bacteria 27912
489 Ga0495679_001026 3300047446 Bacteria 17130
490 Ga0495593_0038245 3300047673 Bacteria 2592
491 Ga0495593_0070021 3300047673 Bacteria 1823
492 Ga0495626_0021458 3300048091 Bacteria 3205
493 Ga0496100_0000150 3300048903 Bacteria 38678
494 Ga0496100_0002709 3300048903 Bacteria 9053
495 Ga0496100_0003753 3300048903 Bacteria 7954
496 Ga0496100_0008113 3300048903 Bacteria 5843
497 Ga0496101_0000102 3300048904 Bacteria 88779
498 Ga0496101_0000103 3300048904 Bacteria 88726
499 Ga0496101_0002821 3300048904 Bacteria 10678
500 Ga0496101_0003030 3300048904 Bacteria 10362
501 Ga0496102_0000028 3300048905 Bacteria 224124
502 Ga0496102_0000037 3300048905 Bacteria 199368
503 Ga0496102_0000256 3300048905 Bacteria 69381
504 Ga0496102_0008315 3300048905 Bacteria 8891
505 Ga0496102_0048148 3300048905 Bacteria 3876
506 Ga0496102_0051205 3300048905 Bacteria 3762
507 Ga0496103_0000004 3300048906 Bacteria 510080
508 Ga0496103_0000024 3300048906 Bacteria 223336
509 Ga0496103_0000675 3300048906 Bacteria 25646
510 Ga0496103_0001077 3300048906 Bacteria 19064
511 Ga0496104_0001814 3300048907 Bacteria 18528
512 Ga0496104_0003980 3300048907 Bacteria 12797
513 Ga0496105_0001717 3300048908 Bacteria 15651
514 Ga0496105_0017030 3300048908 Bacteria 5817
515 Ga0496105_0053050 3300048908 Bacteria 3349
516 Ga0496106_0000661 3300048909 Bacteria 24693
517 Ga0496106_0001446 3300048909 Bacteria 17814
518 Ga0496107_0000421 3300048910 Bacteria 22921
519 Ga0496107_0002750 3300048910 Bacteria 11569
520 Ga0496108_0000007 3300048911 Bacteria 351492
521 Ga0496108_0002933 3300048911 Bacteria 13712
522 Ga0496108_0028307 3300048911 Bacteria 4636
523 Ga0496108_0048432 3300048911 Bacteria 3554
524 Ga0496109_0000936 3300048912 Bacteria 24158
525 Ga0496109_0029690 3300048912 Bacteria 4898
526 Ga0496109_0054810 3300048912 Bacteria 3636
527 Ga0496110_0033500 3300048913 Bacteria 4443
528 Ga0496110_0049360 3300048913 Bacteria 3691
529 Ga0496110_0101791 3300048913 Bacteria 2575
530 Ga0496111_0006818 3300048914 Bacteria 7449
531 Ga0496111_0016237 3300048914 Bacteria 5130
532 Ga0496111_0028476 3300048914 Bacteria 3960
533 Ga0496111_0062286 3300048914 Bacteria 2705
534 Ga0496112_0003102 3300048915 Bacteria 13629
535 Ga0496112_0010706 3300048915 Bacteria 8336
536 Ga0496112_0110525 3300048915 Bacteria 2719
537 Ga0496113_0078247 3300048916 Bacteria 2530
538 Ga0496114_0001286 3300048917 Bacteria 18965
539 Ga0496114_0002579 3300048917 Bacteria 13845
540 Ga0496114_0008626 3300048917 Bacteria 8079
541 Ga0496114_0009194 3300048917 Bacteria 7837
542 Ga0496114_0020580 3300048917 Bacteria 5355
543 Ga0496114_0022743 3300048917 Bacteria 5110
544 Ga0496114_0119129 3300048917 Bacteria 2269
545 Ga0496116_0000276 3300048919 Bacteria 89506
546 Ga0496116_0000307 3300048919 Bacteria 82318
547 Ga0496116_0000319 3300048919 Bacteria 78946
548 Ga0496116_0005328 3300048919 Bacteria 11985
549 Ga0496117_0000003 3300048920 Bacteria 1881097
550 Ga0496117_0000081 3300048920 Bacteria 223343
551 Ga0496117_0000184 3300048920 Bacteria 127675
552 Ga0496117_0001470 3300048920 Bacteria 33884
553 Ga0496117_0002500 3300048920 Bacteria 23077
554 Ga0496117_0007459 3300048920 Bacteria 10675
555 Ga0496117_0027567 3300048920 Bacteria 4422
556 Ga0496118_0000001 3300048921 Bacteria 1881100
557 Ga0496118_0000062 3300048921 Bacteria 219267
558 Ga0496118_0000142 3300048921 Bacteria 126087
559 Ga0496118_0000275 3300048921 Bacteria 90451
560 Ga0496118_0002678 3300048921 Bacteria 23536
561 Ga0496118_0004097 3300048921 Bacteria 17668
562 Ga0496118_0009283 3300048921 Bacteria 9976
563 Ga0496118_0015793 3300048921 Bacteria 6965
564 Ga0496118_0020389 3300048921 Bacteria 5878
565 Ga0496119_0001483 3300048922 Bacteria 28127
566 Ga0496119_0003639 3300048922 Bacteria 15826
567 Ga0496119_0004611 3300048922 Bacteria 13606
568 Ga0496119_0005794 3300048922 Bacteria 11687
569 Ga0496119_0009985 3300048922 Bacteria 8040
570 Ga0496119_0025510 3300048922 Bacteria 4126
571 Ga0496120_0001510 3300048923 Bacteria 27511
572 Ga0496120_0002853 3300048923 Bacteria 16636
573 Ga0496120_0005269 3300048923 Bacteria 10385
574 Ga0496120_0010377 3300048923 Bacteria 6503
575 Ga0496120_0023439 3300048923 Bacteria 3864
576 Ga0496120_0024688 3300048923 Bacteria 3743
577 Ga0496120_0053963 3300048923 Bacteria 2281
578 Ga0496121_0000134 3300048924 Bacteria 165728
579 Ga0496121_0000338 3300048924 Bacteria 97703
580 Ga0496121_0001738 3300048924 Bacteria 35590
581 Ga0496121_0004581 3300048924 Bacteria 18434
582 Ga0496121_0010661 3300048924 Bacteria 10317
583 Ga0496121_0019625 3300048924 Bacteria 6751
584 Ga0496122_0000453 3300048925 Bacteria 85486
585 Ga0496122_0009089 3300048925 Bacteria 10536
586 Ga0496123_0009947 3300048926 Bacteria 8480
587 Ga0496123_0011666 3300048926 Bacteria 7585
588 Ga0496124_0000090 3300048927 Bacteria 192095
589 Ga0496124_0000113 3300048927 Bacteria 165710
590 Ga0496124_0005617 3300048927 Bacteria 14030
591 Ga0496124_0011185 3300048927 Bacteria 8997
592 Ga0496124_0014575 3300048927 Bacteria 7594
593 Ga0496124_0051542 3300048927 Bacteria 3501
594 Ga0496125_0000127 3300048928 Bacteria 165710
595 Ga0496125_0003033 3300048928 Bacteria 21006
596 Ga0496125_0003310 3300048928 Bacteria 19722
597 Ga0496125_0005680 3300048928 Bacteria 13755
598 Ga0496125_0007943 3300048928 Bacteria 11203
599 Ga0496125_0064819 3300048928 Bacteria 2899
600 Ga0496126_0000140 3300048929 Bacteria 165728
601 Ga0496126_0000148 3300048929 Bacteria 163288
602 Ga0496126_0000551 3300048929 Bacteria 72093
603 Ga0496126_0005413 3300048929 Bacteria 14564
604 Ga0496126_0017380 3300048929 Bacteria 7166
605 Ga0496126_0042098 3300048929 Bacteria 4220
606 Ga0496126_0052946 3300048929 Bacteria 3685
607 Ga0501032_0006318 3300049569 Bacteria 8729
608 Ga0501032_0044557 3300049569 Bacteria 3002
609 Ga0501033_0000475 3300049570 Bacteria 38003
610 Ga0501033_0031429 3300049570 Bacteria 3990
611 Ga0501033_0034673 3300049570 Bacteria 3783
612 Ga0501034_0001017 3300049571 Bacteria 40194
613 Ga0501034_0001976 3300049571 Bacteria 25980
614 Ga0501034_0138225 3300049571 Bacteria 2416
615 Ga0501036_0008116 3300049572 Bacteria 8603
616 Ga0501036_0031518 3300049572 Bacteria 4480
617 Ga0501037_0005362 3300049573 Bacteria 9330
618 Ga0501037_0114156 3300049573 Bacteria 1944
619 Ga0501038_0010359 3300049574 Bacteria 8531
620 Ga0501039_0016710 3300049575 Bacteria 5622
621 Ga0501043_0009083 3300049579 Bacteria 7819
622 Ga0501046_0001150 3300049580 Bacteria 25719
623 Ga0501047_0019357 3300049581 Bacteria 6530
624 Ga0501047_0071600 3300049581 Bacteria 3336
625 Ga0501048_0004986 3300049582 Bacteria 10124
626 Ga0501067_0017615 3300049583 Bacteria 3954
627 Ga0501068_0001478 3300049584 Bacteria 12507
628 Ga0501069_0021986 3300049585 Bacteria 3465
629 Ga0501070_0001935 3300049586 Bacteria 18290
630 Ga0501070_0003678 3300049586 Bacteria 13256
631 Ga0501070_0003812 3300049586 Bacteria 13014
632 Ga0501070_0008931 3300049586 Bacteria 8472
633 Ga0501070_0065984 3300049586 Bacteria 2997
634 Ga0501073_0001444 3300049589 Bacteria 17571
635 Ga0501073_0018415 3300049589 Bacteria 5047
636 Ga0501074_0029052 3300049590 Bacteria 4005
637 Ga0501077_0008118 3300049593 Bacteria 6490
638 Ga0501080_0002002 3300049742 Bacteria 17586
639 Ga0501083_0059158 3300049744 Bacteria 2563
640 Ga0501083_0062510 3300049744 Bacteria 2484
641 Ga0501263_001300 3300049760 Bacteria 2310
642 Ga0501035_0001692 3300049822 Bacteria 22306
643 Ga0501044_0001637 3300049823 Bacteria 26261
644 Ga0501044_0004131 3300049823 Bacteria 16298
645 Ga0501044_0004356 3300049823 Bacteria 15855
646 Ga0501044_0025358 3300049823 Bacteria 6284
647 Ga0501044_0083864 3300049823 Bacteria 3221
648 Ga0501226_000006 3300049853 Bacteria 259153
649 nmdc:mga03683_31809_c1 3300050489 Bacteria 2119
650 nmdc:mga03n38_16424_c1 3300050490 Bacteria 2879
651 nmdc:mga00v17_20650_c1 3300050491 Bacteria 3776
652 nmdc:mga00v17_5588_c1 3300050491 Bacteria 6630
653 nmdc:mga00v17_8696_c2 3300050491 Bacteria 4260
654 nmdc:mga0yw44_44898_c1 3300050492 Bacteria 2646
655 nmdc:mga0yw44_9241_c1 3300050492 Bacteria 4965
656 nmdc:mga07m45_21298_c1 3300050496 Bacteria 3528
657 nmdc:mga07m45_22315_c1 3300050496 Bacteria 3455
658 nmdc:mga07m45_6411_c1 3300050496 Bacteria 5942
659 nmdc:mga05p37_64973_c1 3300050507 Bacteria 4490
660 nmdc:mga08y16_22247_c1 3300050511 Bacteria 6690
661 nmdc:mga08y16_62316_c1 3300050511 Bacteria 3894
662 nmdc:mga0n895_162759_c1 3300050512 Bacteria 2263
663 nmdc:mga0n895_54272_c1 3300050512 Bacteria 3941
664 nmdc:mga0sz30_11458_c1 3300050516 Bacteria 3424
665 nmdc:mga0sz30_1671_c1 3300050516 Bacteria 7873
666 nmdc:mga0sz30_39163_c1 3300050516 Bacteria 1988
667 nmdc:mga0sz30_636_c1 3300050516 Bacteria 12980
668 Ga0495601_0004427 3300053077 Bacteria 8110
669 Ga0500650_0018370 3300053098 Bacteria 3031
670 Ga0500652_000004 3300053131 Bacteria 173428
671 Ga0500652_018471 3300053131 Bacteria 2575
672 Ga0500616_0000223 3300053153 Bacteria 88492
673 Ga0500616_0004157 3300053153 Bacteria 10450
674 Ga0500616_0022471 3300053153 Bacteria 3520
675 Ga0500634_0000596 3300053161 Bacteria 12051
676 Ga0500645_000063 3300053730 Bacteria 85018
677 Ga0501082_0005048 3300060353 Bacteria 11509
678 Ga0466962_0011356 3300061719 Bacteria 4289
679 Ga0466962_0024644 3300061719 Bacteria 2889
680 2508677596 2508501039 Bacteria 9978592
681 2511376276 2511231024 Bacteria 5835885
682 2517759231 2517572101 Bacteria 6884336
683 2526211544 2526164512 Bacteria 4025691
684 2528204729 2527291627 Bacteria 5309833
685 2528214755 2527291629 Bacteria 5267418
686 2546949703 2546825537 Bacteria 5389291
687 2551709155 2551306089 Bacteria 7162724
688 2551714076 2551306089 Bacteria 7162724
689 2551744209 2551306093 Bacteria 7064773
690 2579750607 2576861822 Bacteria 5004595
691 2579858246 2579778521 Bacteria 7624758
692 2597865012 2597489888 Bacteria 6179543
693 2597870867 2597489889 Bacteria 6297495
694 2599103628 2597490356 Bacteria 7030811
695 2599400141 2599185167 Bacteria 6353609
696 2599451529 2599185179 Bacteria 6611171
697 2599509349 2599185189 Bacteria 5862825
698 2599512701 2599185190 Bacteria 6285678
699 2599520052 2599185191 Bacteria 6297582
700 2599891377 2599185290 Bacteria 6289611
701 2599947556 2599185303 Bacteria 6512725
702 2601689728 2600255296 Bacteria 5784754
703 2619858951 2619618881 Bacteria 7521104
704 2620349990 2619619003 Bacteria 7619552
705 2621298430 2619619299 Bacteria 6649820
706 2626637029 2626541554 Bacteria 7741902
707 2643874394 2643221571 Bacteria 6228673
708 2644441181 2643221678 Bacteria 9540101
709 2644486461 2643221687 Bacteria 6500351
710 2644621849 2643221713 Bacteria 6554480
711 2644627261 2643221714 Bacteria 9015452
712 2644634998 2643221715 Bacteria 6671032
713 2671838027 2671180195 Bacteria 9757215
714 2676199556 2675902999 Bacteria 9438463
715 2677899800 2675903420 Bacteria 6247433
716 2686540058 2684623035 Bacteria 8032739
717 2686544524 2684623036 Bacteria 5199090
718 2689961857 2687453737 Bacteria 11203906
719 2689989914 2687453743 Bacteria 8361025
720 2710602889 2710264753 Bacteria 5455564
721 2723249760 2721755607 Bacteria 5841722
722 2729147524 2728369097 Bacteria 4333476
723 2738667672 2738541264 Bacteria 5935393
724 2738671187 2738541265 Bacteria 6594665
725 2738706140 2738541274 Bacteria 6909446
726 2738749581 2738541282 Bacteria 6593925
727 2738858621 2738541303 Bacteria 6591772
728 2738947211 2738541317 Bacteria 5340176
729 2739146742 2738541356 Bacteria 5935017
730 2739332960 2738543028 Bacteria 6917070
731 2753300207 2751185788 Bacteria 4541048
732 2772646171 2772190715 Bacteria 6959372
733 2774844134 2773857921 Bacteria 9435764
734 2774856183 2773857922 Bacteria 9757215
735 2774867845 2773857924 Bacteria 5256821
736 2808846541 2808606359 Bacteria 9866990
737 2808907448 2808606373 Bacteria 4423627
738 2808941475 2808606379 Bacteria 5022697
739 2808977342 2808606385 Bacteria 6711065
740 2808992497 2808606388 Bacteria 6706662
741 2816504865 2816332139 Bacteria 9138787
742 2817492421 2816332298 Bacteria 6852809
743 2829750589 2829745981 Bacteria 5406054
744 2834034534 2834028612 Bacteria 6354979
745 2837275816 2837268691 Bacteria 7850704
746 2842138383 2842134933 Bacteria 5847019
747 2842696160 2842694124 Bacteria 4063419
748 2842829480 2842826826 Bacteria 5974129
749 2842840939 2842837860 Bacteria 6066181
750 2846957312 2846952575 Bacteria 6587527
751 2848863348 2848858292 Bacteria 7391279
752 2852613273 2852612431 Bacteria 6885235
753 2852668991 2852667396 Bacteria 6885555
754 2855674941 2855670206 Bacteria 7120389
755 2855681807 2855676851 Bacteria 7063653
756 2856748321 2856741275 Bacteria 8096094
757 2857289628 2857288857 Bacteria 7189066
758 2858849411 2858848962 Bacteria 6963058
759 2858882438 2858882152 Bacteria 7230291
760 2858894607 2858888857 Bacteria 7060307
761 2858895626 2858895516 Bacteria 7378898
762 2860871526 2860867994 Bacteria 5645326
763 2861692945 2861691609 Bacteria 5628931
764 2868094425 2868088558 Bacteria 7609351
765 2869049992 2869048445 Bacteria 6875584
766 2869062291 2869061728 Bacteria 7112407
767 2869069597 2869068681 Bacteria 7205615
768 2880490920 2880489317 Bacteria 7096270
769 2880501591 2880495981 Bacteria 7340502
770 2889310680 2889306138 Bacteria 6358934
771 2891398203 2891395885 Bacteria 9251614
772 2891563632 2891562705 Bacteria 8039471
773 2894817758 2894817345 Bacteria 4892941
774 2895889194 2895880812 Bacteria 11255272
775 2902406405 2902405164 Bacteria 6784948
776 2902798402 2902792274 Bacteria 7270173
777 2902801569 2902799365 Bacteria 5419524
778 2902816946 2902810491 Bacteria 6794147
779 2902840120 2902837492 Bacteria 6697721
780 2908450921 2908446538 Bacteria 6829095
781 2913312692 2913308742 Bacteria 5350706
782 2915364521 2915358134 Bacteria 6050864
783 2919044375 2919042368 Bacteria 3905917
784 2919468968 2919468124 Bacteria 9133025
785 2920880483 2920879853 Bacteria 4216831
786 2928105766 2928104781 Bacteria 3877447
787 2929193528 2929189879 Bacteria 5930554
788 2929214990 2929212328 Bacteria 7708288
789 2929230103 2929226422 Bacteria 7248583
790 2931394873 2931390751 Bacteria 6273349
791 2939587255 2939582691 Bacteria 7088898
792 2939600495 2939598168 Bacteria 4687164
793 2945932430 2945928738 Bacteria 6053221
794 2946008634 2946006987 Bacteria 6705746
795 2946079789 2946072368 Bacteria 8999607
796 2947238839 2947233263 Bacteria 6439278
797 2984552281 2984551494 Bacteria 3877562
798 637880231 637000116 Bacteria 5433628
799 640487397 640427133 Bacteria 4567418
800 651175331 651053060 Bacteria 4689946
801 8002778434 8002775197 Bacteria 10728764
802 8002790503 8002784119 Bacteria 9788632
803 8045866622 8045864390 Bacteria 5043873
804 8054111671 8054107350 Bacteria 5022511
805 8054290752 8054285046 Bacteria 6919322
806 8054350858 8054347763 Bacteria 5901107
807 8054474743 8054472261 Bacteria 7464355
808 8054507381 8054503363 Bacteria 6101651
809 8054566569 8054563764 Bacteria 5592885
810 8054709465 8054704163 Bacteria 7247792
811 8054728830 8054727385 Bacteria 7558670
812 8054734700 8054734606 Bacteria 6947278
813 8054915694 8054913762 Bacteria 7713009
814 8054923954 8054920844 Bacteria 7068637
815 8055160810 8055157932 Bacteria 6429399
816 8055822324 8055817908 Bacteria 6609162
817 8056135786 8056131705 Bacteria 6107031
818 8056153083 8056148874 Bacteria 6479865
819 8056161989 8056161164 Bacteria 6106669
820 Ga0207639_10010424
821 rootH2_10015241
822 Ga0055538_1000079
823 Ga0055539_1000120
824 Ga0055533_1000128
825 Ga0055532_1000116
826 Ga0055525_1000165
827 Ga0055540_1000024
828 Ga0055540_1002431
829 Ga0055540_1004520
830 Ga0055540_1007661
831 Ga0055541_1000080
832 Ga0065714_10002472
833 Ga0070658_10035015
834 Ga0070676_10017874
835 Ga0070683_100172717
836 Ga0070670_100000045
837 Ga0070670_100148774
838 Ga0070682_100007253
839 Ga0070682_100067347
840 Ga0070687_100030946
841 Ga0070661_100006754
842 Ga0070692_10048048
843 Ga0070668_100000449
844 Ga0070668_100001342
845 Ga0070668_100019915
846 Ga0070668_100028001
847 Ga0070668_100084310
848 Ga0070669_100025937
849 Ga0070671_100003104
850 Ga0070671_100028821
851 Ga0070671_100044515
852 Ga0070674_100001298
853 Ga0070674_100024358
854 Ga0070659_100035434
855 Ga0070659_100087211
856 Ga0070667_100000063
857 Ga0070667_100039611
858 Ga0070667_100116471
859 Ga0070714_100006996
860 Ga0070714_100033136
861 Ga0070711_100002490
862 Ga0070705_100009653
863 Ga0070700_100009255
864 Ga0070663_100005931
865 Ga0070663_100092463
866 Ga0070678_100001418
867 Ga0070662_100048435
868 Ga0070662_100066836
869 Ga0068867_100005596
870 Ga0070685_10009916
871 Ga0068853_100000144
872 Ga0068853_100014791
873 Ga0070665_100000979
874 Ga0070665_100008785
875 Ga0070665_100012648
876 Ga0070665_100017721
877 Ga0070664_100009176
878 Ga0068854_100021764
879 Ga0068854_100037486
880 Ga0070702_100014451
881 Ga0068859_100000184
882 Ga0068859_100001979
883 Ga0068859_100006882
884 Ga0068859_100012750
885 Ga0068859_100102861
886 Ga0068866_10001173
887 Ga0068866_10021990
888 Ga0068851_10000040
889 Ga0068863_100000159
890 Ga0068863_100000739
891 Ga0068863_100008258
892 Ga0068863_100009338
893 Ga0068858_100000141
894 Ga0068858_100010221
895 Ga0068858_100031984
896 Ga0068860_100000065
897 Ga0068860_100014977
898 Ga0068862_100000028
899 Ga0068862_100000496
900 Ga0068862_100021504
901 Ga0081455_10052913
902 Ga0081540_1021753
903 Ga0081539_10000889
904 Ga0081539_10003849
905 Ga0081539_10005545
906 Ga0081539_10008604
907 Ga0075365_10003226
908 Ga0075365_10004832
909 Ga0075368_10003971
910 Ga0075368_10006832
911 Ga0075363_100001644
912 Ga0075363_100007787
913 Ga0075364_10004962
914 Ga0075364_10005195
915 Ga0075364_10018758
916 Ga0075364_10028339
917 Ga0070712_100005495
918 Ga0075367_10006245
919 Ga0075369_10000241
920 Ga0075369_10002872
921 Ga0075369_10026792
922 Ga0097621_100130240
923 Ga0075370_10013757
924 Ga0075370_10049387
925 Ga0068871_100075218
926 Ga0075428_100003910
927 Ga0075430_100040168
928 Ga0075430_100079384
929 Ga0068865_100000662
930 Ga0097620_100000184
931 Ga0097620_100001979
932 Ga0097620_100006882
933 Ga0097620_100012750
934 Ga0097620_100102859
935 Ga0105251_10001487
936 Ga0105244_10005906
937 Ga0105250_10000381
938 Ga0105240_10115972
939 Ga0111539_10001058
940 Ga0105245_10006009
941 Ga0105247_10000232
942 Ga0105247_10000606
943 Ga0105247_10000653
944 Ga0105247_10003188
945 Ga0114129_10028015
946 Ga0105243_10000916
947 Ga0105242_10000321
948 Ga0105248_10000074
949 Ga0105248_10000812
950 Ga0105248_10002879
951 Ga0105248_10022807
952 Ga0105237_10001244
953 Ga0105237_10015275
954 Ga0105237_10033771
955 Ga0105238_10033151
956 Ga0105249_10000011
957 Ga0105249_10087755
958 Ga0105239_10027928
959 Ga0105239_10030661
960 Ga0105239_10088169
961 Ga0105246_10000513
962 Ga0105246_10013913
963 Ga0157373_10001051
964 Ga0157373_10004203
965 Ga0157373_10015031
966 Ga0157371_10001356
967 Ga0157371_10094442
968 Ga0157370_10000649
969 Ga0157370_10070452
970 Ga0157370_10156697
971 Ga0157369_10008322
972 Ga0157369_10009567
973 Ga0157378_10005790
974 Ga0157372_10078811
975 Ga0157372_10131802
976 Ga0157375_10000539
977 Ga0157375_10006212
978 Ga0163163_10000528
979 Ga0163163_10034600
980 Ga0157380_10004453
981 Ga0182008_10005229
982 Ga0157379_10000730
983 Ga0157379_10018275
984 Ga0157379_10078828
985 Ga0157376_10050752
986 Ga0182006_1000561
987 Ga0182007_10000945
988 Ga0163161_10011606
989 Ga0213872_10000559
990 Ga0213872_10000896
991 Ga0213872_10001399
992 Ga0213874_10000129
993 Ga0213876_10000839
994 Ga0213876_10023512
995 Ga0213875_10030200
996 Ga0224712_10031778
997 Ga0209784_100017
998 Ga0209566_100014
999 Ga0209674_100028
1000 Ga0209147_100105
1001 Ga0209563_100032
1002 Ga0209258_100194
1003 Ga0209646_1000416
1004 Ga0209677_100018
1005 Ga0209051_1000021
1006 Ga0209051_1002711
1007 Ga0209051_1012203
1008 Ga0209051_1015472
1009 Ga0207656_10000047
1010 Ga0207696_1000043
1011 Ga0207655_1000407
1012 Ga0207713_1001287
1013 Ga0207692_10006494
1014 Ga0207642_10002300
1015 Ga0207710_10000022
1016 Ga0207710_10000175
1017 Ga0207710_10000427
1018 Ga0207688_10026388
1019 Ga0207680_10023956
1020 Ga0207680_10064718
1021 Ga0207647_10034064
1022 Ga0207671_10001896
1023 Ga0207671_10007963
1024 Ga0207671_10035963
1025 Ga0207693_10004928
1026 Ga0207663_10013385
1027 Ga0207649_10000237
1028 Ga0207681_10001233
1029 Ga0207694_10038868
1030 Ga0207650_10000135
1031 Ga0207650_10000425
1032 Ga0207687_10035703
1033 Ga0207664_10003061
1034 Ga0207664_10028828
1035 Ga0207644_10003823
1036 Ga0207644_10048597
1037 Ga0207706_10000460
1038 Ga0207706_10002365
1039 Ga0207706_10058048
1040 Ga0207669_10001460
1041 Ga0207704_10001025
1042 Ga0207665_10002351
1043 Ga0207665_10028753
1044 Ga0207665_10032302
1045 Ga0207691_10099235
1046 Ga0207711_10000149
1047 Ga0207711_10000182
1048 Ga0207711_10017686
1049 Ga0207679_10000005
1050 Ga0207712_10000020
1051 Ga0207658_10000661
1052 Ga0207658_10000705
1053 Ga0207703_10000147
1054 Ga0207703_10025897
1055 Ga0207639_10002316
1056 Ga0207639_10025141
1057 Ga0207678_10005859
1058 Ga0207678_10047531
1059 Ga0207708_10005631
1060 Ga0207641_10000156
1061 Ga0207641_10004176
1062 Ga0207641_10008873
1063 Ga0207641_10115382
1064 Ga0207648_10005870
1065 Ga0207648_10012427
1066 Ga0207648_10022324
1067 Ga0207675_100004842
1068 Ga0207675_100080124
1069 Ga0209371_1002155
1070 Ga0209983_1001711
1071 Ga0209971_1000393
1072 Ga0207428_10004305
1073 Ga0268266_10002989
1074 Ga0268265_10000004
1075 Ga0268265_10000413
1076 Ga0268265_10008623
1077 Ga0268264_10000024
1078 Ga0268264_10020535
1079 Ga0268264_10150495
1080 Ga0265334_10006625
1081 Ga0265336_10001076
1082 Ga0307515_10000478
1083 Ga0307515_10013912
1084 Ga0307515_10088731
1085 Ga0265324_10000006
1086 Ga0307511_10035520
1087 Ga0307512_10009183
1088 Ga0307512_10036044
1089 Ga0265325_10000389
1090 Ga0265340_10006669
1091 Ga0265331_10019738
1092 Ga0265327_10002866
1093 Ga0307513_10000354
1094 Ga0307513_10013021
1095 Ga0307513_10034534
1096 Ga0307509_10117635
1097 Ga0307508_10009642
1098 Ga0307508_10017511
1099 Ga0316575_10004993
1100 Ga0316575_10032784
1101 Ga0316579_10003353
1102 Ga0316579_10004069
1103 Ga0316579_10017411
1104 Ga0316579_10023098
1105 Ga0316576_10000081
1106 Ga0316576_10000785
1107 Ga0316576_10003569
1108 Ga0316576_10003570
1109 Ga0316576_10024306
1110 Ga0316576_10061297
1111 Ga0316578_10000343
1112 Ga0316578_10001427
1113 Ga0316578_10002325
1114 Ga0316578_10002609
1115 Ga0316578_10003048
1116 Ga0316578_10035391
1117 Ga0316578_10051782
1118 Ga0307516_10000433
1119 Ga0307516_10040295
1120 Ga0307516_10043788
1121 Ga0307516_10064937
1122 Ga0307405_10006782
1123 Ga0307405_10019490
1124 Ga0316577_10000205
1125 Ga0316577_10000819
1126 Ga0316577_10002280
1127 Ga0316577_10002634
1128 Ga0307410_10012605
1129 Ga0307410_10077164
1130 Ga0326468_10000068
1131 Ga0307406_10032212
1132 Ga0307406_10033170
1133 Ga0307406_10070434
1134 Ga0307407_10003980
1135 Ga0307407_10033356
1136 Ga0307409_100005183
1137 Ga0307409_100007127
1138 Ga0307409_100026708
1139 Ga0307416_100036002
1140 Ga0307416_100056126
1141 Ga0307416_100087235
1142 Ga0307414_10062673
1143 Ga0307415_100005072
1144 Ga0307415_100014478
1145 Ga0307415_100086577
1146 Ga0316583_10000620
1147 Ga0316583_10000654
1148 Ga0316583_10001929
1149 Ga0316583_10004646
1150 Ga0316585_10000314
1151 Ga0373951_0000033
1152 Ga0316574_0001916
1153 Ga0316574_0023265
1154 Ga0316574_0027430
1155 Ga0316574_0035073
1156 Ga0316574_0035884
1157 Ga0316574_0072459
1158 Ga0316582_0001990
1159 Ga0316582_0004202
1160 Ga0316582_0013534
1161 Ga0316582_0019043
1162 Ga0316582_0025264
1163 Ga0316582_0068815
1164 Ga0316584_0000228
1165 Ga0316584_0006308
1166 Ga0316584_0013448
1167 Ga0316584_0016479
1168 Ga0316584_0047828
1169 Ga0316584_0050913
1170 Ga0316584_0066774
1171 Ga0395898_0050215
1172 Ga0395905_0043769
1173 Ga0436364_0001062
1174 Ga0436364_0256774
1175 Ga0436364_0873566
1176 Ga0436364_1208595
1177 Ga0395901_0034137
1178 Ga0400484_00882
1179 Ga0400484_05567
1180 Ga0400490_02928
1181 Ga0400485_05559
1182 Ga0400485_13786
1183 Ga0400488_02552
1184 Ga0400488_15424
1185 Ga0400488_16979
1186 Ga0400488_19971
1187 Ga0400488_35558
1188 Ga0400486_06092
1189 Ga0400486_08934
1190 Ga0400486_19627
1191 Ga0400483_036359
1192 Ga0400483_046106
1193 Ga0400483_068223
1194 Ga0400483_133356
1195 Ga0400483_157927
1196 Ga0400483_164641
1197 Ga0400483_183708
1198 Ga0400483_287287
1199 Ga0400489_77073
1200 Ga0400489_87471
1201 Ga0400487_04208
1202 Ga0400487_09727
1203 Ga0400487_22364
1204 Ga0400487_27920
1205 Ga0400487_38476
1206 Ga0400487_59567
1207 Ga0436365_0015250
1208 Ga0436365_0350974
1209 Ga0436365_0529637
1210 Ga0436365_1823845
1211 Ga0436361_0020532
1212 Ga0436361_0142459
1213 Ga0436361_0450698
1214 Ga0436361_0572145
1215 Ga0436361_0884959
1216 Ga0436361_0889231
1217 Ga0436363_0370824
1218 Ga0436362_0832574
1219 Ga0439461_0004639
1220 Ga0439466_0006798
1221 Ga0439465_0003836
1222 Ga0439465_0020559
1223 Ga0451791_0014186
1224 Ga0451793_0408605
1225 Ga0451795_1123441
1226 Ga0451807_1611397
1227 Ga0451847_0303602
1228 Ga0451853_0247559
1229 Ga0451853_2525222
1230 Ga0439432_000002
1231 Ga0439432_001309
1232 Ga0450911_000007
1233 Ga0450903_000224
1234 Ga0450904_000573
1235 Ga0439434_0002295
1236 Ga0439435_0005161
1237 Ga0439459_0000372
1238 Ga0451577_0000002
1239 Ga0451577_0002234
1240 Ga0451577_0010358
1241 Ga0451577_0042406
1242 Ga0451577_0062387
1243 Ga0466972_0007425
1244 Ga0453683_0000003
1245 Ga0466965_0001172
1246 Ga0466965_0004675
1247 Ga0466965_0006938
1248 Ga0466966_0021386
1249 Ga0466966_0050249
1250 Ga0466966_0087701
1251 Ga0466961_0022978
1252 Ga0466961_0064401
1253 Ga0466964_0015739
1254 Ga0453684_0000002
1255 Ga0453684_0000029
1256 Ga0453684_0000163
1257 Ga0453684_0005489
1258 Ga0453684_0006674
1259 Ga0466971_0004692
1260 Ga0466968_0001457
1261 Ga0466970_0007319
1262 Ga0466970_0025262
1263 Ga0466970_0065875
1264 Ga0466957_0001918
1265 Ga0466957_0004044
1266 Ga0466960_0000590
1267 Ga0466960_0000674
1268 Ga0466960_0005162
1269 Ga0466960_0007616
1270 Ga0466960_0007720
1271 Ga0466960_0008993
1272 Ga0466960_0009846
1273 Ga0466959_0004025
1274 Ga0466959_0028893
1275 Ga0466959_0035720
1276 Ga0451576_0000004
1277 Ga0451576_0000304
1278 Ga0451576_0002902
1279 Ga0451576_0004546
1280 Ga0451576_0004616
1281 Ga0451576_0022990
1282 Ga0451576_0035808
1283 Ga0451576_0039541
1284 Ga0451576_0053617
1285 Ga0451576_0117151
1286 Ga0466958_0000314
1287 Ga0466958_0077465
1288 Ga0466967_0001537
1289 Ga0466967_0028981
1290 Ga0466967_0029651
1291 Ga0466967_0042705
1292 Ga0466967_0044720
1293 Ga0466967_0119127
1294 Ga0495627_001093
1295 Ga0495638_0000853
1296 Ga0495607_0003237
1297 Ga0495583_0002227
1298 Ga0495606_0005869
1299 Ga0495606_0036423
1300 Ga0495610_0002466
1301 Ga0495648_0008982
1302 Ga0495654_0000631
1303 Ga0495625_0056797
1304 Ga0495661_0001357
1305 Ga0495649_0025811
1306 Ga0495581_0024166
1307 Ga0495672_0001067
1308 Ga0495679_001026
1309 Ga0495593_0038245
1310 Ga0495593_0070021
1311 Ga0495626_0021458
1312 Ga0496100_0000150
1313 Ga0496100_0002709
1314 Ga0496100_0003753
1315 Ga0496100_0008113
1316 Ga0496101_0000102
1317 Ga0496101_0000103
1318 Ga0496101_0002821
1319 Ga0496101_0003030
1320 Ga0496102_0000028
1321 Ga0496102_0000037
1322 Ga0496102_0000256
1323 Ga0496102_0008315
1324 Ga0496102_0048148
1325 Ga0496102_0051205
1326 Ga0496103_0000004
1327 Ga0496103_0000024
1328 Ga0496103_0000675
1329 Ga0496103_0001077
1330 Ga0496104_0001814
1331 Ga0496104_0003980
1332 Ga0496105_0001717
1333 Ga0496105_0017030
1334 Ga0496105_0053050
1335 Ga0496106_0000661
1336 Ga0496106_0001446
1337 Ga0496107_0000421
1338 Ga0496107_0002750
1339 Ga0496108_0000007
1340 Ga0496108_0002933
1341 Ga0496108_0028307
1342 Ga0496108_0048432
1343 Ga0496109_0000936
1344 Ga0496109_0029690
1345 Ga0496109_0054810
1346 Ga0496110_0033500
1347 Ga0496110_0049360
1348 Ga0496110_0101791
1349 Ga0496111_0006818
1350 Ga0496111_0016237
1351 Ga0496111_0028476
1352 Ga0496111_0062286
1353 Ga0496112_0003102
1354 Ga0496112_0010706
1355 Ga0496112_0110525
1356 Ga0496113_0078247
1357 Ga0496114_0001286
1358 Ga0496114_0002579
1359 Ga0496114_0008626
1360 Ga0496114_0009194
1361 Ga0496114_0020580
1362 Ga0496114_0022743
1363 Ga0496114_0119129
1364 Ga0496116_0000276
1365 Ga0496116_0000307
1366 Ga0496116_0000319
1367 Ga0496116_0005328
1368 Ga0496117_0000003
1369 Ga0496117_0000081
1370 Ga0496117_0000184
1371 Ga0496117_0001470
1372 Ga0496117_0002500
1373 Ga0496117_0007459
1374 Ga0496117_0027567
1375 Ga0496118_0000001
1376 Ga0496118_0000062
1377 Ga0496118_0000142
1378 Ga0496118_0000275
1379 Ga0496118_0002678
1380 Ga0496118_0004097
1381 Ga0496118_0009283
1382 Ga0496118_0015793
1383 Ga0496118_0020389
1384 Ga0496119_0001483
1385 Ga0496119_0003639
1386 Ga0496119_0004611
1387 Ga0496119_0005794
1388 Ga0496119_0009985
1389 Ga0496119_0025510
1390 Ga0496120_0001510
1391 Ga0496120_0002853
1392 Ga0496120_0005269
1393 Ga0496120_0010377
1394 Ga0496120_0023439
1395 Ga0496120_0024688
1396 Ga0496120_0053963
1397 Ga0496121_0000134
1398 Ga0496121_0000338
1399 Ga0496121_0001738
1400 Ga0496121_0004581
1401 Ga0496121_0010661
1402 Ga0496121_0019625
1403 Ga0496122_0000453
1404 Ga0496122_0009089
1405 Ga0496123_0009947
1406 Ga0496123_0011666
1407 Ga0496124_0000090
1408 Ga0496124_0000113
1409 Ga0496124_0005617
1410 Ga0496124_0011185
1411 Ga0496124_0014575
1412 Ga0496124_0051542
1413 Ga0496125_0000127
1414 Ga0496125_0003033
1415 Ga0496125_0003310
1416 Ga0496125_0005680
1417 Ga0496125_0007943
1418 Ga0496125_0064819
1419 Ga0496126_0000140
1420 Ga0496126_0000148
1421 Ga0496126_0000551
1422 Ga0496126_0005413
1423 Ga0496126_0017380
1424 Ga0496126_0042098
1425 Ga0496126_0052946
1426 Ga0501032_0006318
1427 Ga0501032_0044557
1428 Ga0501033_0000475
1429 Ga0501033_0031429
1430 Ga0501033_0034673
1431 Ga0501034_0001017
1432 Ga0501034_0001976
1433 Ga0501034_0138225
1434 Ga0501036_0008116
1435 Ga0501036_0031518
1436 Ga0501037_0005362
1437 Ga0501037_0114156
1438 Ga0501038_0010359
1439 Ga0501039_0016710
1440 Ga0501043_0009083
1441 Ga0501046_0001150
1442 Ga0501047_0019357
1443 Ga0501047_0071600
1444 Ga0501048_0004986
1445 Ga0501067_0017615
1446 Ga0501068_0001478
1447 Ga0501069_0021986
1448 Ga0501070_0001935
1449 Ga0501070_0003678
1450 Ga0501070_0003812
1451 Ga0501070_0008931
1452 Ga0501070_0065984
1453 Ga0501073_0001444
1454 Ga0501073_0018415
1455 Ga0501074_0029052
1456 Ga0501077_0008118
1457 Ga0501080_0002002
1458 Ga0501083_0059158
1459 Ga0501083_0062510
1460 Ga0501263_001300
1461 Ga0501035_0001692
1462 Ga0501044_0001637
1463 Ga0501044_0004131
1464 Ga0501044_0004356
1465 Ga0501044_0025358
1466 Ga0501044_0083864
1467 Ga0501226_000006
1468 nmdc:mga03683_31809_c1
1469 nmdc:mga03n38_16424_c1
1470 nmdc:mga00v17_20650_c1
1471 nmdc:mga00v17_5588_c1
1472 nmdc:mga00v17_8696_c2
1473 nmdc:mga0yw44_44898_c1
1474 nmdc:mga0yw44_9241_c1
1475 nmdc:mga07m45_21298_c1
1476 nmdc:mga07m45_22315_c1
1477 nmdc:mga07m45_6411_c1
1478 nmdc:mga05p37_64973_c1
1479 nmdc:mga08y16_22247_c1
1480 nmdc:mga08y16_62316_c1
1481 nmdc:mga0n895_162759_c1
1482 nmdc:mga0n895_54272_c1
1483 nmdc:mga0sz30_11458_c1
1484 nmdc:mga0sz30_1671_c1
1485 nmdc:mga0sz30_39163_c1
1486 nmdc:mga0sz30_636_c1
1487 Ga0495601_0004427
1488 Ga0500650_0018370
1489 Ga0500652_000004
1490 Ga0500652_018471
1491 Ga0500616_0000223
1492 Ga0500616_0004157
1493 Ga0500616_0022471
1494 Ga0500634_0000596
1495 Ga0500645_000063
1496 Ga0501082_0005048
1497 Ga0466962_0011356
1498 Ga0466962_0024644
1499 2508677596
1500 2511376276
1501 2517759231
1502 2526211544
1503 2528204729
1504 2528214755
1505 2546949703
1506 2551709155
1507 2551714076
1508 2551744209
1509 2579750607
1510 2579858246
1511 2597865012
1512 2597870867
1513 2599103628
1514 2599400141
1515 2599451529
1516 2599509349
1517 2599512701
1518 2599520052
1519 2599891377
1520 2599947556
1521 2601689728
1522 2619858951
1523 2620349990
1524 2621298430
1525 2626637029
1526 2643874394
1527 2644441181
1528 2644486461
1529 2644621849
1530 2644627261
1531 2644634998
1532 2671838027
1533 2676199556
1534 2677899800
1535 2686540058
1536 2686544524
1537 2689961857
1538 2689989914
1539 2710602889
1540 2723249760
1541 2729147524
1542 2738667672
1543 2738671187
1544 2738706140
1545 2738749581
1546 2738858621
1547 2738947211
1548 2739146742
1549 2739332960
1550 2753300207
1551 2772646171
1552 2774844134
1553 2774856183
1554 2774867845
1555 2808846541
1556 2808907448
1557 2808941475
1558 2808977342
1559 2808992497
1560 2816504865
1561 2817492421
1562 2829750589
1563 2834034534
1564 2837275816
1565 2842138383
1566 2842696160
1567 2842829480
1568 2842840939
1569 2846957312
1570 2848863348
1571 2852613273
1572 2852668991
1573 2855674941
1574 2855681807
1575 2856748321
1576 2857289628
1577 2858849411
1578 2858882438
1579 2858894607
1580 2858895626
1581 2860871526
1582 2861692945
1583 2868094425
1584 2869049992
1585 2869062291
1586 2869069597
1587 2880490920
1588 2880501591
1589 2889310680
1590 2891398203
1591 2891563632
1592 2894817758
1593 2895889194
1594 2902406405
1595 2902798402
1596 2902801569
1597 2902816946
1598 2902840120
1599 2908450921
1600 2913312692
1601 2915364521
1602 2919044375
1603 2919468968
1604 2920880483
1605 2928105766
1606 2929193528
1607 2929214990
1608 2929230103
1609 2931394873
1610 2939587255
1611 2939600495
1612 2945932430
1613 2946008634
1614 2946079789
1615 2947238839
1616 2984552281
1617 637880231
1618 640487397
1619 651175331
1620 8002778434
1621 8002790503
1622 8045866622
1623 8054111671
1624 8054290752
1625 8054350858
1626 8054474743
1627 8054507381
1628 8054566569
1629 8054709465
1630 8054728830
1631 8054734700
1632 8054915694
1633 8054923954
1634 8055160810
1635 8055822324
1636 8056135786
1637 8056153083
1638 8056161989

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00733

Asn_synthase

Asparagine synthase

293

641

0.95

PF13522

GATase_6

Glutamine amidotransferase domain

76

210

0.94

PF13537

GATase_7

Glutamine amidotransferase domain

91

216

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ct9-assembly2.cif.gz_C crystal structure of asparagine synthetase b from escherichia coli 0.8501 3 590
7ylz-assembly2.cif.gz_B unliganded form of hydroxyamidotransferase tsnb9 0.8468 2 590
1ct9-assembly1.cif.gz_D crystal structure of asparagine synthetase b from escherichia coli 0.8425 3 591
7ylz-assembly2.cif.gz_B unliganded form of hydroxyamidotransferase tsnb9 0.8385 2 590
7ylz-assembly1.cif.gz_A unliganded form of hydroxyamidotransferase tsnb9 0.8334 2 590
ID Description Score Start End Superfamily
af_Q86A01_14_228_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9368 18 212 3.60.20.10
af_P9WN33_15_198_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9219 15 179 3.60.20.10
af_Q7KTW9_18_204_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9176 21 220 3.60.20.10
af_P49090_1_193_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9062 1 224 3.60.20.10
af_P49090_1_193_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9018 1 224 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A0N8R332-F1-model_v4 asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) 0.9933 31 158 GO:0005829
AF-A0A1C3P6N4-F1-model_v4 asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) 0.9894 104 592 GO:0004066
GO:0005524
GO:0005829
GO:0006529
AF-A0A3M1WBL3-F1-model_v4 asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) 0.9882 1 268 GO:0004066
GO:0005524
GO:0005829
GO:0006529
AF-A0A831STF3-F1-model_v4 asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) 0.9868 1 591 GO:0004066
GO:0005524
GO:0005829
GO:0006529
AF-A0A1R4HTJ7-F1-model_v4 asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) 0.9868 1 591 GO:0004066
GO:0005524
GO:0005829
GO:0006529

Map