F482172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 454 | 1638 | 588 |
Family's Representative Sequence
| Representative Sequence | 3300026041|Ga0207639_10010424|Ga0207639_100104243 |
| Length | 650 |
| Sequence | VVLATNVFGGGAIRLPEVAGLTSSCAKGCLAHSNSKPDTTEESITICGIAGEIGRDRPADLAAVAAMTNCMVPRGPDGAGAWADRSVALGHRRLAIIDLSSSGHQPMHDPDLGLTVAFNGCIYNYPELRQQLLGKGYRFFSHSDTEVILKGYREWGERVVDHLKGMFAFAVAERDTGRVVLARDRLGVKPLYWCDVSDGDGAGAMRFASSLPALVAAGGVDTDLDPVALSHYLSFHSVVPAPRTILRGVRKLEPGTIMRVEPDGTRTQETYWEPVLERSQERAGWAEQDWEEAILASLRTAVERRLVADVPVGCLLSGGLDSSLIVGLLAEAGQHGLKTFSIGFEAAGGEEGDEFKYSDVIARHFGTDHHQIRIDTARMLPALSGAIGAMSEPMMSHDCVAFYLLSQEVSKHVKVVQSGQGADEIFAGYHWYPPMAHAGDDDPRAALSQYRKAFFDRDHEALNRLLQPRWRLDADVAGDYVLEHFSHPGAATATDRALRLDTTVMLVDDPVKRVDNMTMAWGLEGRVPFLDHELVELAATCPPELKTAYEGKGVLKEAARKVIPHEVIDRPKGYFPVPALKHLAGPYLELVNDALHGSAARDRGLFAKDAVDGLLADPNGSLTPLRGNPLWQIGLLELWLARHVDGVKSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 155 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 163 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 164 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 165 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 166 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 179 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 180 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 183 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 189 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 190 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 191 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 192 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 193 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 194 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 195 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 201 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 202 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 203 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 210 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 211 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 212 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 213 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 214 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 215 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 271 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 272 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 299 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 301 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 310 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 311 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 313 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 316 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 317 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 318 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 319 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 320 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 321 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 322 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 323 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 324 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 325 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 326 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 327 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 328 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 329 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 330 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 331 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 332 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 333 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 334 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 335 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 336 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 337 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 338 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 339 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 340 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 341 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 342 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 343 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 344 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 345 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 346 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 347 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 348 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 349 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 350 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 351 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 352 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 353 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 354 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 355 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 356 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 357 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 358 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 359 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 360 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 361 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 362 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 363 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 364 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 365 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 366 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 367 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 368 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 369 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 370 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 371 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 372 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 373 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 374 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 375 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 376 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 377 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 378 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 379 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 380 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 381 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 382 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 383 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 384 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 385 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 386 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 387 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 388 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 389 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 390 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 391 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 392 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 393 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 394 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 395 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 396 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 397 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 398 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 399 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 400 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 401 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 402 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 403 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 404 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 405 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 406 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 407 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 408 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 409 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 410 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 411 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 412 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 413 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 414 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 415 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 416 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 417 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 418 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 419 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 420 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 421 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 422 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 423 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 424 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 425 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 426 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 427 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 428 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 429 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 430 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 431 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 432 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 433 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 434 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 435 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 436 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 437 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 438 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 439 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 440 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 441 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 442 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 443 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 444 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 445 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 446 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 447 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 448 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 449 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 450 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 451 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 452 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 453 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 454 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.78 |
| Metatranscriptomes | 0.12 |
| Isolates | 17.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 7.2 |
| Nodule | 4.03 |
| Rhizoplane | 7.94 |
| Rhizosphere | 57.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207639_10010424 | 3300026041 | Bacteria | 6437 |
| 2 | rootH2_10015241 | 3300003320 | Bacteria | 50279 |
| 3 | Ga0055538_1000079 | 3300003751 | Bacteria | 85355 |
| 4 | Ga0055539_1000120 | 3300003752 | Bacteria | 85355 |
| 5 | Ga0055533_1000128 | 3300003756 | Bacteria | 85355 |
| 6 | Ga0055532_1000116 | 3300003758 | Bacteria | 85351 |
| 7 | Ga0055525_1000165 | 3300003759 | Bacteria | 85355 |
| 8 | Ga0055540_1000024 | 3300003792 | Bacteria | 199164 |
| 9 | Ga0055540_1002431 | 3300003792 | Bacteria | 9835 |
| 10 | Ga0055540_1004520 | 3300003792 | Bacteria | 6222 |
| 11 | Ga0055540_1007661 | 3300003792 | Bacteria | 4027 |
| 12 | Ga0055541_1000080 | 3300003841 | Bacteria | 85355 |
| 13 | Ga0065714_10002472 | 3300005288 | Bacteria | 23443 |
| 14 | Ga0070658_10035015 | 3300005327 | Bacteria | 4042 |
| 15 | Ga0070676_10017874 | 3300005328 | Bacteria | 3926 |
| 16 | Ga0070683_100172717 | 3300005329 | Bacteria | 2052 |
| 17 | Ga0070670_100000045 | 3300005331 | Bacteria | 140180 |
| 18 | Ga0070670_100148774 | 3300005331 | Bacteria | 2026 |
| 19 | Ga0070682_100007253 | 3300005337 | Bacteria | 6248 |
| 20 | Ga0070682_100067347 | 3300005337 | Bacteria | 2280 |
| 21 | Ga0070687_100030946 | 3300005343 | Bacteria | 2620 |
| 22 | Ga0070661_100006754 | 3300005344 | Bacteria | 7909 |
| 23 | Ga0070692_10048048 | 3300005345 | Bacteria | 2210 |
| 24 | Ga0070668_100000449 | 3300005347 | Bacteria | 27220 |
| 25 | Ga0070668_100001342 | 3300005347 | Bacteria | 17578 |
| 26 | Ga0070668_100019915 | 3300005347 | Bacteria | 5056 |
| 27 | Ga0070668_100028001 | 3300005347 | Bacteria | 4277 |
| 28 | Ga0070668_100084310 | 3300005347 | Bacteria | 2496 |
| 29 | Ga0070669_100025937 | 3300005353 | Bacteria | 4214 |
| 30 | Ga0070671_100003104 | 3300005355 | Bacteria | 12936 |
| 31 | Ga0070671_100028821 | 3300005355 | Bacteria | 4576 |
| 32 | Ga0070671_100044515 | 3300005355 | Bacteria | 3689 |
| 33 | Ga0070674_100001298 | 3300005356 | Bacteria | 13129 |
| 34 | Ga0070674_100024358 | 3300005356 | Bacteria | 3927 |
| 35 | Ga0070659_100035434 | 3300005366 | Bacteria | 3886 |
| 36 | Ga0070659_100087211 | 3300005366 | Bacteria | 2498 |
| 37 | Ga0070667_100000063 | 3300005367 | Bacteria | 138777 |
| 38 | Ga0070667_100039611 | 3300005367 | Bacteria | 3950 |
| 39 | Ga0070667_100116471 | 3300005367 | Bacteria | 2321 |
| 40 | Ga0070714_100006996 | 3300005435 | Bacteria | 8746 |
| 41 | Ga0070714_100033136 | 3300005435 | Bacteria | 4317 |
| 42 | Ga0070711_100002490 | 3300005439 | Bacteria | 10513 |
| 43 | Ga0070705_100009653 | 3300005440 | Bacteria | 4805 |
| 44 | Ga0070700_100009255 | 3300005441 | Bacteria | 5401 |
| 45 | Ga0070663_100005931 | 3300005455 | Bacteria | 7311 |
| 46 | Ga0070663_100092463 | 3300005455 | Bacteria | 2243 |
| 47 | Ga0070678_100001418 | 3300005456 | Bacteria | 12751 |
| 48 | Ga0070662_100048435 | 3300005457 | Bacteria | 3061 |
| 49 | Ga0070662_100066836 | 3300005457 | Bacteria | 2639 |
| 50 | Ga0068867_100005596 | 3300005459 | Bacteria | 8903 |
| 51 | Ga0070685_10009916 | 3300005466 | Bacteria | 4939 |
| 52 | Ga0068853_100000144 | 3300005539 | Bacteria | 48463 |
| 53 | Ga0068853_100014791 | 3300005539 | Bacteria | 6404 |
| 54 | Ga0070665_100000979 | 3300005548 | Bacteria | 36153 |
| 55 | Ga0070665_100008785 | 3300005548 | Bacteria | 10223 |
| 56 | Ga0070665_100012648 | 3300005548 | Bacteria | 8499 |
| 57 | Ga0070665_100017721 | 3300005548 | Bacteria | 7152 |
| 58 | Ga0070664_100009176 | 3300005564 | Bacteria | 8030 |
| 59 | Ga0068854_100021764 | 3300005578 | Bacteria | 4356 |
| 60 | Ga0068854_100037486 | 3300005578 | Bacteria | 3404 |
| 61 | Ga0070702_100014451 | 3300005615 | Bacteria | 4005 |
| 62 | Ga0068859_100000184 | 3300005617 | Bacteria | 61340 |
| 63 | Ga0068859_100001979 | 3300005617 | Bacteria | 20907 |
| 64 | Ga0068859_100006882 | 3300005617 | Bacteria | 11541 |
| 65 | Ga0068859_100012750 | 3300005617 | Bacteria | 8448 |
| 66 | Ga0068859_100102861 | 3300005617 | Bacteria | 2914 |
| 67 | Ga0068866_10001173 | 3300005718 | Bacteria | 11464 |
| 68 | Ga0068866_10021990 | 3300005718 | Bacteria | 2945 |
| 69 | Ga0068851_10000040 | 3300005834 | Bacteria | 93172 |
| 70 | Ga0068863_100000159 | 3300005841 | Bacteria | 71831 |
| 71 | Ga0068863_100000739 | 3300005841 | Bacteria | 32639 |
| 72 | Ga0068863_100008258 | 3300005841 | Bacteria | 10172 |
| 73 | Ga0068863_100009338 | 3300005841 | Bacteria | 9571 |
| 74 | Ga0068858_100000141 | 3300005842 | Bacteria | 76388 |
| 75 | Ga0068858_100010221 | 3300005842 | Bacteria | 8905 |
| 76 | Ga0068858_100031984 | 3300005842 | Bacteria | 4888 |
| 77 | Ga0068860_100000065 | 3300005843 | Bacteria | 186634 |
| 78 | Ga0068860_100014977 | 3300005843 | Bacteria | 7579 |
| 79 | Ga0068862_100000028 | 3300005844 | Bacteria | 184197 |
| 80 | Ga0068862_100000496 | 3300005844 | Bacteria | 41859 |
| 81 | Ga0068862_100021504 | 3300005844 | Bacteria | 5391 |
| 82 | Ga0081455_10052913 | 3300005937 | Bacteria | 3472 |
| 83 | Ga0081540_1021753 | 3300005983 | Bacteria | 3808 |
| 84 | Ga0081539_10000889 | 3300005985 | Bacteria | 57153 |
| 85 | Ga0081539_10003849 | 3300005985 | Bacteria | 17594 |
| 86 | Ga0081539_10005545 | 3300005985 | Bacteria | 12794 |
| 87 | Ga0081539_10008604 | 3300005985 | Bacteria | 8816 |
| 88 | Ga0075365_10003226 | 3300006038 | Bacteria | 8347 |
| 89 | Ga0075365_10004832 | 3300006038 | Bacteria | 7190 |
| 90 | Ga0075368_10003971 | 3300006042 | Bacteria | 4980 |
| 91 | Ga0075368_10006832 | 3300006042 | Bacteria | 4008 |
| 92 | Ga0075363_100001644 | 3300006048 | Bacteria | 8631 |
| 93 | Ga0075363_100007787 | 3300006048 | Bacteria | 4950 |
| 94 | Ga0075364_10004962 | 3300006051 | Bacteria | 7712 |
| 95 | Ga0075364_10005195 | 3300006051 | Bacteria | 7552 |
| 96 | Ga0075364_10018758 | 3300006051 | Bacteria | 4337 |
| 97 | Ga0075364_10028339 | 3300006051 | Bacteria | 3584 |
| 98 | Ga0070712_100005495 | 3300006175 | Bacteria | 7847 |
| 99 | Ga0075367_10006245 | 3300006178 | Bacteria | 6003 |
| 100 | Ga0075369_10000241 | 3300006186 | Bacteria | 16255 |
| 101 | Ga0075369_10002872 | 3300006186 | Bacteria | 6212 |
| 102 | Ga0075369_10026792 | 3300006186 | Bacteria | 2405 |
| 103 | Ga0097621_100130240 | 3300006237 | Bacteria | 2141 |
| 104 | Ga0075370_10013757 | 3300006353 | Bacteria | 4306 |
| 105 | Ga0075370_10049387 | 3300006353 | Bacteria | 2385 |
| 106 | Ga0068871_100075218 | 3300006358 | Bacteria | 2788 |
| 107 | Ga0075428_100003910 | 3300006844 | Bacteria | 16373 |
| 108 | Ga0075430_100040168 | 3300006846 | Bacteria | 3960 |
| 109 | Ga0075430_100079384 | 3300006846 | Bacteria | 2750 |
| 110 | Ga0068865_100000662 | 3300006881 | Bacteria | 19431 |
| 111 | Ga0097620_100000184 | 3300006931 | Bacteria | 61340 |
| 112 | Ga0097620_100001979 | 3300006931 | Bacteria | 20907 |
| 113 | Ga0097620_100006882 | 3300006931 | Bacteria | 11541 |
| 114 | Ga0097620_100012750 | 3300006931 | Bacteria | 8448 |
| 115 | Ga0097620_100102859 | 3300006931 | Bacteria | 2914 |
| 116 | Ga0105251_10001487 | 3300009011 | Bacteria | 20109 |
| 117 | Ga0105244_10005906 | 3300009036 | Bacteria | 8036 |
| 118 | Ga0105250_10000381 | 3300009092 | Bacteria | 33174 |
| 119 | Ga0105240_10115972 | 3300009093 | Bacteria | 3232 |
| 120 | Ga0111539_10001058 | 3300009094 | Bacteria | 36236 |
| 121 | Ga0105245_10006009 | 3300009098 | Bacteria | 10671 |
| 122 | Ga0105247_10000232 | 3300009101 | Bacteria | 53113 |
| 123 | Ga0105247_10000606 | 3300009101 | Bacteria | 29002 |
| 124 | Ga0105247_10000653 | 3300009101 | Bacteria | 27504 |
| 125 | Ga0105247_10003188 | 3300009101 | Bacteria | 10809 |
| 126 | Ga0114129_10028015 | 3300009147 | Bacteria | 7979 |
| 127 | Ga0105243_10000916 | 3300009148 | Bacteria | 27666 |
| 128 | Ga0105242_10000321 | 3300009176 | Bacteria | 38554 |
| 129 | Ga0105248_10000074 | 3300009177 | Bacteria | 114554 |
| 130 | Ga0105248_10000812 | 3300009177 | Bacteria | 35031 |
| 131 | Ga0105248_10002879 | 3300009177 | Bacteria | 19095 |
| 132 | Ga0105248_10022807 | 3300009177 | Bacteria | 6949 |
| 133 | Ga0105237_10001244 | 3300009545 | Bacteria | 33989 |
| 134 | Ga0105237_10015275 | 3300009545 | Bacteria | 7997 |
| 135 | Ga0105237_10033771 | 3300009545 | Bacteria | 5183 |
| 136 | Ga0105238_10033151 | 3300009551 | Bacteria | 5255 |
| 137 | Ga0105249_10000011 | 3300009553 | Bacteria | 292812 |
| 138 | Ga0105249_10087755 | 3300009553 | Bacteria | 2903 |
| 139 | Ga0105239_10027928 | 3300010375 | Bacteria | 6208 |
| 140 | Ga0105239_10030661 | 3300010375 | Bacteria | 5915 |
| 141 | Ga0105239_10088169 | 3300010375 | Bacteria | 3421 |
| 142 | Ga0105246_10000513 | 3300011119 | Bacteria | 21097 |
| 143 | Ga0105246_10013913 | 3300011119 | Bacteria | 5051 |
| 144 | Ga0157373_10001051 | 3300013100 | Bacteria | 21283 |
| 145 | Ga0157373_10004203 | 3300013100 | Bacteria | 10860 |
| 146 | Ga0157373_10015031 | 3300013100 | Bacteria | 5662 |
| 147 | Ga0157371_10001356 | 3300013102 | Bacteria | 25744 |
| 148 | Ga0157371_10094442 | 3300013102 | Bacteria | 2119 |
| 149 | Ga0157370_10000649 | 3300013104 | Bacteria | 43350 |
| 150 | Ga0157370_10070452 | 3300013104 | Bacteria | 3300 |
| 151 | Ga0157370_10156697 | 3300013104 | Bacteria | 2119 |
| 152 | Ga0157369_10008322 | 3300013105 | Bacteria | 11889 |
| 153 | Ga0157369_10009567 | 3300013105 | Bacteria | 11087 |
| 154 | Ga0157378_10005790 | 3300013297 | Bacteria | 10830 |
| 155 | Ga0157372_10078811 | 3300013307 | Bacteria | 3723 |
| 156 | Ga0157372_10131802 | 3300013307 | Bacteria | 2876 |
| 157 | Ga0157375_10000539 | 3300013308 | Bacteria | 33984 |
| 158 | Ga0157375_10006212 | 3300013308 | Bacteria | 10403 |
| 159 | Ga0163163_10000528 | 3300014325 | Bacteria | 34012 |
| 160 | Ga0163163_10034600 | 3300014325 | Bacteria | 4895 |
| 161 | Ga0157380_10004453 | 3300014326 | Bacteria | 9700 |
| 162 | Ga0182008_10005229 | 3300014497 | Bacteria | 7432 |
| 163 | Ga0157379_10000730 | 3300014968 | Bacteria | 26590 |
| 164 | Ga0157379_10018275 | 3300014968 | Bacteria | 6179 |
| 165 | Ga0157379_10078828 | 3300014968 | Bacteria | 2950 |
| 166 | Ga0157376_10050752 | 3300014969 | Bacteria | 3443 |
| 167 | Ga0182006_1000561 | 3300015261 | Bacteria | 27855 |
| 168 | Ga0182007_10000945 | 3300015262 | Bacteria | 15982 |
| 169 | Ga0163161_10011606 | 3300017792 | Bacteria | 6117 |
| 170 | Ga0213872_10000559 | 3300021361 | Bacteria | 28845 |
| 171 | Ga0213872_10000896 | 3300021361 | Bacteria | 21421 |
| 172 | Ga0213872_10001399 | 3300021361 | Bacteria | 15889 |
| 173 | Ga0213874_10000129 | 3300021377 | Bacteria | 12670 |
| 174 | Ga0213876_10000839 | 3300021384 | Bacteria | 20663 |
| 175 | Ga0213876_10023512 | 3300021384 | Bacteria | 3256 |
| 176 | Ga0213875_10030200 | 3300021388 | Bacteria | 2567 |
| 177 | Ga0224712_10031778 | 3300022467 | Bacteria | 1918 |
| 178 | Ga0209784_100017 | 3300025224 | Bacteria | 472003 |
| 179 | Ga0209566_100014 | 3300025225 | Bacteria | 472003 |
| 180 | Ga0209674_100028 | 3300025226 | Bacteria | 472003 |
| 181 | Ga0209147_100105 | 3300025229 | Bacteria | 157437 |
| 182 | Ga0209563_100032 | 3300025230 | Bacteria | 472003 |
| 183 | Ga0209258_100194 | 3300025242 | Bacteria | 124587 |
| 184 | Ga0209646_1000416 | 3300025246 | Bacteria | 24235 |
| 185 | Ga0209677_100018 | 3300025253 | Bacteria | 472003 |
| 186 | Ga0209051_1000021 | 3300025303 | Bacteria | 507633 |
| 187 | Ga0209051_1002711 | 3300025303 | Bacteria | 12317 |
| 188 | Ga0209051_1012203 | 3300025303 | Bacteria | 4169 |
| 189 | Ga0209051_1015472 | 3300025303 | Bacteria | 3506 |
| 190 | Ga0207656_10000047 | 3300025321 | Bacteria | 46771 |
| 191 | Ga0207696_1000043 | 3300025711 | Bacteria | 307112 |
| 192 | Ga0207655_1000407 | 3300025728 | Bacteria | 59248 |
| 193 | Ga0207713_1001287 | 3300025735 | Bacteria | 20678 |
| 194 | Ga0207692_10006494 | 3300025898 | Bacteria | 4744 |
| 195 | Ga0207642_10002300 | 3300025899 | Bacteria | 5952 |
| 196 | Ga0207710_10000022 | 3300025900 | Bacteria | 335632 |
| 197 | Ga0207710_10000175 | 3300025900 | Bacteria | 65485 |
| 198 | Ga0207710_10000427 | 3300025900 | Bacteria | 27512 |
| 199 | Ga0207688_10026388 | 3300025901 | Bacteria | 3194 |
| 200 | Ga0207680_10023956 | 3300025903 | Bacteria | 3342 |
| 201 | Ga0207680_10064718 | 3300025903 | Bacteria | 2243 |
| 202 | Ga0207647_10034064 | 3300025904 | Bacteria | 3255 |
| 203 | Ga0207671_10001896 | 3300025914 | Bacteria | 23245 |
| 204 | Ga0207671_10007963 | 3300025914 | Bacteria | 9078 |
| 205 | Ga0207671_10035963 | 3300025914 | Bacteria | 3672 |
| 206 | Ga0207693_10004928 | 3300025915 | Bacteria | 11215 |
| 207 | Ga0207663_10013385 | 3300025916 | Bacteria | 4458 |
| 208 | Ga0207649_10000237 | 3300025920 | Bacteria | 45073 |
| 209 | Ga0207681_10001233 | 3300025923 | Bacteria | 16482 |
| 210 | Ga0207694_10038868 | 3300025924 | Bacteria | 3659 |
| 211 | Ga0207650_10000135 | 3300025925 | Bacteria | 90396 |
| 212 | Ga0207650_10000425 | 3300025925 | Bacteria | 37178 |
| 213 | Ga0207687_10035703 | 3300025927 | Bacteria | 3383 |
| 214 | Ga0207664_10003061 | 3300025929 | Bacteria | 11113 |
| 215 | Ga0207664_10028828 | 3300025929 | Bacteria | 4222 |
| 216 | Ga0207644_10003823 | 3300025931 | Bacteria | 9749 |
| 217 | Ga0207644_10048597 | 3300025931 | Bacteria | 3034 |
| 218 | Ga0207706_10000460 | 3300025933 | Bacteria | 43393 |
| 219 | Ga0207706_10002365 | 3300025933 | Bacteria | 18429 |
| 220 | Ga0207706_10058048 | 3300025933 | Bacteria | 3410 |
| 221 | Ga0207669_10001460 | 3300025937 | Bacteria | 10076 |
| 222 | Ga0207704_10001025 | 3300025938 | Bacteria | 12409 |
| 223 | Ga0207665_10002351 | 3300025939 | Bacteria | 12764 |
| 224 | Ga0207665_10028753 | 3300025939 | Bacteria | 3674 |
| 225 | Ga0207665_10032302 | 3300025939 | Bacteria | 3466 |
| 226 | Ga0207691_10099235 | 3300025940 | Bacteria | 2600 |
| 227 | Ga0207711_10000149 | 3300025941 | Bacteria | 74062 |
| 228 | Ga0207711_10000182 | 3300025941 | Bacteria | 67307 |
| 229 | Ga0207711_10017686 | 3300025941 | Bacteria | 5922 |
| 230 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 231 | Ga0207712_10000020 | 3300025961 | Bacteria | 292796 |
| 232 | Ga0207658_10000661 | 3300025986 | Bacteria | 30096 |
| 233 | Ga0207658_10000705 | 3300025986 | Bacteria | 29012 |
| 234 | Ga0207703_10000147 | 3300026035 | Bacteria | 82822 |
| 235 | Ga0207703_10025897 | 3300026035 | Bacteria | 4615 |
| 236 | Ga0207639_10002316 | 3300026041 | Bacteria | 12782 |
| 237 | Ga0207639_10025141 | 3300026041 | Bacteria | 4317 |
| 238 | Ga0207678_10005859 | 3300026067 | Bacteria | 10955 |
| 239 | Ga0207678_10047531 | 3300026067 | Bacteria | 3711 |
| 240 | Ga0207708_10005631 | 3300026075 | Bacteria | 9247 |
| 241 | Ga0207641_10000156 | 3300026088 | Bacteria | 97171 |
| 242 | Ga0207641_10004176 | 3300026088 | Bacteria | 12581 |
| 243 | Ga0207641_10008873 | 3300026088 | Bacteria | 8302 |
| 244 | Ga0207641_10115382 | 3300026088 | Bacteria | 2388 |
| 245 | Ga0207648_10005870 | 3300026089 | Bacteria | 12283 |
| 246 | Ga0207648_10012427 | 3300026089 | Bacteria | 7971 |
| 247 | Ga0207648_10022324 | 3300026089 | Bacteria | 5686 |
| 248 | Ga0207675_100004842 | 3300026118 | Bacteria | 12969 |
| 249 | Ga0207675_100080124 | 3300026118 | Bacteria | 3061 |
| 250 | Ga0209371_1002155 | 3300027312 | Bacteria | 11562 |
| 251 | Ga0209983_1001711 | 3300027665 | Bacteria | 4851 |
| 252 | Ga0209971_1000393 | 3300027682 | Bacteria | 11931 |
| 253 | Ga0207428_10004305 | 3300027907 | Bacteria | 13594 |
| 254 | Ga0268266_10002989 | 3300028379 | Bacteria | 17433 |
| 255 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 256 | Ga0268265_10000413 | 3300028380 | Bacteria | 45876 |
| 257 | Ga0268265_10008623 | 3300028380 | Bacteria | 6890 |
| 258 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 259 | Ga0268264_10020535 | 3300028381 | Bacteria | 5397 |
| 260 | Ga0268264_10150495 | 3300028381 | Bacteria | 2086 |
| 261 | Ga0265334_10006625 | 3300028573 | Bacteria | 4980 |
| 262 | Ga0265336_10001076 | 3300028666 | Bacteria | 13243 |
| 263 | Ga0307515_10000478 | 3300028794 | Bacteria | 95304 |
| 264 | Ga0307515_10013912 | 3300028794 | Bacteria | 14979 |
| 265 | Ga0307515_10088731 | 3300028794 | Bacteria | 3904 |
| 266 | Ga0265324_10000006 | 3300029957 | Bacteria | 267048 |
| 267 | Ga0307511_10035520 | 3300030521 | Bacteria | 4350 |
| 268 | Ga0307512_10009183 | 3300030522 | Bacteria | 9555 |
| 269 | Ga0307512_10036044 | 3300030522 | Bacteria | 4202 |
| 270 | Ga0265325_10000389 | 3300031241 | Bacteria | 31049 |
| 271 | Ga0265340_10006669 | 3300031247 | Bacteria | 6326 |
| 272 | Ga0265331_10019738 | 3300031250 | Bacteria | 3475 |
| 273 | Ga0265327_10002866 | 3300031251 | Bacteria | 17361 |
| 274 | Ga0307513_10000354 | 3300031456 | Bacteria | 66910 |
| 275 | Ga0307513_10013021 | 3300031456 | Bacteria | 10232 |
| 276 | Ga0307513_10034534 | 3300031456 | Bacteria | 5673 |
| 277 | Ga0307509_10117635 | 3300031507 | Bacteria | 2644 |
| 278 | Ga0307508_10009642 | 3300031616 | Bacteria | 8870 |
| 279 | Ga0307508_10017511 | 3300031616 | Bacteria | 6514 |
| 280 | Ga0316575_10004993 | 3300031665 | Bacteria | 4694 |
| 281 | Ga0316575_10032784 | 3300031665 | Bacteria | 2036 |
| 282 | Ga0316579_10003353 | 3300031691 | Bacteria | 6227 |
| 283 | Ga0316579_10004069 | 3300031691 | Bacteria | 5773 |
| 284 | Ga0316579_10017411 | 3300031691 | Bacteria | 3149 |
| 285 | Ga0316579_10023098 | 3300031691 | Bacteria | 2788 |
| 286 | Ga0316576_10000081 | 3300031727 | Bacteria | 32958 |
| 287 | Ga0316576_10000785 | 3300031727 | Bacteria | 15940 |
| 288 | Ga0316576_10003569 | 3300031727 | Bacteria | 9160 |
| 289 | Ga0316576_10003570 | 3300031727 | Bacteria | 9160 |
| 290 | Ga0316576_10024306 | 3300031727 | Bacteria | 4229 |
| 291 | Ga0316576_10061297 | 3300031727 | Bacteria | 2757 |
| 292 | Ga0316578_10000343 | 3300031728 | Bacteria | 14685 |
| 293 | Ga0316578_10001427 | 3300031728 | Bacteria | 9687 |
| 294 | Ga0316578_10002325 | 3300031728 | Bacteria | 8274 |
| 295 | Ga0316578_10002609 | 3300031728 | Bacteria | 7987 |
| 296 | Ga0316578_10003048 | 3300031728 | Bacteria | 7556 |
| 297 | Ga0316578_10035391 | 3300031728 | Bacteria | 2871 |
| 298 | Ga0316578_10051782 | 3300031728 | Bacteria | 2405 |
| 299 | Ga0307516_10000433 | 3300031730 | Bacteria | 54987 |
| 300 | Ga0307516_10040295 | 3300031730 | Bacteria | 4651 |
| 301 | Ga0307516_10043788 | 3300031730 | Bacteria | 4433 |
| 302 | Ga0307516_10064937 | 3300031730 | Bacteria | 3527 |
| 303 | Ga0307405_10006782 | 3300031731 | Bacteria | 5666 |
| 304 | Ga0307405_10019490 | 3300031731 | Bacteria | 3770 |
| 305 | Ga0316577_10000205 | 3300031733 | Bacteria | 19951 |
| 306 | Ga0316577_10000819 | 3300031733 | Bacteria | 13539 |
| 307 | Ga0316577_10002280 | 3300031733 | Bacteria | 9450 |
| 308 | Ga0316577_10002634 | 3300031733 | Bacteria | 8909 |
| 309 | Ga0307410_10012605 | 3300031852 | Bacteria | 4897 |
| 310 | Ga0307410_10077164 | 3300031852 | Bacteria | 2328 |
| 311 | Ga0326468_10000068 | 3300031889 | Bacteria | 8456 |
| 312 | Ga0307406_10032212 | 3300031901 | Bacteria | 3199 |
| 313 | Ga0307406_10033170 | 3300031901 | Bacteria | 3158 |
| 314 | Ga0307406_10070434 | 3300031901 | Bacteria | 2290 |
| 315 | Ga0307407_10003980 | 3300031903 | Bacteria | 6175 |
| 316 | Ga0307407_10033356 | 3300031903 | Bacteria | 2809 |
| 317 | Ga0307409_100005183 | 3300031995 | Bacteria | 7454 |
| 318 | Ga0307409_100007127 | 3300031995 | Bacteria | 6657 |
| 319 | Ga0307409_100026708 | 3300031995 | Bacteria | 4077 |
| 320 | Ga0307416_100036002 | 3300032002 | Bacteria | 3789 |
| 321 | Ga0307416_100056126 | 3300032002 | Bacteria | 3176 |
| 322 | Ga0307416_100087235 | 3300032002 | Bacteria | 2663 |
| 323 | Ga0307414_10062673 | 3300032004 | Bacteria | 2640 |
| 324 | Ga0307415_100005072 | 3300032126 | Bacteria | 6935 |
| 325 | Ga0307415_100014478 | 3300032126 | Bacteria | 4639 |
| 326 | Ga0307415_100086577 | 3300032126 | Bacteria | 2255 |
| 327 | Ga0316583_10000620 | 3300032133 | Bacteria | 10846 |
| 328 | Ga0316583_10000654 | 3300032133 | Bacteria | 10633 |
| 329 | Ga0316583_10001929 | 3300032133 | Bacteria | 7088 |
| 330 | Ga0316583_10004646 | 3300032133 | Bacteria | 4902 |
| 331 | Ga0316585_10000314 | 3300032137 | Bacteria | 10861 |
| 332 | Ga0373951_0000033 | 3300035091 | Bacteria | 54195 |
| 333 | Ga0316574_0001916 | 3300035398 | Bacteria | 10187 |
| 334 | Ga0316574_0023265 | 3300035398 | Bacteria | 3699 |
| 335 | Ga0316574_0027430 | 3300035398 | Bacteria | 3431 |
| 336 | Ga0316574_0035073 | 3300035398 | Bacteria | 3064 |
| 337 | Ga0316574_0035884 | 3300035398 | Bacteria | 3033 |
| 338 | Ga0316574_0072459 | 3300035398 | Bacteria | 2177 |
| 339 | Ga0316582_0001990 | 3300036647 | Bacteria | 9366 |
| 340 | Ga0316582_0004202 | 3300036647 | Bacteria | 7224 |
| 341 | Ga0316582_0013534 | 3300036647 | Bacteria | 4596 |
| 342 | Ga0316582_0019043 | 3300036647 | Bacteria | 4010 |
| 343 | Ga0316582_0025264 | 3300036647 | Bacteria | 3565 |
| 344 | Ga0316582_0068815 | 3300036647 | Bacteria | 2287 |
| 345 | Ga0316584_0000228 | 3300036712 | Bacteria | 27809 |
| 346 | Ga0316584_0006308 | 3300036712 | Bacteria | 8031 |
| 347 | Ga0316584_0013448 | 3300036712 | Bacteria | 5792 |
| 348 | Ga0316584_0016479 | 3300036712 | Bacteria | 5296 |
| 349 | Ga0316584_0047828 | 3300036712 | Bacteria | 3196 |
| 350 | Ga0316584_0050913 | 3300036712 | Bacteria | 3097 |
| 351 | Ga0316584_0066774 | 3300036712 | Bacteria | 2695 |
| 352 | Ga0395898_0050215 | 3300037466 | Bacteria | 4083 |
| 353 | Ga0395905_0043769 | 3300037471 | Bacteria | 4200 |
| 354 | Ga0436364_0001062 | 3300037853 | Bacteria | 1952 |
| 355 | Ga0436364_0256774 | 3300037853 | Bacteria | 34884 |
| 356 | Ga0436364_0873566 | 3300037853 | Bacteria | 7188 |
| 357 | Ga0436364_1208595 | 3300037853 | Unclassified | 2848 |
| 358 | Ga0395901_0034137 | 3300038443 | Bacteria | 5253 |
| 359 | Ga0400484_00882 | 3300038725 | Bacteria | 4884 |
| 360 | Ga0400484_05567 | 3300038725 | Bacteria | 13433 |
| 361 | Ga0400490_02928 | 3300038726 | Bacteria | 4438 |
| 362 | Ga0400485_05559 | 3300038735 | Bacteria | 72885 |
| 363 | Ga0400485_13786 | 3300038735 | Bacteria | 18010 |
| 364 | Ga0400488_02552 | 3300038741 | Bacteria | 6726 |
| 365 | Ga0400488_15424 | 3300038741 | Bacteria | 5471 |
| 366 | Ga0400488_16979 | 3300038741 | Bacteria | 10596 |
| 367 | Ga0400488_19971 | 3300038741 | Bacteria | 3284 |
| 368 | Ga0400488_35558 | 3300038741 | Bacteria | 3307 |
| 369 | Ga0400486_06092 | 3300038742 | Bacteria | 9406 |
| 370 | Ga0400486_08934 | 3300038742 | Bacteria | 14468 |
| 371 | Ga0400486_19627 | 3300038742 | Bacteria | 369894 |
| 372 | Ga0400483_036359 | 3300039062 | Bacteria | 6602 |
| 373 | Ga0400483_046106 | 3300039062 | Bacteria | 3526 |
| 374 | Ga0400483_068223 | 3300039062 | Bacteria | 3095 |
| 375 | Ga0400483_133356 | 3300039062 | Bacteria | 4137 |
| 376 | Ga0400483_157927 | 3300039062 | Bacteria | 3039 |
| 377 | Ga0400483_164641 | 3300039062 | Bacteria | 2216 |
| 378 | Ga0400483_183708 | 3300039062 | Bacteria | 3757 |
| 379 | Ga0400483_287287 | 3300039062 | Bacteria | 8379 |
| 380 | Ga0400489_77073 | 3300039093 | Bacteria | 3416 |
| 381 | Ga0400489_87471 | 3300039093 | Bacteria | 26149 |
| 382 | Ga0400487_04208 | 3300039110 | Bacteria | 3634 |
| 383 | Ga0400487_09727 | 3300039110 | Bacteria | 45843 |
| 384 | Ga0400487_22364 | 3300039110 | Bacteria | 3406 |
| 385 | Ga0400487_27920 | 3300039110 | Bacteria | 22272 |
| 386 | Ga0400487_38476 | 3300039110 | Bacteria | 8668 |
| 387 | Ga0400487_59567 | 3300039110 | Bacteria | 21421 |
| 388 | Ga0436365_0015250 | 3300039437 | Bacteria | 5764 |
| 389 | Ga0436365_0350974 | 3300039437 | Bacteria | 14303 |
| 390 | Ga0436365_0529637 | 3300039437 | Bacteria | 32938 |
| 391 | Ga0436365_1823845 | 3300039437 | Bacteria | 75216 |
| 392 | Ga0436361_0020532 | 3300039447 | Bacteria | 44080 |
| 393 | Ga0436361_0142459 | 3300039447 | Bacteria | 45175 |
| 394 | Ga0436361_0450698 | 3300039447 | Bacteria | 8556 |
| 395 | Ga0436361_0572145 | 3300039447 | Bacteria | 42313 |
| 396 | Ga0436361_0884959 | 3300039447 | Bacteria | 2874 |
| 397 | Ga0436361_0889231 | 3300039447 | Bacteria | 2189 |
| 398 | Ga0436363_0370824 | 3300039450 | Bacteria | 44745 |
| 399 | Ga0436362_0832574 | 3300039453 | Bacteria | 2961 |
| 400 | Ga0439461_0004639 | 3300041410 | Bacteria | 2304 |
| 401 | Ga0439466_0006798 | 3300041411 | Bacteria | 4338 |
| 402 | Ga0439465_0003836 | 3300041413 | Bacteria | 4904 |
| 403 | Ga0439465_0020559 | 3300041413 | Bacteria | 2068 |
| 404 | Ga0451791_0014186 | 3300041451 | Bacteria | 8314 |
| 405 | Ga0451793_0408605 | 3300041452 | Bacteria | 20799 |
| 406 | Ga0451795_1123441 | 3300041456 | Bacteria | 2495 |
| 407 | Ga0451807_1611397 | 3300041486 | Bacteria | 2593 |
| 408 | Ga0451847_0303602 | 3300041503 | Bacteria | 2099 |
| 409 | Ga0451853_0247559 | 3300041512 | Bacteria | 4709 |
| 410 | Ga0451853_2525222 | 3300041512 | Bacteria | 6680 |
| 411 | Ga0439432_000002 | 3300042006 | Bacteria | 117808 |
| 412 | Ga0439432_001309 | 3300042006 | Bacteria | 9425 |
| 413 | Ga0450911_000007 | 3300042115 | Bacteria | 212322 |
| 414 | Ga0450903_000224 | 3300042138 | Bacteria | 12598 |
| 415 | Ga0450904_000573 | 3300042139 | Bacteria | 6883 |
| 416 | Ga0439434_0002295 | 3300042435 | Bacteria | 5557 |
| 417 | Ga0439435_0005161 | 3300042436 | Bacteria | 2859 |
| 418 | Ga0439459_0000372 | 3300042438 | Bacteria | 5580 |
| 419 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 420 | Ga0451577_0002234 | 3300042876 | Bacteria | 23544 |
| 421 | Ga0451577_0010358 | 3300042876 | Bacteria | 8920 |
| 422 | Ga0451577_0042406 | 3300042876 | Bacteria | 4081 |
| 423 | Ga0451577_0062387 | 3300042876 | Bacteria | 3324 |
| 424 | Ga0466972_0007425 | 3300044658 | Bacteria | 5511 |
| 425 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 426 | Ga0466965_0001172 | 3300044683 | Bacteria | 10315 |
| 427 | Ga0466965_0004675 | 3300044683 | Bacteria | 6104 |
| 428 | Ga0466965_0006938 | 3300044683 | Bacteria | 5182 |
| 429 | Ga0466966_0021386 | 3300044684 | Bacteria | 4247 |
| 430 | Ga0466966_0050249 | 3300044684 | Bacteria | 2653 |
| 431 | Ga0466966_0087701 | 3300044684 | Bacteria | 1934 |
| 432 | Ga0466961_0022978 | 3300044693 | Bacteria | 4011 |
| 433 | Ga0466961_0064401 | 3300044693 | Bacteria | 2329 |
| 434 | Ga0466964_0015739 | 3300044706 | Bacteria | 2879 |
| 435 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 436 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 437 | Ga0453684_0000163 | 3300044712 | Bacteria | 296196 |
| 438 | Ga0453684_0005489 | 3300044712 | Bacteria | 25077 |
| 439 | Ga0453684_0006674 | 3300044712 | Bacteria | 21779 |
| 440 | Ga0466971_0004692 | 3300044719 | Bacteria | 5907 |
| 441 | Ga0466968_0001457 | 3300044735 | Bacteria | 8493 |
| 442 | Ga0466970_0007319 | 3300044765 | Bacteria | 5530 |
| 443 | Ga0466970_0025262 | 3300044765 | Bacteria | 3110 |
| 444 | Ga0466970_0065875 | 3300044765 | Bacteria | 1944 |
| 445 | Ga0466957_0001918 | 3300044842 | Bacteria | 11039 |
| 446 | Ga0466957_0004044 | 3300044842 | Bacteria | 8119 |
| 447 | Ga0466960_0000590 | 3300044901 | Bacteria | 12546 |
| 448 | Ga0466960_0000674 | 3300044901 | Bacteria | 11863 |
| 449 | Ga0466960_0005162 | 3300044901 | Bacteria | 5163 |
| 450 | Ga0466960_0007616 | 3300044901 | Bacteria | 4407 |
| 451 | Ga0466960_0007720 | 3300044901 | Bacteria | 4381 |
| 452 | Ga0466960_0008993 | 3300044901 | Bacteria | 4106 |
| 453 | Ga0466960_0009846 | 3300044901 | Bacteria | 3953 |
| 454 | Ga0466959_0004025 | 3300045049 | Bacteria | 9766 |
| 455 | Ga0466959_0028893 | 3300045049 | Bacteria | 4109 |
| 456 | Ga0466959_0035720 | 3300045049 | Bacteria | 3673 |
| 457 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 458 | Ga0451576_0000304 | 3300045051 | Bacteria | 119160 |
| 459 | Ga0451576_0002902 | 3300045051 | Bacteria | 24467 |
| 460 | Ga0451576_0004546 | 3300045051 | Bacteria | 17966 |
| 461 | Ga0451576_0004616 | 3300045051 | Bacteria | 17777 |
| 462 | Ga0451576_0022990 | 3300045051 | Bacteria | 6756 |
| 463 | Ga0451576_0035808 | 3300045051 | Bacteria | 5264 |
| 464 | Ga0451576_0039541 | 3300045051 | Bacteria | 4992 |
| 465 | Ga0451576_0053617 | 3300045051 | Bacteria | 4223 |
| 466 | Ga0451576_0117151 | 3300045051 | Bacteria | 2773 |
| 467 | Ga0466958_0000314 | 3300045836 | Bacteria | 19212 |
| 468 | Ga0466958_0077465 | 3300045836 | Bacteria | 2042 |
| 469 | Ga0466967_0001537 | 3300045976 | Bacteria | 13501 |
| 470 | Ga0466967_0028981 | 3300045976 | Bacteria | 4628 |
| 471 | Ga0466967_0029651 | 3300045976 | Bacteria | 4582 |
| 472 | Ga0466967_0042705 | 3300045976 | Bacteria | 3920 |
| 473 | Ga0466967_0044720 | 3300045976 | Bacteria | 3843 |
| 474 | Ga0466967_0119127 | 3300045976 | Bacteria | 2436 |
| 475 | Ga0495627_001093 | 3300046453 | Bacteria | 17709 |
| 476 | Ga0495638_0000853 | 3300046460 | Bacteria | 31744 |
| 477 | Ga0495607_0003237 | 3300046501 | Bacteria | 12550 |
| 478 | Ga0495583_0002227 | 3300046506 | Bacteria | 17109 |
| 479 | Ga0495606_0005869 | 3300046507 | Bacteria | 11562 |
| 480 | Ga0495606_0036423 | 3300046507 | Bacteria | 3351 |
| 481 | Ga0495610_0002466 | 3300046512 | Bacteria | 15539 |
| 482 | Ga0495648_0008982 | 3300046524 | Bacteria | 7805 |
| 483 | Ga0495654_0000631 | 3300046530 | Bacteria | 27787 |
| 484 | Ga0495625_0056797 | 3300046660 | Bacteria | 2785 |
| 485 | Ga0495661_0001357 | 3300046665 | Bacteria | 20682 |
| 486 | Ga0495649_0025811 | 3300046694 | Bacteria | 3272 |
| 487 | Ga0495581_0024166 | 3300047315 | Bacteria | 3522 |
| 488 | Ga0495672_0001067 | 3300047320 | Bacteria | 27912 |
| 489 | Ga0495679_001026 | 3300047446 | Bacteria | 17130 |
| 490 | Ga0495593_0038245 | 3300047673 | Bacteria | 2592 |
| 491 | Ga0495593_0070021 | 3300047673 | Bacteria | 1823 |
| 492 | Ga0495626_0021458 | 3300048091 | Bacteria | 3205 |
| 493 | Ga0496100_0000150 | 3300048903 | Bacteria | 38678 |
| 494 | Ga0496100_0002709 | 3300048903 | Bacteria | 9053 |
| 495 | Ga0496100_0003753 | 3300048903 | Bacteria | 7954 |
| 496 | Ga0496100_0008113 | 3300048903 | Bacteria | 5843 |
| 497 | Ga0496101_0000102 | 3300048904 | Bacteria | 88779 |
| 498 | Ga0496101_0000103 | 3300048904 | Bacteria | 88726 |
| 499 | Ga0496101_0002821 | 3300048904 | Bacteria | 10678 |
| 500 | Ga0496101_0003030 | 3300048904 | Bacteria | 10362 |
| 501 | Ga0496102_0000028 | 3300048905 | Bacteria | 224124 |
| 502 | Ga0496102_0000037 | 3300048905 | Bacteria | 199368 |
| 503 | Ga0496102_0000256 | 3300048905 | Bacteria | 69381 |
| 504 | Ga0496102_0008315 | 3300048905 | Bacteria | 8891 |
| 505 | Ga0496102_0048148 | 3300048905 | Bacteria | 3876 |
| 506 | Ga0496102_0051205 | 3300048905 | Bacteria | 3762 |
| 507 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 508 | Ga0496103_0000024 | 3300048906 | Bacteria | 223336 |
| 509 | Ga0496103_0000675 | 3300048906 | Bacteria | 25646 |
| 510 | Ga0496103_0001077 | 3300048906 | Bacteria | 19064 |
| 511 | Ga0496104_0001814 | 3300048907 | Bacteria | 18528 |
| 512 | Ga0496104_0003980 | 3300048907 | Bacteria | 12797 |
| 513 | Ga0496105_0001717 | 3300048908 | Bacteria | 15651 |
| 514 | Ga0496105_0017030 | 3300048908 | Bacteria | 5817 |
| 515 | Ga0496105_0053050 | 3300048908 | Bacteria | 3349 |
| 516 | Ga0496106_0000661 | 3300048909 | Bacteria | 24693 |
| 517 | Ga0496106_0001446 | 3300048909 | Bacteria | 17814 |
| 518 | Ga0496107_0000421 | 3300048910 | Bacteria | 22921 |
| 519 | Ga0496107_0002750 | 3300048910 | Bacteria | 11569 |
| 520 | Ga0496108_0000007 | 3300048911 | Bacteria | 351492 |
| 521 | Ga0496108_0002933 | 3300048911 | Bacteria | 13712 |
| 522 | Ga0496108_0028307 | 3300048911 | Bacteria | 4636 |
| 523 | Ga0496108_0048432 | 3300048911 | Bacteria | 3554 |
| 524 | Ga0496109_0000936 | 3300048912 | Bacteria | 24158 |
| 525 | Ga0496109_0029690 | 3300048912 | Bacteria | 4898 |
| 526 | Ga0496109_0054810 | 3300048912 | Bacteria | 3636 |
| 527 | Ga0496110_0033500 | 3300048913 | Bacteria | 4443 |
| 528 | Ga0496110_0049360 | 3300048913 | Bacteria | 3691 |
| 529 | Ga0496110_0101791 | 3300048913 | Bacteria | 2575 |
| 530 | Ga0496111_0006818 | 3300048914 | Bacteria | 7449 |
| 531 | Ga0496111_0016237 | 3300048914 | Bacteria | 5130 |
| 532 | Ga0496111_0028476 | 3300048914 | Bacteria | 3960 |
| 533 | Ga0496111_0062286 | 3300048914 | Bacteria | 2705 |
| 534 | Ga0496112_0003102 | 3300048915 | Bacteria | 13629 |
| 535 | Ga0496112_0010706 | 3300048915 | Bacteria | 8336 |
| 536 | Ga0496112_0110525 | 3300048915 | Bacteria | 2719 |
| 537 | Ga0496113_0078247 | 3300048916 | Bacteria | 2530 |
| 538 | Ga0496114_0001286 | 3300048917 | Bacteria | 18965 |
| 539 | Ga0496114_0002579 | 3300048917 | Bacteria | 13845 |
| 540 | Ga0496114_0008626 | 3300048917 | Bacteria | 8079 |
| 541 | Ga0496114_0009194 | 3300048917 | Bacteria | 7837 |
| 542 | Ga0496114_0020580 | 3300048917 | Bacteria | 5355 |
| 543 | Ga0496114_0022743 | 3300048917 | Bacteria | 5110 |
| 544 | Ga0496114_0119129 | 3300048917 | Bacteria | 2269 |
| 545 | Ga0496116_0000276 | 3300048919 | Bacteria | 89506 |
| 546 | Ga0496116_0000307 | 3300048919 | Bacteria | 82318 |
| 547 | Ga0496116_0000319 | 3300048919 | Bacteria | 78946 |
| 548 | Ga0496116_0005328 | 3300048919 | Bacteria | 11985 |
| 549 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 550 | Ga0496117_0000081 | 3300048920 | Bacteria | 223343 |
| 551 | Ga0496117_0000184 | 3300048920 | Bacteria | 127675 |
| 552 | Ga0496117_0001470 | 3300048920 | Bacteria | 33884 |
| 553 | Ga0496117_0002500 | 3300048920 | Bacteria | 23077 |
| 554 | Ga0496117_0007459 | 3300048920 | Bacteria | 10675 |
| 555 | Ga0496117_0027567 | 3300048920 | Bacteria | 4422 |
| 556 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 557 | Ga0496118_0000062 | 3300048921 | Bacteria | 219267 |
| 558 | Ga0496118_0000142 | 3300048921 | Bacteria | 126087 |
| 559 | Ga0496118_0000275 | 3300048921 | Bacteria | 90451 |
| 560 | Ga0496118_0002678 | 3300048921 | Bacteria | 23536 |
| 561 | Ga0496118_0004097 | 3300048921 | Bacteria | 17668 |
| 562 | Ga0496118_0009283 | 3300048921 | Bacteria | 9976 |
| 563 | Ga0496118_0015793 | 3300048921 | Bacteria | 6965 |
| 564 | Ga0496118_0020389 | 3300048921 | Bacteria | 5878 |
| 565 | Ga0496119_0001483 | 3300048922 | Bacteria | 28127 |
| 566 | Ga0496119_0003639 | 3300048922 | Bacteria | 15826 |
| 567 | Ga0496119_0004611 | 3300048922 | Bacteria | 13606 |
| 568 | Ga0496119_0005794 | 3300048922 | Bacteria | 11687 |
| 569 | Ga0496119_0009985 | 3300048922 | Bacteria | 8040 |
| 570 | Ga0496119_0025510 | 3300048922 | Bacteria | 4126 |
| 571 | Ga0496120_0001510 | 3300048923 | Bacteria | 27511 |
| 572 | Ga0496120_0002853 | 3300048923 | Bacteria | 16636 |
| 573 | Ga0496120_0005269 | 3300048923 | Bacteria | 10385 |
| 574 | Ga0496120_0010377 | 3300048923 | Bacteria | 6503 |
| 575 | Ga0496120_0023439 | 3300048923 | Bacteria | 3864 |
| 576 | Ga0496120_0024688 | 3300048923 | Bacteria | 3743 |
| 577 | Ga0496120_0053963 | 3300048923 | Bacteria | 2281 |
| 578 | Ga0496121_0000134 | 3300048924 | Bacteria | 165728 |
| 579 | Ga0496121_0000338 | 3300048924 | Bacteria | 97703 |
| 580 | Ga0496121_0001738 | 3300048924 | Bacteria | 35590 |
| 581 | Ga0496121_0004581 | 3300048924 | Bacteria | 18434 |
| 582 | Ga0496121_0010661 | 3300048924 | Bacteria | 10317 |
| 583 | Ga0496121_0019625 | 3300048924 | Bacteria | 6751 |
| 584 | Ga0496122_0000453 | 3300048925 | Bacteria | 85486 |
| 585 | Ga0496122_0009089 | 3300048925 | Bacteria | 10536 |
| 586 | Ga0496123_0009947 | 3300048926 | Bacteria | 8480 |
| 587 | Ga0496123_0011666 | 3300048926 | Bacteria | 7585 |
| 588 | Ga0496124_0000090 | 3300048927 | Bacteria | 192095 |
| 589 | Ga0496124_0000113 | 3300048927 | Bacteria | 165710 |
| 590 | Ga0496124_0005617 | 3300048927 | Bacteria | 14030 |
| 591 | Ga0496124_0011185 | 3300048927 | Bacteria | 8997 |
| 592 | Ga0496124_0014575 | 3300048927 | Bacteria | 7594 |
| 593 | Ga0496124_0051542 | 3300048927 | Bacteria | 3501 |
| 594 | Ga0496125_0000127 | 3300048928 | Bacteria | 165710 |
| 595 | Ga0496125_0003033 | 3300048928 | Bacteria | 21006 |
| 596 | Ga0496125_0003310 | 3300048928 | Bacteria | 19722 |
| 597 | Ga0496125_0005680 | 3300048928 | Bacteria | 13755 |
| 598 | Ga0496125_0007943 | 3300048928 | Bacteria | 11203 |
| 599 | Ga0496125_0064819 | 3300048928 | Bacteria | 2899 |
| 600 | Ga0496126_0000140 | 3300048929 | Bacteria | 165728 |
| 601 | Ga0496126_0000148 | 3300048929 | Bacteria | 163288 |
| 602 | Ga0496126_0000551 | 3300048929 | Bacteria | 72093 |
| 603 | Ga0496126_0005413 | 3300048929 | Bacteria | 14564 |
| 604 | Ga0496126_0017380 | 3300048929 | Bacteria | 7166 |
| 605 | Ga0496126_0042098 | 3300048929 | Bacteria | 4220 |
| 606 | Ga0496126_0052946 | 3300048929 | Bacteria | 3685 |
| 607 | Ga0501032_0006318 | 3300049569 | Bacteria | 8729 |
| 608 | Ga0501032_0044557 | 3300049569 | Bacteria | 3002 |
| 609 | Ga0501033_0000475 | 3300049570 | Bacteria | 38003 |
| 610 | Ga0501033_0031429 | 3300049570 | Bacteria | 3990 |
| 611 | Ga0501033_0034673 | 3300049570 | Bacteria | 3783 |
| 612 | Ga0501034_0001017 | 3300049571 | Bacteria | 40194 |
| 613 | Ga0501034_0001976 | 3300049571 | Bacteria | 25980 |
| 614 | Ga0501034_0138225 | 3300049571 | Bacteria | 2416 |
| 615 | Ga0501036_0008116 | 3300049572 | Bacteria | 8603 |
| 616 | Ga0501036_0031518 | 3300049572 | Bacteria | 4480 |
| 617 | Ga0501037_0005362 | 3300049573 | Bacteria | 9330 |
| 618 | Ga0501037_0114156 | 3300049573 | Bacteria | 1944 |
| 619 | Ga0501038_0010359 | 3300049574 | Bacteria | 8531 |
| 620 | Ga0501039_0016710 | 3300049575 | Bacteria | 5622 |
| 621 | Ga0501043_0009083 | 3300049579 | Bacteria | 7819 |
| 622 | Ga0501046_0001150 | 3300049580 | Bacteria | 25719 |
| 623 | Ga0501047_0019357 | 3300049581 | Bacteria | 6530 |
| 624 | Ga0501047_0071600 | 3300049581 | Bacteria | 3336 |
| 625 | Ga0501048_0004986 | 3300049582 | Bacteria | 10124 |
| 626 | Ga0501067_0017615 | 3300049583 | Bacteria | 3954 |
| 627 | Ga0501068_0001478 | 3300049584 | Bacteria | 12507 |
| 628 | Ga0501069_0021986 | 3300049585 | Bacteria | 3465 |
| 629 | Ga0501070_0001935 | 3300049586 | Bacteria | 18290 |
| 630 | Ga0501070_0003678 | 3300049586 | Bacteria | 13256 |
| 631 | Ga0501070_0003812 | 3300049586 | Bacteria | 13014 |
| 632 | Ga0501070_0008931 | 3300049586 | Bacteria | 8472 |
| 633 | Ga0501070_0065984 | 3300049586 | Bacteria | 2997 |
| 634 | Ga0501073_0001444 | 3300049589 | Bacteria | 17571 |
| 635 | Ga0501073_0018415 | 3300049589 | Bacteria | 5047 |
| 636 | Ga0501074_0029052 | 3300049590 | Bacteria | 4005 |
| 637 | Ga0501077_0008118 | 3300049593 | Bacteria | 6490 |
| 638 | Ga0501080_0002002 | 3300049742 | Bacteria | 17586 |
| 639 | Ga0501083_0059158 | 3300049744 | Bacteria | 2563 |
| 640 | Ga0501083_0062510 | 3300049744 | Bacteria | 2484 |
| 641 | Ga0501263_001300 | 3300049760 | Bacteria | 2310 |
| 642 | Ga0501035_0001692 | 3300049822 | Bacteria | 22306 |
| 643 | Ga0501044_0001637 | 3300049823 | Bacteria | 26261 |
| 644 | Ga0501044_0004131 | 3300049823 | Bacteria | 16298 |
| 645 | Ga0501044_0004356 | 3300049823 | Bacteria | 15855 |
| 646 | Ga0501044_0025358 | 3300049823 | Bacteria | 6284 |
| 647 | Ga0501044_0083864 | 3300049823 | Bacteria | 3221 |
| 648 | Ga0501226_000006 | 3300049853 | Bacteria | 259153 |
| 649 | nmdc:mga03683_31809_c1 | 3300050489 | Bacteria | 2119 |
| 650 | nmdc:mga03n38_16424_c1 | 3300050490 | Bacteria | 2879 |
| 651 | nmdc:mga00v17_20650_c1 | 3300050491 | Bacteria | 3776 |
| 652 | nmdc:mga00v17_5588_c1 | 3300050491 | Bacteria | 6630 |
| 653 | nmdc:mga00v17_8696_c2 | 3300050491 | Bacteria | 4260 |
| 654 | nmdc:mga0yw44_44898_c1 | 3300050492 | Bacteria | 2646 |
| 655 | nmdc:mga0yw44_9241_c1 | 3300050492 | Bacteria | 4965 |
| 656 | nmdc:mga07m45_21298_c1 | 3300050496 | Bacteria | 3528 |
| 657 | nmdc:mga07m45_22315_c1 | 3300050496 | Bacteria | 3455 |
| 658 | nmdc:mga07m45_6411_c1 | 3300050496 | Bacteria | 5942 |
| 659 | nmdc:mga05p37_64973_c1 | 3300050507 | Bacteria | 4490 |
| 660 | nmdc:mga08y16_22247_c1 | 3300050511 | Bacteria | 6690 |
| 661 | nmdc:mga08y16_62316_c1 | 3300050511 | Bacteria | 3894 |
| 662 | nmdc:mga0n895_162759_c1 | 3300050512 | Bacteria | 2263 |
| 663 | nmdc:mga0n895_54272_c1 | 3300050512 | Bacteria | 3941 |
| 664 | nmdc:mga0sz30_11458_c1 | 3300050516 | Bacteria | 3424 |
| 665 | nmdc:mga0sz30_1671_c1 | 3300050516 | Bacteria | 7873 |
| 666 | nmdc:mga0sz30_39163_c1 | 3300050516 | Bacteria | 1988 |
| 667 | nmdc:mga0sz30_636_c1 | 3300050516 | Bacteria | 12980 |
| 668 | Ga0495601_0004427 | 3300053077 | Bacteria | 8110 |
| 669 | Ga0500650_0018370 | 3300053098 | Bacteria | 3031 |
| 670 | Ga0500652_000004 | 3300053131 | Bacteria | 173428 |
| 671 | Ga0500652_018471 | 3300053131 | Bacteria | 2575 |
| 672 | Ga0500616_0000223 | 3300053153 | Bacteria | 88492 |
| 673 | Ga0500616_0004157 | 3300053153 | Bacteria | 10450 |
| 674 | Ga0500616_0022471 | 3300053153 | Bacteria | 3520 |
| 675 | Ga0500634_0000596 | 3300053161 | Bacteria | 12051 |
| 676 | Ga0500645_000063 | 3300053730 | Bacteria | 85018 |
| 677 | Ga0501082_0005048 | 3300060353 | Bacteria | 11509 |
| 678 | Ga0466962_0011356 | 3300061719 | Bacteria | 4289 |
| 679 | Ga0466962_0024644 | 3300061719 | Bacteria | 2889 |
| 680 | 2508677596 | 2508501039 | Bacteria | 9978592 |
| 681 | 2511376276 | 2511231024 | Bacteria | 5835885 |
| 682 | 2517759231 | 2517572101 | Bacteria | 6884336 |
| 683 | 2526211544 | 2526164512 | Bacteria | 4025691 |
| 684 | 2528204729 | 2527291627 | Bacteria | 5309833 |
| 685 | 2528214755 | 2527291629 | Bacteria | 5267418 |
| 686 | 2546949703 | 2546825537 | Bacteria | 5389291 |
| 687 | 2551709155 | 2551306089 | Bacteria | 7162724 |
| 688 | 2551714076 | 2551306089 | Bacteria | 7162724 |
| 689 | 2551744209 | 2551306093 | Bacteria | 7064773 |
| 690 | 2579750607 | 2576861822 | Bacteria | 5004595 |
| 691 | 2579858246 | 2579778521 | Bacteria | 7624758 |
| 692 | 2597865012 | 2597489888 | Bacteria | 6179543 |
| 693 | 2597870867 | 2597489889 | Bacteria | 6297495 |
| 694 | 2599103628 | 2597490356 | Bacteria | 7030811 |
| 695 | 2599400141 | 2599185167 | Bacteria | 6353609 |
| 696 | 2599451529 | 2599185179 | Bacteria | 6611171 |
| 697 | 2599509349 | 2599185189 | Bacteria | 5862825 |
| 698 | 2599512701 | 2599185190 | Bacteria | 6285678 |
| 699 | 2599520052 | 2599185191 | Bacteria | 6297582 |
| 700 | 2599891377 | 2599185290 | Bacteria | 6289611 |
| 701 | 2599947556 | 2599185303 | Bacteria | 6512725 |
| 702 | 2601689728 | 2600255296 | Bacteria | 5784754 |
| 703 | 2619858951 | 2619618881 | Bacteria | 7521104 |
| 704 | 2620349990 | 2619619003 | Bacteria | 7619552 |
| 705 | 2621298430 | 2619619299 | Bacteria | 6649820 |
| 706 | 2626637029 | 2626541554 | Bacteria | 7741902 |
| 707 | 2643874394 | 2643221571 | Bacteria | 6228673 |
| 708 | 2644441181 | 2643221678 | Bacteria | 9540101 |
| 709 | 2644486461 | 2643221687 | Bacteria | 6500351 |
| 710 | 2644621849 | 2643221713 | Bacteria | 6554480 |
| 711 | 2644627261 | 2643221714 | Bacteria | 9015452 |
| 712 | 2644634998 | 2643221715 | Bacteria | 6671032 |
| 713 | 2671838027 | 2671180195 | Bacteria | 9757215 |
| 714 | 2676199556 | 2675902999 | Bacteria | 9438463 |
| 715 | 2677899800 | 2675903420 | Bacteria | 6247433 |
| 716 | 2686540058 | 2684623035 | Bacteria | 8032739 |
| 717 | 2686544524 | 2684623036 | Bacteria | 5199090 |
| 718 | 2689961857 | 2687453737 | Bacteria | 11203906 |
| 719 | 2689989914 | 2687453743 | Bacteria | 8361025 |
| 720 | 2710602889 | 2710264753 | Bacteria | 5455564 |
| 721 | 2723249760 | 2721755607 | Bacteria | 5841722 |
| 722 | 2729147524 | 2728369097 | Bacteria | 4333476 |
| 723 | 2738667672 | 2738541264 | Bacteria | 5935393 |
| 724 | 2738671187 | 2738541265 | Bacteria | 6594665 |
| 725 | 2738706140 | 2738541274 | Bacteria | 6909446 |
| 726 | 2738749581 | 2738541282 | Bacteria | 6593925 |
| 727 | 2738858621 | 2738541303 | Bacteria | 6591772 |
| 728 | 2738947211 | 2738541317 | Bacteria | 5340176 |
| 729 | 2739146742 | 2738541356 | Bacteria | 5935017 |
| 730 | 2739332960 | 2738543028 | Bacteria | 6917070 |
| 731 | 2753300207 | 2751185788 | Bacteria | 4541048 |
| 732 | 2772646171 | 2772190715 | Bacteria | 6959372 |
| 733 | 2774844134 | 2773857921 | Bacteria | 9435764 |
| 734 | 2774856183 | 2773857922 | Bacteria | 9757215 |
| 735 | 2774867845 | 2773857924 | Bacteria | 5256821 |
| 736 | 2808846541 | 2808606359 | Bacteria | 9866990 |
| 737 | 2808907448 | 2808606373 | Bacteria | 4423627 |
| 738 | 2808941475 | 2808606379 | Bacteria | 5022697 |
| 739 | 2808977342 | 2808606385 | Bacteria | 6711065 |
| 740 | 2808992497 | 2808606388 | Bacteria | 6706662 |
| 741 | 2816504865 | 2816332139 | Bacteria | 9138787 |
| 742 | 2817492421 | 2816332298 | Bacteria | 6852809 |
| 743 | 2829750589 | 2829745981 | Bacteria | 5406054 |
| 744 | 2834034534 | 2834028612 | Bacteria | 6354979 |
| 745 | 2837275816 | 2837268691 | Bacteria | 7850704 |
| 746 | 2842138383 | 2842134933 | Bacteria | 5847019 |
| 747 | 2842696160 | 2842694124 | Bacteria | 4063419 |
| 748 | 2842829480 | 2842826826 | Bacteria | 5974129 |
| 749 | 2842840939 | 2842837860 | Bacteria | 6066181 |
| 750 | 2846957312 | 2846952575 | Bacteria | 6587527 |
| 751 | 2848863348 | 2848858292 | Bacteria | 7391279 |
| 752 | 2852613273 | 2852612431 | Bacteria | 6885235 |
| 753 | 2852668991 | 2852667396 | Bacteria | 6885555 |
| 754 | 2855674941 | 2855670206 | Bacteria | 7120389 |
| 755 | 2855681807 | 2855676851 | Bacteria | 7063653 |
| 756 | 2856748321 | 2856741275 | Bacteria | 8096094 |
| 757 | 2857289628 | 2857288857 | Bacteria | 7189066 |
| 758 | 2858849411 | 2858848962 | Bacteria | 6963058 |
| 759 | 2858882438 | 2858882152 | Bacteria | 7230291 |
| 760 | 2858894607 | 2858888857 | Bacteria | 7060307 |
| 761 | 2858895626 | 2858895516 | Bacteria | 7378898 |
| 762 | 2860871526 | 2860867994 | Bacteria | 5645326 |
| 763 | 2861692945 | 2861691609 | Bacteria | 5628931 |
| 764 | 2868094425 | 2868088558 | Bacteria | 7609351 |
| 765 | 2869049992 | 2869048445 | Bacteria | 6875584 |
| 766 | 2869062291 | 2869061728 | Bacteria | 7112407 |
| 767 | 2869069597 | 2869068681 | Bacteria | 7205615 |
| 768 | 2880490920 | 2880489317 | Bacteria | 7096270 |
| 769 | 2880501591 | 2880495981 | Bacteria | 7340502 |
| 770 | 2889310680 | 2889306138 | Bacteria | 6358934 |
| 771 | 2891398203 | 2891395885 | Bacteria | 9251614 |
| 772 | 2891563632 | 2891562705 | Bacteria | 8039471 |
| 773 | 2894817758 | 2894817345 | Bacteria | 4892941 |
| 774 | 2895889194 | 2895880812 | Bacteria | 11255272 |
| 775 | 2902406405 | 2902405164 | Bacteria | 6784948 |
| 776 | 2902798402 | 2902792274 | Bacteria | 7270173 |
| 777 | 2902801569 | 2902799365 | Bacteria | 5419524 |
| 778 | 2902816946 | 2902810491 | Bacteria | 6794147 |
| 779 | 2902840120 | 2902837492 | Bacteria | 6697721 |
| 780 | 2908450921 | 2908446538 | Bacteria | 6829095 |
| 781 | 2913312692 | 2913308742 | Bacteria | 5350706 |
| 782 | 2915364521 | 2915358134 | Bacteria | 6050864 |
| 783 | 2919044375 | 2919042368 | Bacteria | 3905917 |
| 784 | 2919468968 | 2919468124 | Bacteria | 9133025 |
| 785 | 2920880483 | 2920879853 | Bacteria | 4216831 |
| 786 | 2928105766 | 2928104781 | Bacteria | 3877447 |
| 787 | 2929193528 | 2929189879 | Bacteria | 5930554 |
| 788 | 2929214990 | 2929212328 | Bacteria | 7708288 |
| 789 | 2929230103 | 2929226422 | Bacteria | 7248583 |
| 790 | 2931394873 | 2931390751 | Bacteria | 6273349 |
| 791 | 2939587255 | 2939582691 | Bacteria | 7088898 |
| 792 | 2939600495 | 2939598168 | Bacteria | 4687164 |
| 793 | 2945932430 | 2945928738 | Bacteria | 6053221 |
| 794 | 2946008634 | 2946006987 | Bacteria | 6705746 |
| 795 | 2946079789 | 2946072368 | Bacteria | 8999607 |
| 796 | 2947238839 | 2947233263 | Bacteria | 6439278 |
| 797 | 2984552281 | 2984551494 | Bacteria | 3877562 |
| 798 | 637880231 | 637000116 | Bacteria | 5433628 |
| 799 | 640487397 | 640427133 | Bacteria | 4567418 |
| 800 | 651175331 | 651053060 | Bacteria | 4689946 |
| 801 | 8002778434 | 8002775197 | Bacteria | 10728764 |
| 802 | 8002790503 | 8002784119 | Bacteria | 9788632 |
| 803 | 8045866622 | 8045864390 | Bacteria | 5043873 |
| 804 | 8054111671 | 8054107350 | Bacteria | 5022511 |
| 805 | 8054290752 | 8054285046 | Bacteria | 6919322 |
| 806 | 8054350858 | 8054347763 | Bacteria | 5901107 |
| 807 | 8054474743 | 8054472261 | Bacteria | 7464355 |
| 808 | 8054507381 | 8054503363 | Bacteria | 6101651 |
| 809 | 8054566569 | 8054563764 | Bacteria | 5592885 |
| 810 | 8054709465 | 8054704163 | Bacteria | 7247792 |
| 811 | 8054728830 | 8054727385 | Bacteria | 7558670 |
| 812 | 8054734700 | 8054734606 | Bacteria | 6947278 |
| 813 | 8054915694 | 8054913762 | Bacteria | 7713009 |
| 814 | 8054923954 | 8054920844 | Bacteria | 7068637 |
| 815 | 8055160810 | 8055157932 | Bacteria | 6429399 |
| 816 | 8055822324 | 8055817908 | Bacteria | 6609162 |
| 817 | 8056135786 | 8056131705 | Bacteria | 6107031 |
| 818 | 8056153083 | 8056148874 | Bacteria | 6479865 |
| 819 | 8056161989 | 8056161164 | Bacteria | 6106669 |
| 820 | Ga0207639_10010424 | |||
| 821 | rootH2_10015241 | |||
| 822 | Ga0055538_1000079 | |||
| 823 | Ga0055539_1000120 | |||
| 824 | Ga0055533_1000128 | |||
| 825 | Ga0055532_1000116 | |||
| 826 | Ga0055525_1000165 | |||
| 827 | Ga0055540_1000024 | |||
| 828 | Ga0055540_1002431 | |||
| 829 | Ga0055540_1004520 | |||
| 830 | Ga0055540_1007661 | |||
| 831 | Ga0055541_1000080 | |||
| 832 | Ga0065714_10002472 | |||
| 833 | Ga0070658_10035015 | |||
| 834 | Ga0070676_10017874 | |||
| 835 | Ga0070683_100172717 | |||
| 836 | Ga0070670_100000045 | |||
| 837 | Ga0070670_100148774 | |||
| 838 | Ga0070682_100007253 | |||
| 839 | Ga0070682_100067347 | |||
| 840 | Ga0070687_100030946 | |||
| 841 | Ga0070661_100006754 | |||
| 842 | Ga0070692_10048048 | |||
| 843 | Ga0070668_100000449 | |||
| 844 | Ga0070668_100001342 | |||
| 845 | Ga0070668_100019915 | |||
| 846 | Ga0070668_100028001 | |||
| 847 | Ga0070668_100084310 | |||
| 848 | Ga0070669_100025937 | |||
| 849 | Ga0070671_100003104 | |||
| 850 | Ga0070671_100028821 | |||
| 851 | Ga0070671_100044515 | |||
| 852 | Ga0070674_100001298 | |||
| 853 | Ga0070674_100024358 | |||
| 854 | Ga0070659_100035434 | |||
| 855 | Ga0070659_100087211 | |||
| 856 | Ga0070667_100000063 | |||
| 857 | Ga0070667_100039611 | |||
| 858 | Ga0070667_100116471 | |||
| 859 | Ga0070714_100006996 | |||
| 860 | Ga0070714_100033136 | |||
| 861 | Ga0070711_100002490 | |||
| 862 | Ga0070705_100009653 | |||
| 863 | Ga0070700_100009255 | |||
| 864 | Ga0070663_100005931 | |||
| 865 | Ga0070663_100092463 | |||
| 866 | Ga0070678_100001418 | |||
| 867 | Ga0070662_100048435 | |||
| 868 | Ga0070662_100066836 | |||
| 869 | Ga0068867_100005596 | |||
| 870 | Ga0070685_10009916 | |||
| 871 | Ga0068853_100000144 | |||
| 872 | Ga0068853_100014791 | |||
| 873 | Ga0070665_100000979 | |||
| 874 | Ga0070665_100008785 | |||
| 875 | Ga0070665_100012648 | |||
| 876 | Ga0070665_100017721 | |||
| 877 | Ga0070664_100009176 | |||
| 878 | Ga0068854_100021764 | |||
| 879 | Ga0068854_100037486 | |||
| 880 | Ga0070702_100014451 | |||
| 881 | Ga0068859_100000184 | |||
| 882 | Ga0068859_100001979 | |||
| 883 | Ga0068859_100006882 | |||
| 884 | Ga0068859_100012750 | |||
| 885 | Ga0068859_100102861 | |||
| 886 | Ga0068866_10001173 | |||
| 887 | Ga0068866_10021990 | |||
| 888 | Ga0068851_10000040 | |||
| 889 | Ga0068863_100000159 | |||
| 890 | Ga0068863_100000739 | |||
| 891 | Ga0068863_100008258 | |||
| 892 | Ga0068863_100009338 | |||
| 893 | Ga0068858_100000141 | |||
| 894 | Ga0068858_100010221 | |||
| 895 | Ga0068858_100031984 | |||
| 896 | Ga0068860_100000065 | |||
| 897 | Ga0068860_100014977 | |||
| 898 | Ga0068862_100000028 | |||
| 899 | Ga0068862_100000496 | |||
| 900 | Ga0068862_100021504 | |||
| 901 | Ga0081455_10052913 | |||
| 902 | Ga0081540_1021753 | |||
| 903 | Ga0081539_10000889 | |||
| 904 | Ga0081539_10003849 | |||
| 905 | Ga0081539_10005545 | |||
| 906 | Ga0081539_10008604 | |||
| 907 | Ga0075365_10003226 | |||
| 908 | Ga0075365_10004832 | |||
| 909 | Ga0075368_10003971 | |||
| 910 | Ga0075368_10006832 | |||
| 911 | Ga0075363_100001644 | |||
| 912 | Ga0075363_100007787 | |||
| 913 | Ga0075364_10004962 | |||
| 914 | Ga0075364_10005195 | |||
| 915 | Ga0075364_10018758 | |||
| 916 | Ga0075364_10028339 | |||
| 917 | Ga0070712_100005495 | |||
| 918 | Ga0075367_10006245 | |||
| 919 | Ga0075369_10000241 | |||
| 920 | Ga0075369_10002872 | |||
| 921 | Ga0075369_10026792 | |||
| 922 | Ga0097621_100130240 | |||
| 923 | Ga0075370_10013757 | |||
| 924 | Ga0075370_10049387 | |||
| 925 | Ga0068871_100075218 | |||
| 926 | Ga0075428_100003910 | |||
| 927 | Ga0075430_100040168 | |||
| 928 | Ga0075430_100079384 | |||
| 929 | Ga0068865_100000662 | |||
| 930 | Ga0097620_100000184 | |||
| 931 | Ga0097620_100001979 | |||
| 932 | Ga0097620_100006882 | |||
| 933 | Ga0097620_100012750 | |||
| 934 | Ga0097620_100102859 | |||
| 935 | Ga0105251_10001487 | |||
| 936 | Ga0105244_10005906 | |||
| 937 | Ga0105250_10000381 | |||
| 938 | Ga0105240_10115972 | |||
| 939 | Ga0111539_10001058 | |||
| 940 | Ga0105245_10006009 | |||
| 941 | Ga0105247_10000232 | |||
| 942 | Ga0105247_10000606 | |||
| 943 | Ga0105247_10000653 | |||
| 944 | Ga0105247_10003188 | |||
| 945 | Ga0114129_10028015 | |||
| 946 | Ga0105243_10000916 | |||
| 947 | Ga0105242_10000321 | |||
| 948 | Ga0105248_10000074 | |||
| 949 | Ga0105248_10000812 | |||
| 950 | Ga0105248_10002879 | |||
| 951 | Ga0105248_10022807 | |||
| 952 | Ga0105237_10001244 | |||
| 953 | Ga0105237_10015275 | |||
| 954 | Ga0105237_10033771 | |||
| 955 | Ga0105238_10033151 | |||
| 956 | Ga0105249_10000011 | |||
| 957 | Ga0105249_10087755 | |||
| 958 | Ga0105239_10027928 | |||
| 959 | Ga0105239_10030661 | |||
| 960 | Ga0105239_10088169 | |||
| 961 | Ga0105246_10000513 | |||
| 962 | Ga0105246_10013913 | |||
| 963 | Ga0157373_10001051 | |||
| 964 | Ga0157373_10004203 | |||
| 965 | Ga0157373_10015031 | |||
| 966 | Ga0157371_10001356 | |||
| 967 | Ga0157371_10094442 | |||
| 968 | Ga0157370_10000649 | |||
| 969 | Ga0157370_10070452 | |||
| 970 | Ga0157370_10156697 | |||
| 971 | Ga0157369_10008322 | |||
| 972 | Ga0157369_10009567 | |||
| 973 | Ga0157378_10005790 | |||
| 974 | Ga0157372_10078811 | |||
| 975 | Ga0157372_10131802 | |||
| 976 | Ga0157375_10000539 | |||
| 977 | Ga0157375_10006212 | |||
| 978 | Ga0163163_10000528 | |||
| 979 | Ga0163163_10034600 | |||
| 980 | Ga0157380_10004453 | |||
| 981 | Ga0182008_10005229 | |||
| 982 | Ga0157379_10000730 | |||
| 983 | Ga0157379_10018275 | |||
| 984 | Ga0157379_10078828 | |||
| 985 | Ga0157376_10050752 | |||
| 986 | Ga0182006_1000561 | |||
| 987 | Ga0182007_10000945 | |||
| 988 | Ga0163161_10011606 | |||
| 989 | Ga0213872_10000559 | |||
| 990 | Ga0213872_10000896 | |||
| 991 | Ga0213872_10001399 | |||
| 992 | Ga0213874_10000129 | |||
| 993 | Ga0213876_10000839 | |||
| 994 | Ga0213876_10023512 | |||
| 995 | Ga0213875_10030200 | |||
| 996 | Ga0224712_10031778 | |||
| 997 | Ga0209784_100017 | |||
| 998 | Ga0209566_100014 | |||
| 999 | Ga0209674_100028 | |||
| 1000 | Ga0209147_100105 | |||
| 1001 | Ga0209563_100032 | |||
| 1002 | Ga0209258_100194 | |||
| 1003 | Ga0209646_1000416 | |||
| 1004 | Ga0209677_100018 | |||
| 1005 | Ga0209051_1000021 | |||
| 1006 | Ga0209051_1002711 | |||
| 1007 | Ga0209051_1012203 | |||
| 1008 | Ga0209051_1015472 | |||
| 1009 | Ga0207656_10000047 | |||
| 1010 | Ga0207696_1000043 | |||
| 1011 | Ga0207655_1000407 | |||
| 1012 | Ga0207713_1001287 | |||
| 1013 | Ga0207692_10006494 | |||
| 1014 | Ga0207642_10002300 | |||
| 1015 | Ga0207710_10000022 | |||
| 1016 | Ga0207710_10000175 | |||
| 1017 | Ga0207710_10000427 | |||
| 1018 | Ga0207688_10026388 | |||
| 1019 | Ga0207680_10023956 | |||
| 1020 | Ga0207680_10064718 | |||
| 1021 | Ga0207647_10034064 | |||
| 1022 | Ga0207671_10001896 | |||
| 1023 | Ga0207671_10007963 | |||
| 1024 | Ga0207671_10035963 | |||
| 1025 | Ga0207693_10004928 | |||
| 1026 | Ga0207663_10013385 | |||
| 1027 | Ga0207649_10000237 | |||
| 1028 | Ga0207681_10001233 | |||
| 1029 | Ga0207694_10038868 | |||
| 1030 | Ga0207650_10000135 | |||
| 1031 | Ga0207650_10000425 | |||
| 1032 | Ga0207687_10035703 | |||
| 1033 | Ga0207664_10003061 | |||
| 1034 | Ga0207664_10028828 | |||
| 1035 | Ga0207644_10003823 | |||
| 1036 | Ga0207644_10048597 | |||
| 1037 | Ga0207706_10000460 | |||
| 1038 | Ga0207706_10002365 | |||
| 1039 | Ga0207706_10058048 | |||
| 1040 | Ga0207669_10001460 | |||
| 1041 | Ga0207704_10001025 | |||
| 1042 | Ga0207665_10002351 | |||
| 1043 | Ga0207665_10028753 | |||
| 1044 | Ga0207665_10032302 | |||
| 1045 | Ga0207691_10099235 | |||
| 1046 | Ga0207711_10000149 | |||
| 1047 | Ga0207711_10000182 | |||
| 1048 | Ga0207711_10017686 | |||
| 1049 | Ga0207679_10000005 | |||
| 1050 | Ga0207712_10000020 | |||
| 1051 | Ga0207658_10000661 | |||
| 1052 | Ga0207658_10000705 | |||
| 1053 | Ga0207703_10000147 | |||
| 1054 | Ga0207703_10025897 | |||
| 1055 | Ga0207639_10002316 | |||
| 1056 | Ga0207639_10025141 | |||
| 1057 | Ga0207678_10005859 | |||
| 1058 | Ga0207678_10047531 | |||
| 1059 | Ga0207708_10005631 | |||
| 1060 | Ga0207641_10000156 | |||
| 1061 | Ga0207641_10004176 | |||
| 1062 | Ga0207641_10008873 | |||
| 1063 | Ga0207641_10115382 | |||
| 1064 | Ga0207648_10005870 | |||
| 1065 | Ga0207648_10012427 | |||
| 1066 | Ga0207648_10022324 | |||
| 1067 | Ga0207675_100004842 | |||
| 1068 | Ga0207675_100080124 | |||
| 1069 | Ga0209371_1002155 | |||
| 1070 | Ga0209983_1001711 | |||
| 1071 | Ga0209971_1000393 | |||
| 1072 | Ga0207428_10004305 | |||
| 1073 | Ga0268266_10002989 | |||
| 1074 | Ga0268265_10000004 | |||
| 1075 | Ga0268265_10000413 | |||
| 1076 | Ga0268265_10008623 | |||
| 1077 | Ga0268264_10000024 | |||
| 1078 | Ga0268264_10020535 | |||
| 1079 | Ga0268264_10150495 | |||
| 1080 | Ga0265334_10006625 | |||
| 1081 | Ga0265336_10001076 | |||
| 1082 | Ga0307515_10000478 | |||
| 1083 | Ga0307515_10013912 | |||
| 1084 | Ga0307515_10088731 | |||
| 1085 | Ga0265324_10000006 | |||
| 1086 | Ga0307511_10035520 | |||
| 1087 | Ga0307512_10009183 | |||
| 1088 | Ga0307512_10036044 | |||
| 1089 | Ga0265325_10000389 | |||
| 1090 | Ga0265340_10006669 | |||
| 1091 | Ga0265331_10019738 | |||
| 1092 | Ga0265327_10002866 | |||
| 1093 | Ga0307513_10000354 | |||
| 1094 | Ga0307513_10013021 | |||
| 1095 | Ga0307513_10034534 | |||
| 1096 | Ga0307509_10117635 | |||
| 1097 | Ga0307508_10009642 | |||
| 1098 | Ga0307508_10017511 | |||
| 1099 | Ga0316575_10004993 | |||
| 1100 | Ga0316575_10032784 | |||
| 1101 | Ga0316579_10003353 | |||
| 1102 | Ga0316579_10004069 | |||
| 1103 | Ga0316579_10017411 | |||
| 1104 | Ga0316579_10023098 | |||
| 1105 | Ga0316576_10000081 | |||
| 1106 | Ga0316576_10000785 | |||
| 1107 | Ga0316576_10003569 | |||
| 1108 | Ga0316576_10003570 | |||
| 1109 | Ga0316576_10024306 | |||
| 1110 | Ga0316576_10061297 | |||
| 1111 | Ga0316578_10000343 | |||
| 1112 | Ga0316578_10001427 | |||
| 1113 | Ga0316578_10002325 | |||
| 1114 | Ga0316578_10002609 | |||
| 1115 | Ga0316578_10003048 | |||
| 1116 | Ga0316578_10035391 | |||
| 1117 | Ga0316578_10051782 | |||
| 1118 | Ga0307516_10000433 | |||
| 1119 | Ga0307516_10040295 | |||
| 1120 | Ga0307516_10043788 | |||
| 1121 | Ga0307516_10064937 | |||
| 1122 | Ga0307405_10006782 | |||
| 1123 | Ga0307405_10019490 | |||
| 1124 | Ga0316577_10000205 | |||
| 1125 | Ga0316577_10000819 | |||
| 1126 | Ga0316577_10002280 | |||
| 1127 | Ga0316577_10002634 | |||
| 1128 | Ga0307410_10012605 | |||
| 1129 | Ga0307410_10077164 | |||
| 1130 | Ga0326468_10000068 | |||
| 1131 | Ga0307406_10032212 | |||
| 1132 | Ga0307406_10033170 | |||
| 1133 | Ga0307406_10070434 | |||
| 1134 | Ga0307407_10003980 | |||
| 1135 | Ga0307407_10033356 | |||
| 1136 | Ga0307409_100005183 | |||
| 1137 | Ga0307409_100007127 | |||
| 1138 | Ga0307409_100026708 | |||
| 1139 | Ga0307416_100036002 | |||
| 1140 | Ga0307416_100056126 | |||
| 1141 | Ga0307416_100087235 | |||
| 1142 | Ga0307414_10062673 | |||
| 1143 | Ga0307415_100005072 | |||
| 1144 | Ga0307415_100014478 | |||
| 1145 | Ga0307415_100086577 | |||
| 1146 | Ga0316583_10000620 | |||
| 1147 | Ga0316583_10000654 | |||
| 1148 | Ga0316583_10001929 | |||
| 1149 | Ga0316583_10004646 | |||
| 1150 | Ga0316585_10000314 | |||
| 1151 | Ga0373951_0000033 | |||
| 1152 | Ga0316574_0001916 | |||
| 1153 | Ga0316574_0023265 | |||
| 1154 | Ga0316574_0027430 | |||
| 1155 | Ga0316574_0035073 | |||
| 1156 | Ga0316574_0035884 | |||
| 1157 | Ga0316574_0072459 | |||
| 1158 | Ga0316582_0001990 | |||
| 1159 | Ga0316582_0004202 | |||
| 1160 | Ga0316582_0013534 | |||
| 1161 | Ga0316582_0019043 | |||
| 1162 | Ga0316582_0025264 | |||
| 1163 | Ga0316582_0068815 | |||
| 1164 | Ga0316584_0000228 | |||
| 1165 | Ga0316584_0006308 | |||
| 1166 | Ga0316584_0013448 | |||
| 1167 | Ga0316584_0016479 | |||
| 1168 | Ga0316584_0047828 | |||
| 1169 | Ga0316584_0050913 | |||
| 1170 | Ga0316584_0066774 | |||
| 1171 | Ga0395898_0050215 | |||
| 1172 | Ga0395905_0043769 | |||
| 1173 | Ga0436364_0001062 | |||
| 1174 | Ga0436364_0256774 | |||
| 1175 | Ga0436364_0873566 | |||
| 1176 | Ga0436364_1208595 | |||
| 1177 | Ga0395901_0034137 | |||
| 1178 | Ga0400484_00882 | |||
| 1179 | Ga0400484_05567 | |||
| 1180 | Ga0400490_02928 | |||
| 1181 | Ga0400485_05559 | |||
| 1182 | Ga0400485_13786 | |||
| 1183 | Ga0400488_02552 | |||
| 1184 | Ga0400488_15424 | |||
| 1185 | Ga0400488_16979 | |||
| 1186 | Ga0400488_19971 | |||
| 1187 | Ga0400488_35558 | |||
| 1188 | Ga0400486_06092 | |||
| 1189 | Ga0400486_08934 | |||
| 1190 | Ga0400486_19627 | |||
| 1191 | Ga0400483_036359 | |||
| 1192 | Ga0400483_046106 | |||
| 1193 | Ga0400483_068223 | |||
| 1194 | Ga0400483_133356 | |||
| 1195 | Ga0400483_157927 | |||
| 1196 | Ga0400483_164641 | |||
| 1197 | Ga0400483_183708 | |||
| 1198 | Ga0400483_287287 | |||
| 1199 | Ga0400489_77073 | |||
| 1200 | Ga0400489_87471 | |||
| 1201 | Ga0400487_04208 | |||
| 1202 | Ga0400487_09727 | |||
| 1203 | Ga0400487_22364 | |||
| 1204 | Ga0400487_27920 | |||
| 1205 | Ga0400487_38476 | |||
| 1206 | Ga0400487_59567 | |||
| 1207 | Ga0436365_0015250 | |||
| 1208 | Ga0436365_0350974 | |||
| 1209 | Ga0436365_0529637 | |||
| 1210 | Ga0436365_1823845 | |||
| 1211 | Ga0436361_0020532 | |||
| 1212 | Ga0436361_0142459 | |||
| 1213 | Ga0436361_0450698 | |||
| 1214 | Ga0436361_0572145 | |||
| 1215 | Ga0436361_0884959 | |||
| 1216 | Ga0436361_0889231 | |||
| 1217 | Ga0436363_0370824 | |||
| 1218 | Ga0436362_0832574 | |||
| 1219 | Ga0439461_0004639 | |||
| 1220 | Ga0439466_0006798 | |||
| 1221 | Ga0439465_0003836 | |||
| 1222 | Ga0439465_0020559 | |||
| 1223 | Ga0451791_0014186 | |||
| 1224 | Ga0451793_0408605 | |||
| 1225 | Ga0451795_1123441 | |||
| 1226 | Ga0451807_1611397 | |||
| 1227 | Ga0451847_0303602 | |||
| 1228 | Ga0451853_0247559 | |||
| 1229 | Ga0451853_2525222 | |||
| 1230 | Ga0439432_000002 | |||
| 1231 | Ga0439432_001309 | |||
| 1232 | Ga0450911_000007 | |||
| 1233 | Ga0450903_000224 | |||
| 1234 | Ga0450904_000573 | |||
| 1235 | Ga0439434_0002295 | |||
| 1236 | Ga0439435_0005161 | |||
| 1237 | Ga0439459_0000372 | |||
| 1238 | Ga0451577_0000002 | |||
| 1239 | Ga0451577_0002234 | |||
| 1240 | Ga0451577_0010358 | |||
| 1241 | Ga0451577_0042406 | |||
| 1242 | Ga0451577_0062387 | |||
| 1243 | Ga0466972_0007425 | |||
| 1244 | Ga0453683_0000003 | |||
| 1245 | Ga0466965_0001172 | |||
| 1246 | Ga0466965_0004675 | |||
| 1247 | Ga0466965_0006938 | |||
| 1248 | Ga0466966_0021386 | |||
| 1249 | Ga0466966_0050249 | |||
| 1250 | Ga0466966_0087701 | |||
| 1251 | Ga0466961_0022978 | |||
| 1252 | Ga0466961_0064401 | |||
| 1253 | Ga0466964_0015739 | |||
| 1254 | Ga0453684_0000002 | |||
| 1255 | Ga0453684_0000029 | |||
| 1256 | Ga0453684_0000163 | |||
| 1257 | Ga0453684_0005489 | |||
| 1258 | Ga0453684_0006674 | |||
| 1259 | Ga0466971_0004692 | |||
| 1260 | Ga0466968_0001457 | |||
| 1261 | Ga0466970_0007319 | |||
| 1262 | Ga0466970_0025262 | |||
| 1263 | Ga0466970_0065875 | |||
| 1264 | Ga0466957_0001918 | |||
| 1265 | Ga0466957_0004044 | |||
| 1266 | Ga0466960_0000590 | |||
| 1267 | Ga0466960_0000674 | |||
| 1268 | Ga0466960_0005162 | |||
| 1269 | Ga0466960_0007616 | |||
| 1270 | Ga0466960_0007720 | |||
| 1271 | Ga0466960_0008993 | |||
| 1272 | Ga0466960_0009846 | |||
| 1273 | Ga0466959_0004025 | |||
| 1274 | Ga0466959_0028893 | |||
| 1275 | Ga0466959_0035720 | |||
| 1276 | Ga0451576_0000004 | |||
| 1277 | Ga0451576_0000304 | |||
| 1278 | Ga0451576_0002902 | |||
| 1279 | Ga0451576_0004546 | |||
| 1280 | Ga0451576_0004616 | |||
| 1281 | Ga0451576_0022990 | |||
| 1282 | Ga0451576_0035808 | |||
| 1283 | Ga0451576_0039541 | |||
| 1284 | Ga0451576_0053617 | |||
| 1285 | Ga0451576_0117151 | |||
| 1286 | Ga0466958_0000314 | |||
| 1287 | Ga0466958_0077465 | |||
| 1288 | Ga0466967_0001537 | |||
| 1289 | Ga0466967_0028981 | |||
| 1290 | Ga0466967_0029651 | |||
| 1291 | Ga0466967_0042705 | |||
| 1292 | Ga0466967_0044720 | |||
| 1293 | Ga0466967_0119127 | |||
| 1294 | Ga0495627_001093 | |||
| 1295 | Ga0495638_0000853 | |||
| 1296 | Ga0495607_0003237 | |||
| 1297 | Ga0495583_0002227 | |||
| 1298 | Ga0495606_0005869 | |||
| 1299 | Ga0495606_0036423 | |||
| 1300 | Ga0495610_0002466 | |||
| 1301 | Ga0495648_0008982 | |||
| 1302 | Ga0495654_0000631 | |||
| 1303 | Ga0495625_0056797 | |||
| 1304 | Ga0495661_0001357 | |||
| 1305 | Ga0495649_0025811 | |||
| 1306 | Ga0495581_0024166 | |||
| 1307 | Ga0495672_0001067 | |||
| 1308 | Ga0495679_001026 | |||
| 1309 | Ga0495593_0038245 | |||
| 1310 | Ga0495593_0070021 | |||
| 1311 | Ga0495626_0021458 | |||
| 1312 | Ga0496100_0000150 | |||
| 1313 | Ga0496100_0002709 | |||
| 1314 | Ga0496100_0003753 | |||
| 1315 | Ga0496100_0008113 | |||
| 1316 | Ga0496101_0000102 | |||
| 1317 | Ga0496101_0000103 | |||
| 1318 | Ga0496101_0002821 | |||
| 1319 | Ga0496101_0003030 | |||
| 1320 | Ga0496102_0000028 | |||
| 1321 | Ga0496102_0000037 | |||
| 1322 | Ga0496102_0000256 | |||
| 1323 | Ga0496102_0008315 | |||
| 1324 | Ga0496102_0048148 | |||
| 1325 | Ga0496102_0051205 | |||
| 1326 | Ga0496103_0000004 | |||
| 1327 | Ga0496103_0000024 | |||
| 1328 | Ga0496103_0000675 | |||
| 1329 | Ga0496103_0001077 | |||
| 1330 | Ga0496104_0001814 | |||
| 1331 | Ga0496104_0003980 | |||
| 1332 | Ga0496105_0001717 | |||
| 1333 | Ga0496105_0017030 | |||
| 1334 | Ga0496105_0053050 | |||
| 1335 | Ga0496106_0000661 | |||
| 1336 | Ga0496106_0001446 | |||
| 1337 | Ga0496107_0000421 | |||
| 1338 | Ga0496107_0002750 | |||
| 1339 | Ga0496108_0000007 | |||
| 1340 | Ga0496108_0002933 | |||
| 1341 | Ga0496108_0028307 | |||
| 1342 | Ga0496108_0048432 | |||
| 1343 | Ga0496109_0000936 | |||
| 1344 | Ga0496109_0029690 | |||
| 1345 | Ga0496109_0054810 | |||
| 1346 | Ga0496110_0033500 | |||
| 1347 | Ga0496110_0049360 | |||
| 1348 | Ga0496110_0101791 | |||
| 1349 | Ga0496111_0006818 | |||
| 1350 | Ga0496111_0016237 | |||
| 1351 | Ga0496111_0028476 | |||
| 1352 | Ga0496111_0062286 | |||
| 1353 | Ga0496112_0003102 | |||
| 1354 | Ga0496112_0010706 | |||
| 1355 | Ga0496112_0110525 | |||
| 1356 | Ga0496113_0078247 | |||
| 1357 | Ga0496114_0001286 | |||
| 1358 | Ga0496114_0002579 | |||
| 1359 | Ga0496114_0008626 | |||
| 1360 | Ga0496114_0009194 | |||
| 1361 | Ga0496114_0020580 | |||
| 1362 | Ga0496114_0022743 | |||
| 1363 | Ga0496114_0119129 | |||
| 1364 | Ga0496116_0000276 | |||
| 1365 | Ga0496116_0000307 | |||
| 1366 | Ga0496116_0000319 | |||
| 1367 | Ga0496116_0005328 | |||
| 1368 | Ga0496117_0000003 | |||
| 1369 | Ga0496117_0000081 | |||
| 1370 | Ga0496117_0000184 | |||
| 1371 | Ga0496117_0001470 | |||
| 1372 | Ga0496117_0002500 | |||
| 1373 | Ga0496117_0007459 | |||
| 1374 | Ga0496117_0027567 | |||
| 1375 | Ga0496118_0000001 | |||
| 1376 | Ga0496118_0000062 | |||
| 1377 | Ga0496118_0000142 | |||
| 1378 | Ga0496118_0000275 | |||
| 1379 | Ga0496118_0002678 | |||
| 1380 | Ga0496118_0004097 | |||
| 1381 | Ga0496118_0009283 | |||
| 1382 | Ga0496118_0015793 | |||
| 1383 | Ga0496118_0020389 | |||
| 1384 | Ga0496119_0001483 | |||
| 1385 | Ga0496119_0003639 | |||
| 1386 | Ga0496119_0004611 | |||
| 1387 | Ga0496119_0005794 | |||
| 1388 | Ga0496119_0009985 | |||
| 1389 | Ga0496119_0025510 | |||
| 1390 | Ga0496120_0001510 | |||
| 1391 | Ga0496120_0002853 | |||
| 1392 | Ga0496120_0005269 | |||
| 1393 | Ga0496120_0010377 | |||
| 1394 | Ga0496120_0023439 | |||
| 1395 | Ga0496120_0024688 | |||
| 1396 | Ga0496120_0053963 | |||
| 1397 | Ga0496121_0000134 | |||
| 1398 | Ga0496121_0000338 | |||
| 1399 | Ga0496121_0001738 | |||
| 1400 | Ga0496121_0004581 | |||
| 1401 | Ga0496121_0010661 | |||
| 1402 | Ga0496121_0019625 | |||
| 1403 | Ga0496122_0000453 | |||
| 1404 | Ga0496122_0009089 | |||
| 1405 | Ga0496123_0009947 | |||
| 1406 | Ga0496123_0011666 | |||
| 1407 | Ga0496124_0000090 | |||
| 1408 | Ga0496124_0000113 | |||
| 1409 | Ga0496124_0005617 | |||
| 1410 | Ga0496124_0011185 | |||
| 1411 | Ga0496124_0014575 | |||
| 1412 | Ga0496124_0051542 | |||
| 1413 | Ga0496125_0000127 | |||
| 1414 | Ga0496125_0003033 | |||
| 1415 | Ga0496125_0003310 | |||
| 1416 | Ga0496125_0005680 | |||
| 1417 | Ga0496125_0007943 | |||
| 1418 | Ga0496125_0064819 | |||
| 1419 | Ga0496126_0000140 | |||
| 1420 | Ga0496126_0000148 | |||
| 1421 | Ga0496126_0000551 | |||
| 1422 | Ga0496126_0005413 | |||
| 1423 | Ga0496126_0017380 | |||
| 1424 | Ga0496126_0042098 | |||
| 1425 | Ga0496126_0052946 | |||
| 1426 | Ga0501032_0006318 | |||
| 1427 | Ga0501032_0044557 | |||
| 1428 | Ga0501033_0000475 | |||
| 1429 | Ga0501033_0031429 | |||
| 1430 | Ga0501033_0034673 | |||
| 1431 | Ga0501034_0001017 | |||
| 1432 | Ga0501034_0001976 | |||
| 1433 | Ga0501034_0138225 | |||
| 1434 | Ga0501036_0008116 | |||
| 1435 | Ga0501036_0031518 | |||
| 1436 | Ga0501037_0005362 | |||
| 1437 | Ga0501037_0114156 | |||
| 1438 | Ga0501038_0010359 | |||
| 1439 | Ga0501039_0016710 | |||
| 1440 | Ga0501043_0009083 | |||
| 1441 | Ga0501046_0001150 | |||
| 1442 | Ga0501047_0019357 | |||
| 1443 | Ga0501047_0071600 | |||
| 1444 | Ga0501048_0004986 | |||
| 1445 | Ga0501067_0017615 | |||
| 1446 | Ga0501068_0001478 | |||
| 1447 | Ga0501069_0021986 | |||
| 1448 | Ga0501070_0001935 | |||
| 1449 | Ga0501070_0003678 | |||
| 1450 | Ga0501070_0003812 | |||
| 1451 | Ga0501070_0008931 | |||
| 1452 | Ga0501070_0065984 | |||
| 1453 | Ga0501073_0001444 | |||
| 1454 | Ga0501073_0018415 | |||
| 1455 | Ga0501074_0029052 | |||
| 1456 | Ga0501077_0008118 | |||
| 1457 | Ga0501080_0002002 | |||
| 1458 | Ga0501083_0059158 | |||
| 1459 | Ga0501083_0062510 | |||
| 1460 | Ga0501263_001300 | |||
| 1461 | Ga0501035_0001692 | |||
| 1462 | Ga0501044_0001637 | |||
| 1463 | Ga0501044_0004131 | |||
| 1464 | Ga0501044_0004356 | |||
| 1465 | Ga0501044_0025358 | |||
| 1466 | Ga0501044_0083864 | |||
| 1467 | Ga0501226_000006 | |||
| 1468 | nmdc:mga03683_31809_c1 | |||
| 1469 | nmdc:mga03n38_16424_c1 | |||
| 1470 | nmdc:mga00v17_20650_c1 | |||
| 1471 | nmdc:mga00v17_5588_c1 | |||
| 1472 | nmdc:mga00v17_8696_c2 | |||
| 1473 | nmdc:mga0yw44_44898_c1 | |||
| 1474 | nmdc:mga0yw44_9241_c1 | |||
| 1475 | nmdc:mga07m45_21298_c1 | |||
| 1476 | nmdc:mga07m45_22315_c1 | |||
| 1477 | nmdc:mga07m45_6411_c1 | |||
| 1478 | nmdc:mga05p37_64973_c1 | |||
| 1479 | nmdc:mga08y16_22247_c1 | |||
| 1480 | nmdc:mga08y16_62316_c1 | |||
| 1481 | nmdc:mga0n895_162759_c1 | |||
| 1482 | nmdc:mga0n895_54272_c1 | |||
| 1483 | nmdc:mga0sz30_11458_c1 | |||
| 1484 | nmdc:mga0sz30_1671_c1 | |||
| 1485 | nmdc:mga0sz30_39163_c1 | |||
| 1486 | nmdc:mga0sz30_636_c1 | |||
| 1487 | Ga0495601_0004427 | |||
| 1488 | Ga0500650_0018370 | |||
| 1489 | Ga0500652_000004 | |||
| 1490 | Ga0500652_018471 | |||
| 1491 | Ga0500616_0000223 | |||
| 1492 | Ga0500616_0004157 | |||
| 1493 | Ga0500616_0022471 | |||
| 1494 | Ga0500634_0000596 | |||
| 1495 | Ga0500645_000063 | |||
| 1496 | Ga0501082_0005048 | |||
| 1497 | Ga0466962_0011356 | |||
| 1498 | Ga0466962_0024644 | |||
| 1499 | 2508677596 | |||
| 1500 | 2511376276 | |||
| 1501 | 2517759231 | |||
| 1502 | 2526211544 | |||
| 1503 | 2528204729 | |||
| 1504 | 2528214755 | |||
| 1505 | 2546949703 | |||
| 1506 | 2551709155 | |||
| 1507 | 2551714076 | |||
| 1508 | 2551744209 | |||
| 1509 | 2579750607 | |||
| 1510 | 2579858246 | |||
| 1511 | 2597865012 | |||
| 1512 | 2597870867 | |||
| 1513 | 2599103628 | |||
| 1514 | 2599400141 | |||
| 1515 | 2599451529 | |||
| 1516 | 2599509349 | |||
| 1517 | 2599512701 | |||
| 1518 | 2599520052 | |||
| 1519 | 2599891377 | |||
| 1520 | 2599947556 | |||
| 1521 | 2601689728 | |||
| 1522 | 2619858951 | |||
| 1523 | 2620349990 | |||
| 1524 | 2621298430 | |||
| 1525 | 2626637029 | |||
| 1526 | 2643874394 | |||
| 1527 | 2644441181 | |||
| 1528 | 2644486461 | |||
| 1529 | 2644621849 | |||
| 1530 | 2644627261 | |||
| 1531 | 2644634998 | |||
| 1532 | 2671838027 | |||
| 1533 | 2676199556 | |||
| 1534 | 2677899800 | |||
| 1535 | 2686540058 | |||
| 1536 | 2686544524 | |||
| 1537 | 2689961857 | |||
| 1538 | 2689989914 | |||
| 1539 | 2710602889 | |||
| 1540 | 2723249760 | |||
| 1541 | 2729147524 | |||
| 1542 | 2738667672 | |||
| 1543 | 2738671187 | |||
| 1544 | 2738706140 | |||
| 1545 | 2738749581 | |||
| 1546 | 2738858621 | |||
| 1547 | 2738947211 | |||
| 1548 | 2739146742 | |||
| 1549 | 2739332960 | |||
| 1550 | 2753300207 | |||
| 1551 | 2772646171 | |||
| 1552 | 2774844134 | |||
| 1553 | 2774856183 | |||
| 1554 | 2774867845 | |||
| 1555 | 2808846541 | |||
| 1556 | 2808907448 | |||
| 1557 | 2808941475 | |||
| 1558 | 2808977342 | |||
| 1559 | 2808992497 | |||
| 1560 | 2816504865 | |||
| 1561 | 2817492421 | |||
| 1562 | 2829750589 | |||
| 1563 | 2834034534 | |||
| 1564 | 2837275816 | |||
| 1565 | 2842138383 | |||
| 1566 | 2842696160 | |||
| 1567 | 2842829480 | |||
| 1568 | 2842840939 | |||
| 1569 | 2846957312 | |||
| 1570 | 2848863348 | |||
| 1571 | 2852613273 | |||
| 1572 | 2852668991 | |||
| 1573 | 2855674941 | |||
| 1574 | 2855681807 | |||
| 1575 | 2856748321 | |||
| 1576 | 2857289628 | |||
| 1577 | 2858849411 | |||
| 1578 | 2858882438 | |||
| 1579 | 2858894607 | |||
| 1580 | 2858895626 | |||
| 1581 | 2860871526 | |||
| 1582 | 2861692945 | |||
| 1583 | 2868094425 | |||
| 1584 | 2869049992 | |||
| 1585 | 2869062291 | |||
| 1586 | 2869069597 | |||
| 1587 | 2880490920 | |||
| 1588 | 2880501591 | |||
| 1589 | 2889310680 | |||
| 1590 | 2891398203 | |||
| 1591 | 2891563632 | |||
| 1592 | 2894817758 | |||
| 1593 | 2895889194 | |||
| 1594 | 2902406405 | |||
| 1595 | 2902798402 | |||
| 1596 | 2902801569 | |||
| 1597 | 2902816946 | |||
| 1598 | 2902840120 | |||
| 1599 | 2908450921 | |||
| 1600 | 2913312692 | |||
| 1601 | 2915364521 | |||
| 1602 | 2919044375 | |||
| 1603 | 2919468968 | |||
| 1604 | 2920880483 | |||
| 1605 | 2928105766 | |||
| 1606 | 2929193528 | |||
| 1607 | 2929214990 | |||
| 1608 | 2929230103 | |||
| 1609 | 2931394873 | |||
| 1610 | 2939587255 | |||
| 1611 | 2939600495 | |||
| 1612 | 2945932430 | |||
| 1613 | 2946008634 | |||
| 1614 | 2946079789 | |||
| 1615 | 2947238839 | |||
| 1616 | 2984552281 | |||
| 1617 | 637880231 | |||
| 1618 | 640487397 | |||
| 1619 | 651175331 | |||
| 1620 | 8002778434 | |||
| 1621 | 8002790503 | |||
| 1622 | 8045866622 | |||
| 1623 | 8054111671 | |||
| 1624 | 8054290752 | |||
| 1625 | 8054350858 | |||
| 1626 | 8054474743 | |||
| 1627 | 8054507381 | |||
| 1628 | 8054566569 | |||
| 1629 | 8054709465 | |||
| 1630 | 8054728830 | |||
| 1631 | 8054734700 | |||
| 1632 | 8054915694 | |||
| 1633 | 8054923954 | |||
| 1634 | 8055160810 | |||
| 1635 | 8055822324 | |||
| 1636 | 8056135786 | |||
| 1637 | 8056153083 | |||
| 1638 | 8056161989 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ct9-assembly2.cif.gz_C | crystal structure of asparagine synthetase b from escherichia coli | 0.8501 | 3 | 590 |
| 7ylz-assembly2.cif.gz_B | unliganded form of hydroxyamidotransferase tsnb9 | 0.8468 | 2 | 590 |
| 1ct9-assembly1.cif.gz_D | crystal structure of asparagine synthetase b from escherichia coli | 0.8425 | 3 | 591 |
| 7ylz-assembly2.cif.gz_B | unliganded form of hydroxyamidotransferase tsnb9 | 0.8385 | 2 | 590 |
| 7ylz-assembly1.cif.gz_A | unliganded form of hydroxyamidotransferase tsnb9 | 0.8334 | 2 | 590 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86A01_14_228_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9368 | 18 | 212 | 3.60.20.10 |
| af_P9WN33_15_198_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9219 | 15 | 179 | 3.60.20.10 |
| af_Q7KTW9_18_204_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9176 | 21 | 220 | 3.60.20.10 |
| af_P49090_1_193_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9062 | 1 | 224 | 3.60.20.10 |
| af_P49090_1_193_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9018 | 1 | 224 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0N8R332-F1-model_v4 | asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) | 0.9933 | 31 | 158 |
GO:0005829
|
| AF-A0A1C3P6N4-F1-model_v4 | asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) | 0.9894 | 104 | 592 |
GO:0004066
GO:0005524 GO:0005829 GO:0006529 |
| AF-A0A3M1WBL3-F1-model_v4 | asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) | 0.9882 | 1 | 268 |
GO:0004066
GO:0005524 GO:0005829 GO:0006529 |
| AF-A0A831STF3-F1-model_v4 | asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) | 0.9868 | 1 | 591 |
GO:0004066
GO:0005524 GO:0005829 GO:0006529 |
| AF-A0A1R4HTJ7-F1-model_v4 | asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4) | 0.9868 | 1 | 591 |
GO:0004066
GO:0005524 GO:0005829 GO:0006529 |