F482173

General Info

Members Datasets Scaffolds Average Seq Length
819 229 1638 249

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10253708|Ga0207683_102537082
Length 303
Sequence MSEGQIRIGIGGWNFPPWRGVFYPDKHPQAKELDYASSQMGAIEINATFYGRQKPKSWENWEKIVPDGFQFAIKGSRYCVSRSKLAESADSIANFFGQGFQVLGPKLGPILWQLPPGLAYREDRMARFFAMLPDTTQRAGVIAAGCDDKIKTKFGEEPVIAPEGPGAVLRHAVEVRHDSFATGAFAQLCREHGVALVVADTAGRFTWVDEVTSDLVYVRLHGDQELYTSRYSDQGIEWWAARVQGWADTEGVREVQVYFDNDGHAHAPFDARRLAERLGVATEPPEPLPPWQPLPSLRGRVSP

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.12
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.03
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10253708 3300026121 Bacteria 1605
2 JGI24736J21556_1000088 3300001904 Bacteria 15229
3 JGI24752J21851_1002175 3300001976 Bacteria 2619
4 JGI24740J21852_10003266 3300001979 Bacteria 7153
5 JGI24739J22299_10001795 3300001989 Bacteria 8170
6 JGI24737J22298_10001166 3300001990 Bacteria 9251
7 JGI24737J22298_10010428 3300001990 Bacteria 3066
8 JGI24737J22298_10059284 3300001990 Bacteria 1153
9 JGI24735J21928_10007888 3300002067 Bacteria 3459
10 JGI24735J21928_10045769 3300002067 Bacteria 1270
11 JGI24738J21930_10000237 3300002075 Bacteria 15008
12 Ga0065715_10000902 3300005293 Bacteria 21505
13 Ga0070658_10000205 3300005327 Bacteria 52211
14 Ga0070658_10036962 3300005327 Bacteria 3935
15 Ga0070658_10038175 3300005327 Bacteria 3874
16 Ga0070658_10042298 3300005327 Bacteria 3679
17 Ga0070658_10106010 3300005327 Bacteria 2325
18 Ga0070658_10124626 3300005327 Bacteria 2143
19 Ga0070658_10185245 3300005327 Bacteria 1753
20 Ga0070658_10408201 3300005327 Bacteria 1167
21 Ga0070658_10559865 3300005327 Bacteria 989
22 Ga0070676_10003558 3300005328 Bacteria 8148
23 Ga0070676_10016348 3300005328 Bacteria 4102
24 Ga0070676_10068053 3300005328 Bacteria 2131
25 Ga0070676_10116732 3300005328 Bacteria 1669
26 Ga0070683_100004542 3300005329 Bacteria 11456
27 Ga0070683_100036109 3300005329 Bacteria 4520
28 Ga0070683_100160152 3300005329 Bacteria 2135
29 Ga0070690_100002718 3300005330 Bacteria 9548
30 Ga0070670_100001324 3300005331 Bacteria 19783
31 Ga0070670_100048670 3300005331 Bacteria 3647
32 Ga0070670_100593673 3300005331 Bacteria 990
33 Ga0070677_10000275 3300005333 Bacteria 18016
34 Ga0070666_10000168 3300005335 Bacteria 45111
35 Ga0070666_10032423 3300005335 Bacteria 3451
36 Ga0070666_10216122 3300005335 Bacteria 1351
37 Ga0070680_100006630 3300005336 Bacteria 8804
38 Ga0070680_100098220 3300005336 Bacteria 2428
39 Ga0070680_100101052 3300005336 Bacteria 2394
40 Ga0070680_100376368 3300005336 Bacteria 1209
41 Ga0070682_100096697 3300005337 Bacteria 1942
42 Ga0070682_100287212 3300005337 Bacteria 1202
43 Ga0070682_100323971 3300005337 Unclassified 1139
44 Ga0068868_100014045 3300005338 Bacteria 5893
45 Ga0068868_100082609 3300005338 Bacteria 2577
46 Ga0068868_100241992 3300005338 Bacteria 1516
47 Ga0070660_100000009 3300005339 Bacteria 145691
48 Ga0070660_100004590 3300005339 Bacteria 9547
49 Ga0070660_100006002 3300005339 Bacteria 8397
50 Ga0070660_100012719 3300005339 Bacteria 6017
51 Ga0070660_100038646 3300005339 Bacteria 3624
52 Ga0070660_100046787 3300005339 Bacteria 3317
53 Ga0070660_100062052 3300005339 Bacteria 2903
54 Ga0070660_100126334 3300005339 Bacteria 2044
55 Ga0070660_100155311 3300005339 Bacteria 1841
56 Ga0070660_100281818 3300005339 Bacteria 1360
57 Ga0070660_100452759 3300005339 Bacteria 1065
58 Ga0070687_100393118 3300005343 Unclassified 907
59 Ga0070661_100000100 3300005344 Bacteria 70585
60 Ga0070661_100019177 3300005344 Bacteria 4871
61 Ga0070661_100026556 3300005344 Bacteria 4165
62 Ga0070661_100042263 3300005344 Bacteria 3326
63 Ga0070661_100060693 3300005344 Bacteria 2774
64 Ga0070661_100102555 3300005344 Bacteria 2130
65 Ga0070661_100127081 3300005344 Bacteria 1913
66 Ga0070692_10002409 3300005345 Bacteria 7247
67 Ga0070692_10009418 3300005345 Bacteria 4404
68 Ga0070692_10203621 3300005345 Bacteria 1161
69 Ga0070692_10263399 3300005345 Bacteria 1037
70 Ga0070668_100001906 3300005347 Bacteria 15259
71 Ga0070668_100024681 3300005347 Bacteria 4556
72 Ga0070668_100039524 3300005347 Bacteria 3607
73 Ga0070669_100003417 3300005353 Bacteria 11434
74 Ga0070669_100020276 3300005353 Bacteria 4749
75 Ga0070669_100068315 3300005353 Bacteria 2623
76 Ga0070675_100003230 3300005354 Bacteria 12344
77 Ga0070675_100024582 3300005354 Bacteria 4824
78 Ga0070675_100094024 3300005354 Bacteria 2515
79 Ga0070675_100177660 3300005354 Bacteria 1839
80 Ga0070675_100361204 3300005354 Bacteria 1289
81 Ga0070675_100504172 3300005354 Bacteria 1091
82 Ga0070671_100011680 3300005355 Bacteria 7063
83 Ga0070671_100013050 3300005355 Bacteria 6697
84 Ga0070671_100023983 3300005355 Bacteria 4992
85 Ga0070671_100027135 3300005355 Bacteria 4711
86 Ga0070671_100097305 3300005355 Bacteria 2468
87 Ga0070671_100253915 3300005355 Bacteria 1494
88 Ga0070671_100258133 3300005355 Bacteria 1481
89 Ga0070671_100560667 3300005355 Bacteria 985
90 Ga0070674_100005112 3300005356 Bacteria 7542
91 Ga0070674_100019554 3300005356 Bacteria 4304
92 Ga0070674_100129679 3300005356 Unclassified 1878
93 Ga0070674_100147047 3300005356 Bacteria 1775
94 Ga0070674_100168485 3300005356 Bacteria 1668
95 Ga0070673_100024388 3300005364 Bacteria 4435
96 Ga0070673_100108079 3300005364 Bacteria 2302
97 Ga0070673_100114237 3300005364 Bacteria 2243
98 Ga0070659_100009072 3300005366 Bacteria 7298
99 Ga0070659_100137400 3300005366 Bacteria 1988
100 Ga0070659_100155438 3300005366 Bacteria 1868
101 Ga0070659_100210161 3300005366 Bacteria 1604
102 Ga0070659_100268505 3300005366 Unclassified 1417
103 Ga0070659_100276059 3300005366 Bacteria 1397
104 Ga0070659_100386357 3300005366 Bacteria 1180
105 Ga0070659_100584236 3300005366 Bacteria 959
106 Ga0070667_100001032 3300005367 Bacteria 25440
107 Ga0070667_100005549 3300005367 Bacteria 10525
108 Ga0070667_100021642 3300005367 Bacteria 5337
109 Ga0070667_100023180 3300005367 Bacteria 5150
110 Ga0070667_100052724 3300005367 Bacteria 3433
111 Ga0070667_100060661 3300005367 Bacteria 3201
112 Ga0070667_100157723 3300005367 Bacteria 1997
113 Ga0070667_100190402 3300005367 Bacteria 1817
114 Ga0070667_100208437 3300005367 Bacteria 1737
115 Ga0070667_100340575 3300005367 Bacteria 1356
116 Ga0070667_100354206 3300005367 Bacteria 1329
117 Ga0070667_100496342 3300005367 Bacteria 1119
118 Ga0070709_10006855 3300005434 Bacteria 6224
119 Ga0070714_100029226 3300005435 Bacteria 4582
120 Ga0070714_100136519 3300005435 Bacteria 2197
121 Ga0070714_100230245 3300005435 Bacteria 1707
122 Ga0070705_100183326 3300005440 Bacteria 1420
123 Ga0070663_100002974 3300005455 Bacteria 9661
124 Ga0070663_100010101 3300005455 Bacteria 5872
125 Ga0070663_100010467 3300005455 Bacteria 5780
126 Ga0070663_100036917 3300005455 Bacteria 3398
127 Ga0070663_100047915 3300005455 Bacteria 3028
128 Ga0070663_100072434 3300005455 Bacteria 2510
129 Ga0070663_100081742 3300005455 Bacteria 2375
130 Ga0070663_100082949 3300005455 Bacteria 2359
131 Ga0070663_100097972 3300005455 Bacteria 2183
132 Ga0070663_100510412 3300005455 Bacteria 1000
133 Ga0070678_100000515 3300005456 Bacteria 18701
134 Ga0070678_100007809 3300005456 Bacteria 6365
135 Ga0070678_100016482 3300005456 Bacteria 4730
136 Ga0070678_100029793 3300005456 Bacteria 3742
137 Ga0070678_100036059 3300005456 Bacteria 3458
138 Ga0070678_100274696 3300005456 Bacteria 1423
139 Ga0070662_100000035 3300005457 Bacteria 77342
140 Ga0070662_100001356 3300005457 Bacteria 15048
141 Ga0070662_100027937 3300005457 Bacteria 3922
142 Ga0070662_100044636 3300005457 Bacteria 3176
143 Ga0070662_100075839 3300005457 Bacteria 2491
144 Ga0070662_100176134 3300005457 Bacteria 1683
145 Ga0070662_100234288 3300005457 Bacteria 1470
146 Ga0070662_100290261 3300005457 Bacteria 1326
147 Ga0070662_100311097 3300005457 Bacteria 1282
148 Ga0070662_100330280 3300005457 Bacteria 1246
149 Ga0070662_100418229 3300005457 Bacteria 1108
150 Ga0070662_100617154 3300005457 Bacteria 913
151 Ga0070681_10039758 3300005458 Bacteria 4715
152 Ga0070681_10062150 3300005458 Bacteria 3708
153 Ga0070681_10251100 3300005458 Bacteria 1681
154 Ga0070681_10351624 3300005458 Bacteria 1384
155 Ga0070681_10411166 3300005458 Bacteria 1265
156 Ga0070681_10628758 3300005458 Bacteria 988
157 Ga0068867_100001817 3300005459 Bacteria 14865
158 Ga0068867_100003846 3300005459 Bacteria 10552
159 Ga0068867_100056465 3300005459 Bacteria 2905
160 Ga0068867_100106824 3300005459 Bacteria 2145
161 Ga0070679_100013900 3300005530 Bacteria 7713
162 Ga0070679_100022595 3300005530 Bacteria 6148
163 Ga0070679_100088459 3300005530 Bacteria 3085
164 Ga0070679_100225898 3300005530 Bacteria 1832
165 Ga0070679_100248137 3300005530 Bacteria 1737
166 Ga0070679_100265707 3300005530 Bacteria 1670
167 Ga0070684_100005397 3300005535 Bacteria 9794
168 Ga0070684_100034267 3300005535 Bacteria 4340
169 Ga0070684_100226443 3300005535 Bacteria 1706
170 Ga0068853_100516894 3300005539 Bacteria 1128
171 Ga0070672_100001525 3300005543 Bacteria 14350
172 Ga0070672_100004387 3300005543 Bacteria 9243
173 Ga0070672_100163225 3300005543 Bacteria 1850
174 Ga0070686_100446628 3300005544 Bacteria 993
175 Ga0070695_100152172 3300005545 Bacteria 1616
176 Ga0070693_100025198 3300005547 Bacteria 3199
177 Ga0070665_100011012 3300005548 Bacteria 9141
178 Ga0070665_100026188 3300005548 Bacteria 5872
179 Ga0070665_100157936 3300005548 Bacteria 2269
180 Ga0068855_100001487 3300005563 Bacteria 29322
181 Ga0068855_100006301 3300005563 Bacteria 14462
182 Ga0068855_100017599 3300005563 Bacteria 8594
183 Ga0068855_100050642 3300005563 Bacteria 4893
184 Ga0068855_100208366 3300005563 Bacteria 2198
185 Ga0068855_100377168 3300005563 Bacteria 1558
186 Ga0068855_100420271 3300005563 Bacteria 1462
187 Ga0068855_100643394 3300005563 Bacteria 1139
188 Ga0070664_100000025 3300005564 Bacteria 93173
189 Ga0070664_100001781 3300005564 Bacteria 17283
190 Ga0070664_100003402 3300005564 Bacteria 12844
191 Ga0070664_100076108 3300005564 Bacteria 2883
192 Ga0070664_100224381 3300005564 Bacteria 1682
193 Ga0070664_100325870 3300005564 Bacteria 1393
194 Ga0068857_100080370 3300005577 Bacteria 2911
195 Ga0068854_100002567 3300005578 Bacteria 11244
196 Ga0068854_100024096 3300005578 Bacteria 4163
197 Ga0068854_100031164 3300005578 Bacteria 3704
198 Ga0068854_100040712 3300005578 Bacteria 3280
199 Ga0068854_100062377 3300005578 Bacteria 2702
200 Ga0068854_100152404 3300005578 Bacteria 1784
201 Ga0068856_100000219 3300005614 Bacteria 61699
202 Ga0068856_100003046 3300005614 Bacteria 17147
203 Ga0068856_100051425 3300005614 Bacteria 4062
204 Ga0068856_100080324 3300005614 Bacteria 3234
205 Ga0068856_100141609 3300005614 Bacteria 2412
206 Ga0068856_100161668 3300005614 Bacteria 2250
207 Ga0068852_100001469 3300005616 Bacteria 15940
208 Ga0068852_100003830 3300005616 Bacteria 10562
209 Ga0068852_100007274 3300005616 Bacteria 8072
210 Ga0068852_100011351 3300005616 Bacteria 6702
211 Ga0068852_100087184 3300005616 Bacteria 2784
212 Ga0068852_100118991 3300005616 Bacteria 2414
213 Ga0068852_100128648 3300005616 Bacteria 2329
214 Ga0068852_100142460 3300005616 Bacteria 2220
215 Ga0068852_100151164 3300005616 Bacteria 2159
216 Ga0068859_100001691 3300005617 Bacteria 22476
217 Ga0068859_100013576 3300005617 Bacteria 8166
218 Ga0068859_100048424 3300005617 Bacteria 4270
219 Ga0068859_100072815 3300005617 Bacteria 3473
220 Ga0068859_100078898 3300005617 Bacteria 3333
221 Ga0068864_100081837 3300005618 Bacteria 2831
222 Ga0068864_100102796 3300005618 Bacteria 2536
223 Ga0068864_100180441 3300005618 Bacteria 1930
224 Ga0068864_100246175 3300005618 Bacteria 1658
225 Ga0068864_100268404 3300005618 Bacteria 1589
226 Ga0068864_100716897 3300005618 Bacteria 978
227 Ga0068866_10002573 3300005718 Bacteria 7482
228 Ga0068866_10054121 3300005718 Bacteria 2055
229 Ga0068861_100089865 3300005719 Bacteria 2421
230 Ga0068861_100133040 3300005719 Bacteria 2021
231 Ga0068851_10003930 3300005834 Bacteria 6651
232 Ga0068851_10013119 3300005834 Bacteria 3921
233 Ga0068851_10057783 3300005834 Bacteria 1981
234 Ga0068870_10012263 3300005840 Bacteria 4001
235 Ga0068863_100053469 3300005841 Bacteria 3828
236 Ga0068863_100103574 3300005841 Bacteria 2707
237 Ga0068863_100108363 3300005841 Bacteria 2643
238 Ga0068863_100179019 3300005841 Bacteria 2035
239 Ga0068863_100194064 3300005841 Bacteria 1952
240 Ga0068863_100500726 3300005841 Bacteria 1196
241 Ga0068858_100000874 3300005842 Bacteria 31179
242 Ga0068858_100010680 3300005842 Bacteria 8686
243 Ga0068858_100408628 3300005842 Bacteria 1305
244 Ga0068860_100002325 3300005843 Bacteria 19958
245 Ga0068860_100006399 3300005843 Bacteria 11822
246 Ga0068860_100117189 3300005843 Bacteria 2548
247 Ga0068862_100003744 3300005844 Bacteria 12971
248 Ga0068862_100005814 3300005844 Bacteria 10280
249 Ga0068862_100018881 3300005844 Bacteria 5745
250 Ga0068862_100020846 3300005844 Bacteria 5475
251 Ga0068862_100112537 3300005844 Bacteria 2391
252 Ga0097621_100002777 3300006237 Bacteria 11982
253 Ga0097621_100027072 3300006237 Bacteria 4505
254 Ga0097621_100192521 3300006237 Bacteria 1767
255 Ga0097621_100202096 3300006237 Bacteria 1726
256 Ga0075370_10050686 3300006353 Bacteria 2355
257 Ga0068871_100002519 3300006358 Bacteria 12491
258 Ga0068871_100101832 3300006358 Bacteria 2407
259 Ga0068871_100362822 3300006358 Bacteria 1283
260 Ga0075428_100037243 3300006844 Bacteria 5356
261 Ga0075431_100067082 3300006847 Bacteria 3705
262 Ga0068865_100019791 3300006881 Bacteria 4359
263 Ga0068865_100301003 3300006881 Bacteria 1284
264 Ga0097620_100001691 3300006931 Bacteria 22476
265 Ga0097620_100013576 3300006931 Bacteria 8166
266 Ga0097620_100048424 3300006931 Bacteria 4270
267 Ga0097620_100072817 3300006931 Bacteria 3473
268 Ga0097620_100078895 3300006931 Bacteria 3333
269 Ga0075435_100487770 3300007076 Bacteria 1065
270 Ga0105250_10006445 3300009092 Bacteria 5127
271 Ga0105250_10198876 3300009092 Bacteria 845
272 Ga0105240_10017468 3300009093 Bacteria 9667
273 Ga0105240_10181211 3300009093 Bacteria 2485
274 Ga0105240_10254879 3300009093 Bacteria 2027
275 Ga0105240_10487279 3300009093 Bacteria 1373
276 Ga0111539_10282653 3300009094 Bacteria 1931
277 Ga0105245_10096984 3300009098 Bacteria 2722
278 Ga0105245_10097546 3300009098 Bacteria 2714
279 Ga0114129_10218777 3300009147 Bacteria 2571
280 Ga0114129_10846490 3300009147 Bacteria 1163
281 Ga0105243_10092110 3300009148 Bacteria 2498
282 Ga0105243_10264046 3300009148 Bacteria 1543
283 Ga0105243_10267893 3300009148 Bacteria 1532
284 Ga0105241_10220293 3300009174 Bacteria 1594
285 Ga0105241_10350199 3300009174 Bacteria 1282
286 Ga0105241_10369052 3300009174 Bacteria 1251
287 Ga0105241_10823381 3300009174 Bacteria 857
288 Ga0105242_10063197 3300009176 Bacteria 3049
289 Ga0105242_10959397 3300009176 Bacteria 860
290 Ga0105248_10000163 3300009177 Bacteria 77658
291 Ga0105248_10000413 3300009177 Bacteria 49136
292 Ga0105248_10004409 3300009177 Bacteria 15579
293 Ga0105248_10008513 3300009177 Bacteria 11264
294 Ga0105248_10014059 3300009177 Bacteria 8809
295 Ga0105248_10021512 3300009177 Bacteria 7145
296 Ga0105248_10031200 3300009177 Bacteria 5956
297 Ga0105248_10070369 3300009177 Bacteria 3929
298 Ga0105238_10055781 3300009551 Bacteria 3965
299 Ga0105238_10134605 3300009551 Bacteria 2449
300 Ga0105238_10432463 3300009551 Bacteria 1312
301 Ga0105238_10444542 3300009551 Bacteria 1293
302 Ga0105249_10026133 3300009553 Bacteria 5258
303 Ga0105249_10113417 3300009553 Bacteria 2565
304 Ga0105239_10146345 3300010375 Bacteria 2635
305 Ga0157373_10005502 3300013100 Bacteria 9500
306 Ga0157373_10020156 3300013100 Bacteria 4850
307 Ga0157373_10083240 3300013100 Bacteria 2255
308 Ga0157373_10111736 3300013100 Bacteria 1921
309 Ga0157373_10123833 3300013100 Bacteria 1818
310 Ga0157371_10002007 3300013102 Bacteria 20125
311 Ga0157371_10002411 3300013102 Bacteria 17884
312 Ga0157371_10003422 3300013102 Bacteria 14414
313 Ga0157371_10006284 3300013102 Bacteria 9839
314 Ga0157371_10017356 3300013102 Bacteria 5350
315 Ga0157371_10020877 3300013102 Bacteria 4816
316 Ga0157371_10021060 3300013102 Bacteria 4793
317 Ga0157371_10028174 3300013102 Bacteria 4069
318 Ga0157371_10041046 3300013102 Bacteria 3303
319 Ga0157371_10180366 3300013102 Bacteria 1511
320 Ga0157371_10191304 3300013102 Bacteria 1465
321 Ga0157371_10195340 3300013102 Bacteria 1449
322 Ga0157371_10251381 3300013102 Bacteria 1273
323 Ga0157371_10354450 3300013102 Bacteria 1068
324 Ga0157371_10430922 3300013102 Bacteria 968
325 Ga0157370_10007112 3300013104 Bacteria 12214
326 Ga0157370_10022437 3300013104 Bacteria 6280
327 Ga0157370_10067078 3300013104 Bacteria 3392
328 Ga0157370_10133813 3300013104 Bacteria 2312
329 Ga0157370_10155212 3300013104 Bacteria 2130
330 Ga0157370_10181971 3300013104 Bacteria 1953
331 Ga0157370_10605700 3300013104 Bacteria 1003
332 Ga0157369_10003518 3300013105 Bacteria 18613
333 Ga0157369_10004524 3300013105 Bacteria 16365
334 Ga0157369_10021274 3300013105 Bacteria 7254
335 Ga0157369_10042484 3300013105 Bacteria 4959
336 Ga0157369_10055420 3300013105 Bacteria 4279
337 Ga0157369_10094394 3300013105 Bacteria 3193
338 Ga0157369_10142141 3300013105 Bacteria 2539
339 Ga0157369_10179499 3300013105 Bacteria 2228
340 Ga0157369_10287459 3300013105 Bacteria 1712
341 Ga0157374_10024957 3300013296 Bacteria 5363
342 Ga0157374_10032457 3300013296 Bacteria 4754
343 Ga0157374_10173900 3300013296 Bacteria 2102
344 Ga0157374_10177931 3300013296 Bacteria 2077
345 Ga0157378_10009310 3300013297 Bacteria 8556
346 Ga0163162_10019478 3300013306 Bacteria 6657
347 Ga0157372_10040777 3300013307 Bacteria 5130
348 Ga0157372_10092818 3300013307 Bacteria 3434
349 Ga0157372_10162307 3300013307 Bacteria 2583
350 Ga0157372_10314923 3300013307 Bacteria 1822
351 Ga0157372_10512575 3300013307 Bacteria 1398
352 Ga0157372_10662191 3300013307 Bacteria 1216
353 Ga0157372_10698032 3300013307 Bacteria 1181
354 Ga0157375_10007721 3300013308 Bacteria 9415
355 Ga0157375_10264637 3300013308 Bacteria 1881
356 Ga0163163_10000173 3300014325 Bacteria 67717
357 Ga0163163_10092920 3300014325 Bacteria 3033
358 Ga0157380_10000713 3300014326 Bacteria 20783
359 Ga0157380_10061465 3300014326 Bacteria 3006
360 Ga0157379_10006729 3300014968 Bacteria 9931
361 Ga0163161_10050703 3300017792 Bacteria 3005
362 Ga0163161_10071102 3300017792 Bacteria 2545
363 Ga0163161_10379929 3300017792 Unclassified 1129
364 Ga0206353_11250066 3300020082 Bacteria 1760
365 Ga0213875_10092176 3300021388 Bacteria 1414
366 Ga0207666_1020650 3300025271 Bacteria 967
367 Ga0207697_10001976 3300025315 Bacteria 10865
368 Ga0207697_10015426 3300025315 Bacteria 3158
369 Ga0207697_10035157 3300025315 Bacteria 2051
370 Ga0207696_1059582 3300025711 Bacteria 1076
371 Ga0207682_10000595 3300025893 Bacteria 16781
372 Ga0207682_10006415 3300025893 Bacteria 4740
373 Ga0207642_10002992 3300025899 Bacteria 5292
374 Ga0207688_10029168 3300025901 Bacteria 3037
375 Ga0207688_10065821 3300025901 Bacteria 2049
376 Ga0207688_10276211 3300025901 Bacteria 1023
377 Ga0207680_10000613 3300025903 Bacteria 16839
378 Ga0207680_10100489 3300025903 Bacteria 1858
379 Ga0207647_10008146 3300025904 Bacteria 7530
380 Ga0207647_10013348 3300025904 Bacteria 5701
381 Ga0207647_10014785 3300025904 Bacteria 5368
382 Ga0207647_10022014 3300025904 Bacteria 4241
383 Ga0207647_10022979 3300025904 Bacteria 4134
384 Ga0207645_10008994 3300025907 Bacteria 6935
385 Ga0207645_10079536 3300025907 Bacteria 2101
386 Ga0207645_10093853 3300025907 Bacteria 1931
387 Ga0207705_10000003 3300025909 Bacteria 709270
388 Ga0207705_10000114 3300025909 Bacteria 90132
389 Ga0207705_10000169 3300025909 Bacteria 69941
390 Ga0207705_10003017 3300025909 Bacteria 12834
391 Ga0207705_10003821 3300025909 Bacteria 11458
392 Ga0207705_10007155 3300025909 Bacteria 8226
393 Ga0207705_10042178 3300025909 Bacteria 3276
394 Ga0207705_10211531 3300025909 Bacteria 1471
395 Ga0207705_10326197 3300025909 Bacteria 1180
396 Ga0207705_10358364 3300025909 Unclassified 1124
397 Ga0207654_10303569 3300025911 Bacteria 1086
398 Ga0207707_10433723 3300025912 Bacteria 1125
399 Ga0207695_10010012 3300025913 Bacteria 11643
400 Ga0207695_10010653 3300025913 Bacteria 11233
401 Ga0207660_10005689 3300025917 Bacteria 8089
402 Ga0207660_10138273 3300025917 Bacteria 1860
403 Ga0207660_10308354 3300025917 Bacteria 1261
404 Ga0207657_10000071 3300025919 Bacteria 93725
405 Ga0207657_10001262 3300025919 Bacteria 27027
406 Ga0207657_10001497 3300025919 Bacteria 24993
407 Ga0207657_10006836 3300025919 Bacteria 11768
408 Ga0207657_10007882 3300025919 Bacteria 10868
409 Ga0207657_10020713 3300025919 Bacteria 6208
410 Ga0207657_10020824 3300025919 Bacteria 6188
411 Ga0207657_10070264 3300025919 Bacteria 2968
412 Ga0207657_10104159 3300025919 Bacteria 2351
413 Ga0207657_10174114 3300025919 Bacteria 1742
414 Ga0207657_10347906 3300025919 Bacteria 1169
415 Ga0207657_10507370 3300025919 Bacteria 945
416 Ga0207649_10003393 3300025920 Bacteria 8710
417 Ga0207649_10058970 3300025920 Bacteria 2406
418 Ga0207649_10064002 3300025920 Bacteria 2324
419 Ga0207649_10081953 3300025920 Bacteria 2091
420 Ga0207649_10279387 3300025920 Bacteria 1213
421 Ga0207652_10018615 3300025921 Bacteria 5698
422 Ga0207652_10026606 3300025921 Bacteria 4820
423 Ga0207652_10029574 3300025921 Bacteria 4583
424 Ga0207652_10225466 3300025921 Bacteria 1689
425 Ga0207652_10294774 3300025921 Bacteria 1464
426 Ga0207681_10033441 3300025923 Bacteria 3371
427 Ga0207681_10053531 3300025923 Bacteria 2740
428 Ga0207681_10109003 3300025923 Bacteria 2011
429 Ga0207681_10151879 3300025923 Bacteria 1736
430 Ga0207681_10182537 3300025923 Bacteria 1599
431 Ga0207681_10276173 3300025923 Bacteria 1321
432 Ga0207694_10156150 3300025924 Bacteria 1840
433 Ga0207694_10491959 3300025924 Bacteria 1026
434 Ga0207650_10000997 3300025925 Bacteria 21289
435 Ga0207650_10003728 3300025925 Bacteria 10424
436 Ga0207650_10604629 3300025925 Bacteria 922
437 Ga0207659_10031979 3300025926 Bacteria 3607
438 Ga0207659_10092769 3300025926 Bacteria 2258
439 Ga0207659_10105602 3300025926 Bacteria 2132
440 Ga0207659_10397942 3300025926 Bacteria 1151
441 Ga0207687_10141952 3300025927 Bacteria 1823
442 Ga0207664_10019007 3300025929 Bacteria 5071
443 Ga0207664_10303789 3300025929 Bacteria 1404
444 Ga0207644_10002415 3300025931 Bacteria 12033
445 Ga0207644_10084985 3300025931 Bacteria 2346
446 Ga0207644_10191328 3300025931 Bacteria 1609
447 Ga0207644_10249378 3300025931 Unclassified 1416
448 Ga0207644_10252992 3300025931 Unclassified 1406
449 Ga0207690_10000045 3300025932 Bacteria 116965
450 Ga0207690_10002976 3300025932 Bacteria 10198
451 Ga0207690_10128641 3300025932 Bacteria 1850
452 Ga0207690_10209518 3300025932 Bacteria 1485
453 Ga0207690_10287697 3300025932 Bacteria 1282
454 Ga0207706_10000086 3300025933 Bacteria 95284
455 Ga0207706_10000401 3300025933 Bacteria 46630
456 Ga0207706_10003071 3300025933 Bacteria 16064
457 Ga0207706_10006625 3300025933 Bacteria 10719
458 Ga0207706_10014562 3300025933 Bacteria 7125
459 Ga0207706_10016090 3300025933 Bacteria 6759
460 Ga0207706_10017804 3300025933 Bacteria 6400
461 Ga0207706_10079327 3300025933 Bacteria 2887
462 Ga0207706_10178160 3300025933 Bacteria 1867
463 Ga0207686_10130418 3300025934 Bacteria 1723
464 Ga0207709_10055511 3300025935 Bacteria 2447
465 Ga0207709_10266519 3300025935 Bacteria 1258
466 Ga0207709_10384624 3300025935 Bacteria 1069
467 Ga0207669_10050190 3300025937 Bacteria 2492
468 Ga0207669_10080885 3300025937 Unclassified 2079
469 Ga0207669_10187286 3300025937 Bacteria 1489
470 Ga0207704_10199236 3300025938 Bacteria 1464
471 Ga0207691_10000693 3300025940 Bacteria 33328
472 Ga0207691_10001381 3300025940 Bacteria 24252
473 Ga0207691_10025059 3300025940 Bacteria 5604
474 Ga0207691_10162987 3300025940 Bacteria 1955
475 Ga0207691_10183936 3300025940 Bacteria 1825
476 Ga0207691_10210818 3300025940 Bacteria 1687
477 Ga0207691_10320608 3300025940 Bacteria 1329
478 Ga0207711_10000218 3300025941 Bacteria 61467
479 Ga0207711_10002330 3300025941 Bacteria 17013
480 Ga0207711_10004166 3300025941 Bacteria 12380
481 Ga0207711_10084572 3300025941 Bacteria 2777
482 Ga0207661_10879420 3300025944 Bacteria 825
483 Ga0207679_10000315 3300025945 Bacteria 36328
484 Ga0207679_10192589 3300025945 Bacteria 1697
485 Ga0207679_10204120 3300025945 Bacteria 1653
486 Ga0207667_10001152 3300025949 Bacteria 33245
487 Ga0207667_10007157 3300025949 Bacteria 13471
488 Ga0207667_10176345 3300025949 Bacteria 2196
489 Ga0207667_10245185 3300025949 Bacteria 1833
490 Ga0207667_10249070 3300025949 Bacteria 1817
491 Ga0207667_10327768 3300025949 Bacteria 1563
492 Ga0207667_10743672 3300025949 Bacteria 980
493 Ga0207651_10005717 3300025960 Bacteria 6420
494 Ga0207651_10034182 3300025960 Bacteria 3289
495 Ga0207651_10278785 3300025960 Bacteria 1380
496 Ga0207651_10351699 3300025960 Bacteria 1241
497 Ga0207712_10126816 3300025961 Bacteria 1939
498 Ga0207712_10222236 3300025961 Bacteria 1511
499 Ga0207668_10000021 3300025972 Bacteria 137592
500 Ga0207668_10000673 3300025972 Bacteria 20991
501 Ga0207668_10017690 3300025972 Bacteria 4472
502 Ga0207668_10046247 3300025972 Bacteria 2973
503 Ga0207668_10097402 3300025972 Bacteria 2177
504 Ga0207640_10001100 3300025981 Bacteria 14935
505 Ga0207640_10007769 3300025981 Bacteria 5922
506 Ga0207640_10017868 3300025981 Bacteria 4156
507 Ga0207640_10031155 3300025981 Bacteria 3292
508 Ga0207640_10074835 3300025981 Bacteria 2293
509 Ga0207640_10133170 3300025981 Bacteria 1800
510 Ga0207640_10137791 3300025981 Bacteria 1774
511 Ga0207658_10001945 3300025986 Bacteria 15425
512 Ga0207658_10004040 3300025986 Bacteria 10259
513 Ga0207658_10005047 3300025986 Bacteria 9087
514 Ga0207658_10013277 3300025986 Bacteria 5625
515 Ga0207658_10019436 3300025986 Bacteria 4698
516 Ga0207658_10048034 3300025986 Bacteria 3127
517 Ga0207658_10050191 3300025986 Bacteria 3069
518 Ga0207658_10134183 3300025986 Bacteria 1994
519 Ga0207658_10186592 3300025986 Bacteria 1720
520 Ga0207658_10282306 3300025986 Bacteria 1424
521 Ga0207658_10393446 3300025986 Bacteria 1217
522 Ga0207677_10063412 3300026023 Bacteria 2569
523 Ga0207677_10260539 3300026023 Bacteria 1413
524 Ga0207703_10005015 3300026035 Bacteria 10734
525 Ga0207703_10049055 3300026035 Bacteria 3412
526 Ga0207703_10055145 3300026035 Bacteria 3233
527 Ga0207639_10000330 3300026041 Bacteria 32864
528 Ga0207639_10059889 3300026041 Bacteria 2935
529 Ga0207678_10000311 3300026067 Bacteria 43860
530 Ga0207678_10002415 3300026067 Bacteria 16979
531 Ga0207678_10004098 3300026067 Bacteria 13106
532 Ga0207678_10012923 3300026067 Bacteria 7328
533 Ga0207678_10037769 3300026067 Bacteria 4200
534 Ga0207678_10052072 3300026067 Bacteria 3533
535 Ga0207678_10055330 3300026067 Bacteria 3418
536 Ga0207678_10112236 3300026067 Bacteria 2325
537 Ga0207678_10188772 3300026067 Bacteria 1761
538 Ga0207678_10208973 3300026067 Bacteria 1670
539 Ga0207702_10003195 3300026078 Bacteria 15141
540 Ga0207702_10023441 3300026078 Bacteria 5119
541 Ga0207702_10104098 3300026078 Bacteria 2511
542 Ga0207702_10367712 3300026078 Bacteria 1380
543 Ga0207702_10705944 3300026078 Unclassified 994
544 Ga0207641_10000573 3300026088 Bacteria 40695
545 Ga0207641_10028017 3300026088 Bacteria 4653
546 Ga0207641_10036536 3300026088 Bacteria 4101
547 Ga0207641_10179666 3300026088 Bacteria 1937
548 Ga0207641_10559507 3300026088 Bacteria 1116
549 Ga0207648_10008749 3300026089 Bacteria 9757
550 Ga0207648_10019946 3300026089 Bacteria 6049
551 Ga0207648_10020793 3300026089 Bacteria 5908
552 Ga0207648_10047542 3300026089 Bacteria 3760
553 Ga0207648_10069955 3300026089 Bacteria 3059
554 Ga0207676_10006684 3300026095 Bacteria 8158
555 Ga0207676_10014427 3300026095 Bacteria 5685
556 Ga0207676_10034435 3300026095 Bacteria 3835
557 Ga0207676_10076131 3300026095 Bacteria 2710
558 Ga0207676_10231530 3300026095 Bacteria 1652
559 Ga0207676_10243628 3300026095 Bacteria 1614
560 Ga0207676_10256411 3300026095 Bacteria 1577
561 Ga0207676_10294693 3300026095 Bacteria 1479
562 Ga0207674_10128912 3300026116 Bacteria 2494
563 Ga0207675_100020318 3300026118 Bacteria 6192
564 Ga0207683_10004683 3300026121 Bacteria 11787
565 Ga0207683_10005436 3300026121 Bacteria 10908
566 Ga0207683_10010651 3300026121 Bacteria 7838
567 Ga0207683_10013889 3300026121 Bacteria 6867
568 Ga0207683_10014939 3300026121 Bacteria 6609
569 Ga0207683_10407191 3300026121 Bacteria 1252
570 Ga0207698_10009232 3300026142 Bacteria 6275
571 Ga0207698_10019392 3300026142 Bacteria 4655
572 Ga0207698_10022821 3300026142 Bacteria 4360
573 Ga0207698_10025262 3300026142 Bacteria 4182
574 Ga0207698_10090233 3300026142 Bacteria 2506
575 Ga0207698_10205012 3300026142 Bacteria 1769
576 Ga0207698_10456987 3300026142 Bacteria 1234
577 Ga0207698_10592201 3300026142 Bacteria 1092
578 Ga0268266_10027719 3300028379 Bacteria 4816
579 Ga0268265_10000789 3300028380 Bacteria 30232
580 Ga0268265_10002174 3300028380 Bacteria 15167
581 Ga0268265_10031047 3300028380 Bacteria 3855
582 Ga0268265_10096033 3300028380 Bacteria 2381
583 Ga0268265_10203295 3300028380 Bacteria 1720
584 Ga0268265_10227586 3300028380 Bacteria 1636
585 Ga0268264_10002322 3300028381 Bacteria 16822
586 Ga0268264_10002999 3300028381 Bacteria 14637
587 Ga0268264_10047544 3300028381 Bacteria 3568
588 Ga0268264_10085956 3300028381 Bacteria 2701
589 Ga0268264_10140215 3300028381 Bacteria 2155
590 Ga0316182_1254826 3300030745 Bacteria 1736
591 Ga0307408_100029432 3300031548 Bacteria 3805
592 Ga0307408_100199261 3300031548 Bacteria 1619
593 Ga0307405_10023517 3300031731 Bacteria 3503
594 Ga0307405_10032158 3300031731 Bacteria 3098
595 Ga0307405_10214452 3300031731 Bacteria 1408
596 Ga0307413_10001145 3300031824 Bacteria 9730
597 Ga0307413_10015739 3300031824 Bacteria 3884
598 Ga0307413_10032869 3300031824 Bacteria 2946
599 Ga0307413_10033431 3300031824 Bacteria 2928
600 Ga0307413_10066338 3300031824 Bacteria 2252
601 Ga0307413_10177305 3300031824 Bacteria 1515
602 Ga0307413_10423507 3300031824 Bacteria 1049
603 Ga0307410_10000261 3300031852 Bacteria 20155
604 Ga0307410_10003012 3300031852 Bacteria 8313
605 Ga0307410_10072868 3300031852 Bacteria 2387
606 Ga0307410_10161969 3300031852 Bacteria 1677
607 Ga0307410_10169827 3300031852 Bacteria 1642
608 Ga0307410_10230552 3300031852 Bacteria 1429
609 Ga0307406_10017510 3300031901 Bacteria 4173
610 Ga0307406_10047735 3300031901 Bacteria 2700
611 Ga0307406_10279107 3300031901 Bacteria 1273
612 Ga0307407_10027800 3300031903 Bacteria 3015
613 Ga0307407_10098630 3300031903 Bacteria 1808
614 Ga0307407_10170717 3300031903 Bacteria 1432
615 Ga0307412_10016478 3300031911 Bacteria 4403
616 Ga0307412_10070589 3300031911 Bacteria 2381
617 Ga0307412_10080428 3300031911 Bacteria 2251
618 Ga0307412_10103442 3300031911 Bacteria 2018
619 Ga0307412_10198296 3300031911 Bacteria 1522
620 Ga0307409_100012216 3300031995 Bacteria 5462
621 Ga0307409_100015065 3300031995 Bacteria 5056
622 Ga0307409_100016750 3300031995 Bacteria 4862
623 Ga0307409_100139202 3300031995 Bacteria 2088
624 Ga0307409_100189558 3300031995 Bacteria 1829
625 Ga0307409_100505432 3300031995 Bacteria 1178
626 Ga0307409_100715763 3300031995 Bacteria 1002
627 Ga0307416_100178748 3300032002 Bacteria 1986
628 Ga0307416_100533994 3300032002 Bacteria 1243
629 Ga0307414_10034797 3300032004 Bacteria 3344
630 Ga0307411_10027064 3300032005 Bacteria 3463
631 Ga0307411_10037020 3300032005 Bacteria 3063
632 Ga0307411_10075542 3300032005 Bacteria 2300
633 Ga0307411_10101073 3300032005 Bacteria 2039
634 Ga0307411_10106279 3300032005 Bacteria 1997
635 Ga0307411_10240087 3300032005 Bacteria 1418
636 Ga0307415_100029286 3300032126 Bacteria 3516
637 Ga0307415_100029673 3300032126 Bacteria 3498
638 Ga0307415_100046115 3300032126 Bacteria 2926
639 Ga0307415_100050317 3300032126 Bacteria 2823
640 Ga0307415_100133387 3300032126 Bacteria 1884
641 Ga0307415_100413205 3300032126 Bacteria 1155
642 Ga0307415_100460001 3300032126 Bacteria 1102
643 Ga0307415_100463885 3300032126 Bacteria 1098
644 Ga0373929_0034383 3300035085 Bacteria 1099
645 Ga0373923_0010101 3300035111 Bacteria 3425
646 Ga0373954_0023868 3300035118 Bacteria 2786
647 Ga0395899_0000469 3300037312 Bacteria 45619
648 Ga0395899_0000882 3300037312 Bacteria 28508
649 Ga0395899_0024984 3300037312 Bacteria 4512
650 Ga0395899_0029916 3300037312 Bacteria 4098
651 Ga0395899_0036127 3300037312 Bacteria 3707
652 Ga0395899_0067508 3300037312 Bacteria 2623
653 Ga0395899_0078754 3300037312 Bacteria 2401
654 Ga0395899_0105135 3300037312 Bacteria 2034
655 Ga0395899_0118442 3300037312 Bacteria 1899
656 Ga0395899_0133478 3300037312 Bacteria 1771
657 Ga0395899_0205104 3300037312 Bacteria 1372
658 Ga0395899_0239304 3300037312 Bacteria 1250
659 Ga0395900_0002613 3300037418 Bacteria 19679
660 Ga0395900_0009960 3300037418 Bacteria 9730
661 Ga0395900_0034531 3300037418 Bacteria 5209
662 Ga0395900_0039357 3300037418 Bacteria 4871
663 Ga0395900_0040442 3300037418 Bacteria 4805
664 Ga0395900_0053036 3300037418 Bacteria 4174
665 Ga0395900_0085060 3300037418 Bacteria 3251
666 Ga0395900_0166652 3300037418 Bacteria 2245
667 Ga0395900_0181202 3300037418 Bacteria 2140
668 Ga0395900_0188030 3300037418 Bacteria 2096
669 Ga0395900_0201511 3300037418 Bacteria 2013
670 Ga0395900_0276488 3300037418 Viruses 1672
671 Ga0395900_0333292 3300037418 Bacteria 1495
672 Ga0395900_0521922 3300037418 Bacteria 1135
673 Ga0395900_0582813 3300037418 Bacteria 1060
674 Ga0395900_0670359 3300037418 Bacteria 972
675 Ga0395898_0002231 3300037466 Bacteria 23591
676 Ga0395898_0002321 3300037466 Bacteria 22734
677 Ga0395898_0003885 3300037466 Bacteria 16500
678 Ga0395898_0030071 3300037466 Bacteria 5439
679 Ga0395898_0055064 3300037466 Bacteria 3879
680 Ga0395898_0058713 3300037466 Bacteria 3745
681 Ga0395898_0151759 3300037466 Bacteria 2216
682 Ga0395905_0000852 3300037471 Bacteria 39836
683 Ga0395905_0003384 3300037471 Bacteria 17080
684 Ga0395905_0003854 3300037471 Bacteria 15814
685 Ga0395905_0006999 3300037471 Bacteria 11275
686 Ga0395905_0010977 3300037471 Bacteria 8766
687 Ga0395905_0014983 3300037471 Bacteria 7394
688 Ga0395905_0047344 3300037471 Bacteria 4030
689 Ga0395905_0070343 3300037471 Bacteria 3279
690 Ga0395905_0072001 3300037471 Bacteria 3240
691 Ga0395905_0110378 3300037471 Bacteria 2583
692 Ga0395905_0144104 3300037471 Bacteria 2241
693 Ga0395905_0184796 3300037471 Bacteria 1957
694 Ga0395905_0205156 3300037471 Bacteria 1847
695 Ga0395905_0540765 3300037471 Unclassified 1066
696 Ga0395905_0541034 3300037471 Bacteria 1066
697 Ga0395901_0001956 3300038443 Bacteria 21217
698 Ga0395901_0019190 3300038443 Bacteria 6989
699 Ga0395901_0032798 3300038443 Bacteria 5358
700 Ga0395901_0058836 3300038443 Bacteria 3998
701 Ga0395901_0069994 3300038443 Bacteria 3655
702 Ga0395901_0189161 3300038443 Unclassified 2159
703 Ga0395901_0189432 3300038443 Viruses 2157
704 Ga0395901_0309775 3300038443 Bacteria 1635
705 Ga0395901_0356646 3300038443 Unclassified 1509
706 Ga0395901_0552496 3300038443 Bacteria 1167
707 Ga0395901_0693027 3300038443 Bacteria 1017
708 Ga0436365_1268241 3300039437 Bacteria 8581
709 Ga0451793_0850235 3300041452 Bacteria 4899
710 Ga0451797_0672500 3300041453 Bacteria 2586
711 Ga0451853_0229005 3300041512 Bacteria 1564
712 Ga0439458_0000231 3300042157 Bacteria 13292
713 Ga0466969_0007189 3300044656 Bacteria 5921
714 Ga0466969_0067857 3300044656 Bacteria 1720
715 Ga0466972_0187108 3300044658 Bacteria 970
716 Ga0466965_0069334 3300044683 Bacteria 1772
717 Ga0466966_0005634 3300044684 Bacteria 8237
718 Ga0466966_0028674 3300044684 Bacteria 3623
719 Ga0466966_0050347 3300044684 Bacteria 2650
720 Ga0466966_0074516 3300044684 Bacteria 2121
721 Ga0466966_0161149 3300044684 Bacteria 1366
722 Ga0466966_0406240 3300044684 Bacteria 818
723 Ga0466961_0026322 3300044693 Bacteria 3739
724 Ga0466961_0027122 3300044693 Bacteria 3683
725 Ga0466961_0074439 3300044693 Bacteria 2153
726 Ga0466963_0005389 3300044694 Bacteria 7488
727 Ga0466963_0010351 3300044694 Bacteria 5645
728 Ga0466963_0048837 3300044694 Bacteria 2798
729 Ga0466963_0083234 3300044694 Bacteria 2170
730 Ga0466963_0266356 3300044694 Bacteria 1203
731 Ga0466964_0033773 3300044706 Bacteria 2039
732 Ga0466971_0001498 3300044719 Bacteria 9858
733 Ga0466971_0001516 3300044719 Bacteria 9787
734 Ga0466970_0005781 3300044765 Bacteria 6149
735 Ga0466970_0012662 3300044765 Bacteria 4315
736 Ga0466957_0008128 3300044842 Bacteria 5955
737 Ga0466957_0008541 3300044842 Bacteria 5828
738 Ga0466957_0009728 3300044842 Bacteria 5491
739 Ga0466957_0080749 3300044842 Bacteria 2025
740 Ga0466960_0119706 3300044901 Bacteria 1378
741 Ga0466959_0041126 3300045049 Bacteria 3413
742 Ga0466959_0078523 3300045049 Bacteria 2380
743 Ga0466959_0138088 3300045049 Unclassified 1724
744 Ga0466959_0323204 3300045049 Bacteria 1054
745 Ga0466958_0000595 3300045836 Bacteria 15417
746 Ga0466958_0002509 3300045836 Bacteria 9251
747 Ga0466958_0115907 3300045836 Bacteria 1674
748 Ga0466958_0175160 3300045836 Bacteria 1360
749 Ga0466958_0298845 3300045836 Bacteria 1033
750 Ga0466967_0039189 3300045976 Bacteria 4071
751 Ga0466967_0041813 3300045976 Bacteria 3956
752 Ga0466967_0156656 3300045976 Bacteria 2134
753 Ga0495603_0160154 3300046455 Bacteria 1306
754 Ga0495585_0100420 3300046492 Bacteria 1548
755 Ga0495663_0000381 3300046525 Bacteria 16415
756 Ga0495663_0025790 3300046525 Bacteria 1716
757 Ga0495663_0065678 3300046525 Bacteria 1147
758 Ga0495663_0088783 3300046525 Bacteria 1005
759 Ga0495598_0124703 3300046537 Bacteria 877
760 Ga0495621_0000168 3300046539 Bacteria 14780
761 Ga0495621_0026290 3300046539 Bacteria 1962
762 Ga0495633_0052101 3300046558 Bacteria 1928
763 Ga0495633_0077384 3300046558 Bacteria 1549
764 Ga0495633_0101843 3300046558 Bacteria 1333
765 Ga0495668_0066257 3300046616 Bacteria 1987
766 Ga0495625_0340725 3300046660 Bacteria 950
767 Ga0495635_0246560 3300046663 Bacteria 1205
768 Ga0495659_0008804 3300046664 Bacteria 3213
769 Ga0495669_0026584 3300046684 Bacteria 2529
770 Ga0495669_0102120 3300046684 Bacteria 1333
771 Ga0495669_0188942 3300046684 Bacteria 983
772 Ga0495669_0217692 3300046684 Bacteria 915
773 Ga0495670_0009846 3300046691 Bacteria 4701
774 Ga0495670_0163702 3300046691 Bacteria 1169
775 Ga0495581_0091634 3300047315 Bacteria 1764
776 Ga0495677_0001639 3300047445 Bacteria 8998
777 Ga0495677_0034266 3300047445 Bacteria 1852
778 Ga0495685_066401 3300047447 Bacteria 1212
779 Ga0496100_0286289 3300048903 Bacteria 1230
780 Ga0496101_0087431 3300048904 Bacteria 2313
781 Ga0496102_0020946 3300048905 Bacteria 5782
782 Ga0496103_0065008 3300048906 Bacteria 2275
783 Ga0496104_0403719 3300048907 Bacteria 1279
784 Ga0496105_0396733 3300048908 Bacteria 1096
785 Ga0496106_0015217 3300048909 Bacteria 5693
786 Ga0496106_0142507 3300048909 Bacteria 1886
787 Ga0496107_0045483 3300048910 Bacteria 3158
788 Ga0496107_0135589 3300048910 Bacteria 1818
789 Ga0496108_0007326 3300048911 Bacteria 8943
790 Ga0496108_0019746 3300048911 Bacteria 5536
791 Ga0496108_0033296 3300048911 Bacteria 4281
792 Ga0496109_0008301 3300048912 Bacteria 8819
793 Ga0496109_0012282 3300048912 Bacteria 7393
794 Ga0496109_0530173 3300048912 Bacteria 1111
795 Ga0496110_0045225 3300048913 Bacteria 3847
796 Ga0496110_0239628 3300048913 Unclassified 1650
797 Ga0496110_0300509 3300048913 Bacteria 1462
798 Ga0496111_0013499 3300048914 Bacteria 5562
799 Ga0496111_0024060 3300048914 Bacteria 4283
800 Ga0496112_0010155 3300048915 Bacteria 8530
801 Ga0496112_0031781 3300048915 Bacteria 5121
802 Ga0496112_0164665 3300048915 Bacteria 2183
803 Ga0496112_0187466 3300048915 Bacteria 2032
804 Ga0496113_0006537 3300048916 Bacteria 7400
805 Ga0496113_0028199 3300048916 Bacteria 4035
806 Ga0496114_0000023 3300048917 Bacteria 219092
807 Ga0496114_0034274 3300048917 Bacteria 4188
808 Ga0496114_0125936 3300048917 Bacteria 2208
809 Ga0496114_0482612 3300048917 Bacteria 1097
810 nmdc:mga06r32_24074_c1 3300050510 Bacteria 5645
811 nmdc:mga08y16_274064_c1 3300050511 Bacteria 1741
812 nmdc:mga0rr50_456951_c1 3300050513 Bacteria 1083
813 Ga0500658_0027232 3300053134 Bacteria 2208
814 Ga0590077_048078 3300059426 Bacteria 955
815 Ga0466962_0000756 3300061719 Bacteria 14477
816 Ga0466962_0002209 3300061719 Bacteria 9197
817 Ga0466962_0034813 3300061719 Bacteria 2411
818 Ga0466962_0261311 3300061719 Unclassified 852
819 2896430755 2896429255 Bacteria 2557483
820 Ga0207683_10253708
821 JGI24736J21556_1000088
822 JGI24752J21851_1002175
823 JGI24740J21852_10003266
824 JGI24739J22299_10001795
825 JGI24737J22298_10001166
826 JGI24737J22298_10010428
827 JGI24737J22298_10059284
828 JGI24735J21928_10007888
829 JGI24735J21928_10045769
830 JGI24738J21930_10000237
831 Ga0065715_10000902
832 Ga0070658_10000205
833 Ga0070658_10036962
834 Ga0070658_10038175
835 Ga0070658_10042298
836 Ga0070658_10106010
837 Ga0070658_10124626
838 Ga0070658_10185245
839 Ga0070658_10408201
840 Ga0070658_10559865
841 Ga0070676_10003558
842 Ga0070676_10016348
843 Ga0070676_10068053
844 Ga0070676_10116732
845 Ga0070683_100004542
846 Ga0070683_100036109
847 Ga0070683_100160152
848 Ga0070690_100002718
849 Ga0070670_100001324
850 Ga0070670_100048670
851 Ga0070670_100593673
852 Ga0070677_10000275
853 Ga0070666_10000168
854 Ga0070666_10032423
855 Ga0070666_10216122
856 Ga0070680_100006630
857 Ga0070680_100098220
858 Ga0070680_100101052
859 Ga0070680_100376368
860 Ga0070682_100096697
861 Ga0070682_100287212
862 Ga0070682_100323971
863 Ga0068868_100014045
864 Ga0068868_100082609
865 Ga0068868_100241992
866 Ga0070660_100000009
867 Ga0070660_100004590
868 Ga0070660_100006002
869 Ga0070660_100012719
870 Ga0070660_100038646
871 Ga0070660_100046787
872 Ga0070660_100062052
873 Ga0070660_100126334
874 Ga0070660_100155311
875 Ga0070660_100281818
876 Ga0070660_100452759
877 Ga0070687_100393118
878 Ga0070661_100000100
879 Ga0070661_100019177
880 Ga0070661_100026556
881 Ga0070661_100042263
882 Ga0070661_100060693
883 Ga0070661_100102555
884 Ga0070661_100127081
885 Ga0070692_10002409
886 Ga0070692_10009418
887 Ga0070692_10203621
888 Ga0070692_10263399
889 Ga0070668_100001906
890 Ga0070668_100024681
891 Ga0070668_100039524
892 Ga0070669_100003417
893 Ga0070669_100020276
894 Ga0070669_100068315
895 Ga0070675_100003230
896 Ga0070675_100024582
897 Ga0070675_100094024
898 Ga0070675_100177660
899 Ga0070675_100361204
900 Ga0070675_100504172
901 Ga0070671_100011680
902 Ga0070671_100013050
903 Ga0070671_100023983
904 Ga0070671_100027135
905 Ga0070671_100097305
906 Ga0070671_100253915
907 Ga0070671_100258133
908 Ga0070671_100560667
909 Ga0070674_100005112
910 Ga0070674_100019554
911 Ga0070674_100129679
912 Ga0070674_100147047
913 Ga0070674_100168485
914 Ga0070673_100024388
915 Ga0070673_100108079
916 Ga0070673_100114237
917 Ga0070659_100009072
918 Ga0070659_100137400
919 Ga0070659_100155438
920 Ga0070659_100210161
921 Ga0070659_100268505
922 Ga0070659_100276059
923 Ga0070659_100386357
924 Ga0070659_100584236
925 Ga0070667_100001032
926 Ga0070667_100005549
927 Ga0070667_100021642
928 Ga0070667_100023180
929 Ga0070667_100052724
930 Ga0070667_100060661
931 Ga0070667_100157723
932 Ga0070667_100190402
933 Ga0070667_100208437
934 Ga0070667_100340575
935 Ga0070667_100354206
936 Ga0070667_100496342
937 Ga0070709_10006855
938 Ga0070714_100029226
939 Ga0070714_100136519
940 Ga0070714_100230245
941 Ga0070705_100183326
942 Ga0070663_100002974
943 Ga0070663_100010101
944 Ga0070663_100010467
945 Ga0070663_100036917
946 Ga0070663_100047915
947 Ga0070663_100072434
948 Ga0070663_100081742
949 Ga0070663_100082949
950 Ga0070663_100097972
951 Ga0070663_100510412
952 Ga0070678_100000515
953 Ga0070678_100007809
954 Ga0070678_100016482
955 Ga0070678_100029793
956 Ga0070678_100036059
957 Ga0070678_100274696
958 Ga0070662_100000035
959 Ga0070662_100001356
960 Ga0070662_100027937
961 Ga0070662_100044636
962 Ga0070662_100075839
963 Ga0070662_100176134
964 Ga0070662_100234288
965 Ga0070662_100290261
966 Ga0070662_100311097
967 Ga0070662_100330280
968 Ga0070662_100418229
969 Ga0070662_100617154
970 Ga0070681_10039758
971 Ga0070681_10062150
972 Ga0070681_10251100
973 Ga0070681_10351624
974 Ga0070681_10411166
975 Ga0070681_10628758
976 Ga0068867_100001817
977 Ga0068867_100003846
978 Ga0068867_100056465
979 Ga0068867_100106824
980 Ga0070679_100013900
981 Ga0070679_100022595
982 Ga0070679_100088459
983 Ga0070679_100225898
984 Ga0070679_100248137
985 Ga0070679_100265707
986 Ga0070684_100005397
987 Ga0070684_100034267
988 Ga0070684_100226443
989 Ga0068853_100516894
990 Ga0070672_100001525
991 Ga0070672_100004387
992 Ga0070672_100163225
993 Ga0070686_100446628
994 Ga0070695_100152172
995 Ga0070693_100025198
996 Ga0070665_100011012
997 Ga0070665_100026188
998 Ga0070665_100157936
999 Ga0068855_100001487
1000 Ga0068855_100006301
1001 Ga0068855_100017599
1002 Ga0068855_100050642
1003 Ga0068855_100208366
1004 Ga0068855_100377168
1005 Ga0068855_100420271
1006 Ga0068855_100643394
1007 Ga0070664_100000025
1008 Ga0070664_100001781
1009 Ga0070664_100003402
1010 Ga0070664_100076108
1011 Ga0070664_100224381
1012 Ga0070664_100325870
1013 Ga0068857_100080370
1014 Ga0068854_100002567
1015 Ga0068854_100024096
1016 Ga0068854_100031164
1017 Ga0068854_100040712
1018 Ga0068854_100062377
1019 Ga0068854_100152404
1020 Ga0068856_100000219
1021 Ga0068856_100003046
1022 Ga0068856_100051425
1023 Ga0068856_100080324
1024 Ga0068856_100141609
1025 Ga0068856_100161668
1026 Ga0068852_100001469
1027 Ga0068852_100003830
1028 Ga0068852_100007274
1029 Ga0068852_100011351
1030 Ga0068852_100087184
1031 Ga0068852_100118991
1032 Ga0068852_100128648
1033 Ga0068852_100142460
1034 Ga0068852_100151164
1035 Ga0068859_100001691
1036 Ga0068859_100013576
1037 Ga0068859_100048424
1038 Ga0068859_100072815
1039 Ga0068859_100078898
1040 Ga0068864_100081837
1041 Ga0068864_100102796
1042 Ga0068864_100180441
1043 Ga0068864_100246175
1044 Ga0068864_100268404
1045 Ga0068864_100716897
1046 Ga0068866_10002573
1047 Ga0068866_10054121
1048 Ga0068861_100089865
1049 Ga0068861_100133040
1050 Ga0068851_10003930
1051 Ga0068851_10013119
1052 Ga0068851_10057783
1053 Ga0068870_10012263
1054 Ga0068863_100053469
1055 Ga0068863_100103574
1056 Ga0068863_100108363
1057 Ga0068863_100179019
1058 Ga0068863_100194064
1059 Ga0068863_100500726
1060 Ga0068858_100000874
1061 Ga0068858_100010680
1062 Ga0068858_100408628
1063 Ga0068860_100002325
1064 Ga0068860_100006399
1065 Ga0068860_100117189
1066 Ga0068862_100003744
1067 Ga0068862_100005814
1068 Ga0068862_100018881
1069 Ga0068862_100020846
1070 Ga0068862_100112537
1071 Ga0097621_100002777
1072 Ga0097621_100027072
1073 Ga0097621_100192521
1074 Ga0097621_100202096
1075 Ga0075370_10050686
1076 Ga0068871_100002519
1077 Ga0068871_100101832
1078 Ga0068871_100362822
1079 Ga0075428_100037243
1080 Ga0075431_100067082
1081 Ga0068865_100019791
1082 Ga0068865_100301003
1083 Ga0097620_100001691
1084 Ga0097620_100013576
1085 Ga0097620_100048424
1086 Ga0097620_100072817
1087 Ga0097620_100078895
1088 Ga0075435_100487770
1089 Ga0105250_10006445
1090 Ga0105250_10198876
1091 Ga0105240_10017468
1092 Ga0105240_10181211
1093 Ga0105240_10254879
1094 Ga0105240_10487279
1095 Ga0111539_10282653
1096 Ga0105245_10096984
1097 Ga0105245_10097546
1098 Ga0114129_10218777
1099 Ga0114129_10846490
1100 Ga0105243_10092110
1101 Ga0105243_10264046
1102 Ga0105243_10267893
1103 Ga0105241_10220293
1104 Ga0105241_10350199
1105 Ga0105241_10369052
1106 Ga0105241_10823381
1107 Ga0105242_10063197
1108 Ga0105242_10959397
1109 Ga0105248_10000163
1110 Ga0105248_10000413
1111 Ga0105248_10004409
1112 Ga0105248_10008513
1113 Ga0105248_10014059
1114 Ga0105248_10021512
1115 Ga0105248_10031200
1116 Ga0105248_10070369
1117 Ga0105238_10055781
1118 Ga0105238_10134605
1119 Ga0105238_10432463
1120 Ga0105238_10444542
1121 Ga0105249_10026133
1122 Ga0105249_10113417
1123 Ga0105239_10146345
1124 Ga0157373_10005502
1125 Ga0157373_10020156
1126 Ga0157373_10083240
1127 Ga0157373_10111736
1128 Ga0157373_10123833
1129 Ga0157371_10002007
1130 Ga0157371_10002411
1131 Ga0157371_10003422
1132 Ga0157371_10006284
1133 Ga0157371_10017356
1134 Ga0157371_10020877
1135 Ga0157371_10021060
1136 Ga0157371_10028174
1137 Ga0157371_10041046
1138 Ga0157371_10180366
1139 Ga0157371_10191304
1140 Ga0157371_10195340
1141 Ga0157371_10251381
1142 Ga0157371_10354450
1143 Ga0157371_10430922
1144 Ga0157370_10007112
1145 Ga0157370_10022437
1146 Ga0157370_10067078
1147 Ga0157370_10133813
1148 Ga0157370_10155212
1149 Ga0157370_10181971
1150 Ga0157370_10605700
1151 Ga0157369_10003518
1152 Ga0157369_10004524
1153 Ga0157369_10021274
1154 Ga0157369_10042484
1155 Ga0157369_10055420
1156 Ga0157369_10094394
1157 Ga0157369_10142141
1158 Ga0157369_10179499
1159 Ga0157369_10287459
1160 Ga0157374_10024957
1161 Ga0157374_10032457
1162 Ga0157374_10173900
1163 Ga0157374_10177931
1164 Ga0157378_10009310
1165 Ga0163162_10019478
1166 Ga0157372_10040777
1167 Ga0157372_10092818
1168 Ga0157372_10162307
1169 Ga0157372_10314923
1170 Ga0157372_10512575
1171 Ga0157372_10662191
1172 Ga0157372_10698032
1173 Ga0157375_10007721
1174 Ga0157375_10264637
1175 Ga0163163_10000173
1176 Ga0163163_10092920
1177 Ga0157380_10000713
1178 Ga0157380_10061465
1179 Ga0157379_10006729
1180 Ga0163161_10050703
1181 Ga0163161_10071102
1182 Ga0163161_10379929
1183 Ga0206353_11250066
1184 Ga0213875_10092176
1185 Ga0207666_1020650
1186 Ga0207697_10001976
1187 Ga0207697_10015426
1188 Ga0207697_10035157
1189 Ga0207696_1059582
1190 Ga0207682_10000595
1191 Ga0207682_10006415
1192 Ga0207642_10002992
1193 Ga0207688_10029168
1194 Ga0207688_10065821
1195 Ga0207688_10276211
1196 Ga0207680_10000613
1197 Ga0207680_10100489
1198 Ga0207647_10008146
1199 Ga0207647_10013348
1200 Ga0207647_10014785
1201 Ga0207647_10022014
1202 Ga0207647_10022979
1203 Ga0207645_10008994
1204 Ga0207645_10079536
1205 Ga0207645_10093853
1206 Ga0207705_10000003
1207 Ga0207705_10000114
1208 Ga0207705_10000169
1209 Ga0207705_10003017
1210 Ga0207705_10003821
1211 Ga0207705_10007155
1212 Ga0207705_10042178
1213 Ga0207705_10211531
1214 Ga0207705_10326197
1215 Ga0207705_10358364
1216 Ga0207654_10303569
1217 Ga0207707_10433723
1218 Ga0207695_10010012
1219 Ga0207695_10010653
1220 Ga0207660_10005689
1221 Ga0207660_10138273
1222 Ga0207660_10308354
1223 Ga0207657_10000071
1224 Ga0207657_10001262
1225 Ga0207657_10001497
1226 Ga0207657_10006836
1227 Ga0207657_10007882
1228 Ga0207657_10020713
1229 Ga0207657_10020824
1230 Ga0207657_10070264
1231 Ga0207657_10104159
1232 Ga0207657_10174114
1233 Ga0207657_10347906
1234 Ga0207657_10507370
1235 Ga0207649_10003393
1236 Ga0207649_10058970
1237 Ga0207649_10064002
1238 Ga0207649_10081953
1239 Ga0207649_10279387
1240 Ga0207652_10018615
1241 Ga0207652_10026606
1242 Ga0207652_10029574
1243 Ga0207652_10225466
1244 Ga0207652_10294774
1245 Ga0207681_10033441
1246 Ga0207681_10053531
1247 Ga0207681_10109003
1248 Ga0207681_10151879
1249 Ga0207681_10182537
1250 Ga0207681_10276173
1251 Ga0207694_10156150
1252 Ga0207694_10491959
1253 Ga0207650_10000997
1254 Ga0207650_10003728
1255 Ga0207650_10604629
1256 Ga0207659_10031979
1257 Ga0207659_10092769
1258 Ga0207659_10105602
1259 Ga0207659_10397942
1260 Ga0207687_10141952
1261 Ga0207664_10019007
1262 Ga0207664_10303789
1263 Ga0207644_10002415
1264 Ga0207644_10084985
1265 Ga0207644_10191328
1266 Ga0207644_10249378
1267 Ga0207644_10252992
1268 Ga0207690_10000045
1269 Ga0207690_10002976
1270 Ga0207690_10128641
1271 Ga0207690_10209518
1272 Ga0207690_10287697
1273 Ga0207706_10000086
1274 Ga0207706_10000401
1275 Ga0207706_10003071
1276 Ga0207706_10006625
1277 Ga0207706_10014562
1278 Ga0207706_10016090
1279 Ga0207706_10017804
1280 Ga0207706_10079327
1281 Ga0207706_10178160
1282 Ga0207686_10130418
1283 Ga0207709_10055511
1284 Ga0207709_10266519
1285 Ga0207709_10384624
1286 Ga0207669_10050190
1287 Ga0207669_10080885
1288 Ga0207669_10187286
1289 Ga0207704_10199236
1290 Ga0207691_10000693
1291 Ga0207691_10001381
1292 Ga0207691_10025059
1293 Ga0207691_10162987
1294 Ga0207691_10183936
1295 Ga0207691_10210818
1296 Ga0207691_10320608
1297 Ga0207711_10000218
1298 Ga0207711_10002330
1299 Ga0207711_10004166
1300 Ga0207711_10084572
1301 Ga0207661_10879420
1302 Ga0207679_10000315
1303 Ga0207679_10192589
1304 Ga0207679_10204120
1305 Ga0207667_10001152
1306 Ga0207667_10007157
1307 Ga0207667_10176345
1308 Ga0207667_10245185
1309 Ga0207667_10249070
1310 Ga0207667_10327768
1311 Ga0207667_10743672
1312 Ga0207651_10005717
1313 Ga0207651_10034182
1314 Ga0207651_10278785
1315 Ga0207651_10351699
1316 Ga0207712_10126816
1317 Ga0207712_10222236
1318 Ga0207668_10000021
1319 Ga0207668_10000673
1320 Ga0207668_10017690
1321 Ga0207668_10046247
1322 Ga0207668_10097402
1323 Ga0207640_10001100
1324 Ga0207640_10007769
1325 Ga0207640_10017868
1326 Ga0207640_10031155
1327 Ga0207640_10074835
1328 Ga0207640_10133170
1329 Ga0207640_10137791
1330 Ga0207658_10001945
1331 Ga0207658_10004040
1332 Ga0207658_10005047
1333 Ga0207658_10013277
1334 Ga0207658_10019436
1335 Ga0207658_10048034
1336 Ga0207658_10050191
1337 Ga0207658_10134183
1338 Ga0207658_10186592
1339 Ga0207658_10282306
1340 Ga0207658_10393446
1341 Ga0207677_10063412
1342 Ga0207677_10260539
1343 Ga0207703_10005015
1344 Ga0207703_10049055
1345 Ga0207703_10055145
1346 Ga0207639_10000330
1347 Ga0207639_10059889
1348 Ga0207678_10000311
1349 Ga0207678_10002415
1350 Ga0207678_10004098
1351 Ga0207678_10012923
1352 Ga0207678_10037769
1353 Ga0207678_10052072
1354 Ga0207678_10055330
1355 Ga0207678_10112236
1356 Ga0207678_10188772
1357 Ga0207678_10208973
1358 Ga0207702_10003195
1359 Ga0207702_10023441
1360 Ga0207702_10104098
1361 Ga0207702_10367712
1362 Ga0207702_10705944
1363 Ga0207641_10000573
1364 Ga0207641_10028017
1365 Ga0207641_10036536
1366 Ga0207641_10179666
1367 Ga0207641_10559507
1368 Ga0207648_10008749
1369 Ga0207648_10019946
1370 Ga0207648_10020793
1371 Ga0207648_10047542
1372 Ga0207648_10069955
1373 Ga0207676_10006684
1374 Ga0207676_10014427
1375 Ga0207676_10034435
1376 Ga0207676_10076131
1377 Ga0207676_10231530
1378 Ga0207676_10243628
1379 Ga0207676_10256411
1380 Ga0207676_10294693
1381 Ga0207674_10128912
1382 Ga0207675_100020318
1383 Ga0207683_10004683
1384 Ga0207683_10005436
1385 Ga0207683_10010651
1386 Ga0207683_10013889
1387 Ga0207683_10014939
1388 Ga0207683_10407191
1389 Ga0207698_10009232
1390 Ga0207698_10019392
1391 Ga0207698_10022821
1392 Ga0207698_10025262
1393 Ga0207698_10090233
1394 Ga0207698_10205012
1395 Ga0207698_10456987
1396 Ga0207698_10592201
1397 Ga0268266_10027719
1398 Ga0268265_10000789
1399 Ga0268265_10002174
1400 Ga0268265_10031047
1401 Ga0268265_10096033
1402 Ga0268265_10203295
1403 Ga0268265_10227586
1404 Ga0268264_10002322
1405 Ga0268264_10002999
1406 Ga0268264_10047544
1407 Ga0268264_10085956
1408 Ga0268264_10140215
1409 Ga0316182_1254826
1410 Ga0307408_100029432
1411 Ga0307408_100199261
1412 Ga0307405_10023517
1413 Ga0307405_10032158
1414 Ga0307405_10214452
1415 Ga0307413_10001145
1416 Ga0307413_10015739
1417 Ga0307413_10032869
1418 Ga0307413_10033431
1419 Ga0307413_10066338
1420 Ga0307413_10177305
1421 Ga0307413_10423507
1422 Ga0307410_10000261
1423 Ga0307410_10003012
1424 Ga0307410_10072868
1425 Ga0307410_10161969
1426 Ga0307410_10169827
1427 Ga0307410_10230552
1428 Ga0307406_10017510
1429 Ga0307406_10047735
1430 Ga0307406_10279107
1431 Ga0307407_10027800
1432 Ga0307407_10098630
1433 Ga0307407_10170717
1434 Ga0307412_10016478
1435 Ga0307412_10070589
1436 Ga0307412_10080428
1437 Ga0307412_10103442
1438 Ga0307412_10198296
1439 Ga0307409_100012216
1440 Ga0307409_100015065
1441 Ga0307409_100016750
1442 Ga0307409_100139202
1443 Ga0307409_100189558
1444 Ga0307409_100505432
1445 Ga0307409_100715763
1446 Ga0307416_100178748
1447 Ga0307416_100533994
1448 Ga0307414_10034797
1449 Ga0307411_10027064
1450 Ga0307411_10037020
1451 Ga0307411_10075542
1452 Ga0307411_10101073
1453 Ga0307411_10106279
1454 Ga0307411_10240087
1455 Ga0307415_100029286
1456 Ga0307415_100029673
1457 Ga0307415_100046115
1458 Ga0307415_100050317
1459 Ga0307415_100133387
1460 Ga0307415_100413205
1461 Ga0307415_100460001
1462 Ga0307415_100463885
1463 Ga0373929_0034383
1464 Ga0373923_0010101
1465 Ga0373954_0023868
1466 Ga0395899_0000469
1467 Ga0395899_0000882
1468 Ga0395899_0024984
1469 Ga0395899_0029916
1470 Ga0395899_0036127
1471 Ga0395899_0067508
1472 Ga0395899_0078754
1473 Ga0395899_0105135
1474 Ga0395899_0118442
1475 Ga0395899_0133478
1476 Ga0395899_0205104
1477 Ga0395899_0239304
1478 Ga0395900_0002613
1479 Ga0395900_0009960
1480 Ga0395900_0034531
1481 Ga0395900_0039357
1482 Ga0395900_0040442
1483 Ga0395900_0053036
1484 Ga0395900_0085060
1485 Ga0395900_0166652
1486 Ga0395900_0181202
1487 Ga0395900_0188030
1488 Ga0395900_0201511
1489 Ga0395900_0276488
1490 Ga0395900_0333292
1491 Ga0395900_0521922
1492 Ga0395900_0582813
1493 Ga0395900_0670359
1494 Ga0395898_0002231
1495 Ga0395898_0002321
1496 Ga0395898_0003885
1497 Ga0395898_0030071
1498 Ga0395898_0055064
1499 Ga0395898_0058713
1500 Ga0395898_0151759
1501 Ga0395905_0000852
1502 Ga0395905_0003384
1503 Ga0395905_0003854
1504 Ga0395905_0006999
1505 Ga0395905_0010977
1506 Ga0395905_0014983
1507 Ga0395905_0047344
1508 Ga0395905_0070343
1509 Ga0395905_0072001
1510 Ga0395905_0110378
1511 Ga0395905_0144104
1512 Ga0395905_0184796
1513 Ga0395905_0205156
1514 Ga0395905_0540765
1515 Ga0395905_0541034
1516 Ga0395901_0001956
1517 Ga0395901_0019190
1518 Ga0395901_0032798
1519 Ga0395901_0058836
1520 Ga0395901_0069994
1521 Ga0395901_0189161
1522 Ga0395901_0189432
1523 Ga0395901_0309775
1524 Ga0395901_0356646
1525 Ga0395901_0552496
1526 Ga0395901_0693027
1527 Ga0436365_1268241
1528 Ga0451793_0850235
1529 Ga0451797_0672500
1530 Ga0451853_0229005
1531 Ga0439458_0000231
1532 Ga0466969_0007189
1533 Ga0466969_0067857
1534 Ga0466972_0187108
1535 Ga0466965_0069334
1536 Ga0466966_0005634
1537 Ga0466966_0028674
1538 Ga0466966_0050347
1539 Ga0466966_0074516
1540 Ga0466966_0161149
1541 Ga0466966_0406240
1542 Ga0466961_0026322
1543 Ga0466961_0027122
1544 Ga0466961_0074439
1545 Ga0466963_0005389
1546 Ga0466963_0010351
1547 Ga0466963_0048837
1548 Ga0466963_0083234
1549 Ga0466963_0266356
1550 Ga0466964_0033773
1551 Ga0466971_0001498
1552 Ga0466971_0001516
1553 Ga0466970_0005781
1554 Ga0466970_0012662
1555 Ga0466957_0008128
1556 Ga0466957_0008541
1557 Ga0466957_0009728
1558 Ga0466957_0080749
1559 Ga0466960_0119706
1560 Ga0466959_0041126
1561 Ga0466959_0078523
1562 Ga0466959_0138088
1563 Ga0466959_0323204
1564 Ga0466958_0000595
1565 Ga0466958_0002509
1566 Ga0466958_0115907
1567 Ga0466958_0175160
1568 Ga0466958_0298845
1569 Ga0466967_0039189
1570 Ga0466967_0041813
1571 Ga0466967_0156656
1572 Ga0495603_0160154
1573 Ga0495585_0100420
1574 Ga0495663_0000381
1575 Ga0495663_0025790
1576 Ga0495663_0065678
1577 Ga0495663_0088783
1578 Ga0495598_0124703
1579 Ga0495621_0000168
1580 Ga0495621_0026290
1581 Ga0495633_0052101
1582 Ga0495633_0077384
1583 Ga0495633_0101843
1584 Ga0495668_0066257
1585 Ga0495625_0340725
1586 Ga0495635_0246560
1587 Ga0495659_0008804
1588 Ga0495669_0026584
1589 Ga0495669_0102120
1590 Ga0495669_0188942
1591 Ga0495669_0217692
1592 Ga0495670_0009846
1593 Ga0495670_0163702
1594 Ga0495581_0091634
1595 Ga0495677_0001639
1596 Ga0495677_0034266
1597 Ga0495685_066401
1598 Ga0496100_0286289
1599 Ga0496101_0087431
1600 Ga0496102_0020946
1601 Ga0496103_0065008
1602 Ga0496104_0403719
1603 Ga0496105_0396733
1604 Ga0496106_0015217
1605 Ga0496106_0142507
1606 Ga0496107_0045483
1607 Ga0496107_0135589
1608 Ga0496108_0007326
1609 Ga0496108_0019746
1610 Ga0496108_0033296
1611 Ga0496109_0008301
1612 Ga0496109_0012282
1613 Ga0496109_0530173
1614 Ga0496110_0045225
1615 Ga0496110_0239628
1616 Ga0496110_0300509
1617 Ga0496111_0013499
1618 Ga0496111_0024060
1619 Ga0496112_0010155
1620 Ga0496112_0031781
1621 Ga0496112_0164665
1622 Ga0496112_0187466
1623 Ga0496113_0006537
1624 Ga0496113_0028199
1625 Ga0496114_0000023
1626 Ga0496114_0034274
1627 Ga0496114_0125936
1628 Ga0496114_0482612
1629 nmdc:mga06r32_24074_c1
1630 nmdc:mga08y16_274064_c1
1631 nmdc:mga0rr50_456951_c1
1632 Ga0500658_0027232
1633 Ga0590077_048078
1634 Ga0466962_0000756
1635 Ga0466962_0002209
1636 Ga0466962_0034813
1637 Ga0466962_0261311
1638 2896430755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

23

277

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8146 5 249
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7996 5 249
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7442 1 249
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7415 1 249
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7387 6 249
ID Description Score Start End Superfamily
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8295 70 248 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8146 5 249 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7996 5 249 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7738 6 249 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7682 1 249 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A521MDS9-F1-model_v4 DUF72 domain-containing protein 0.9906 77 247
AF-A0A521MDS9-F1-model_v4 DUF72 domain-containing protein 0.9849 77 247
AF-A0A6G7YRZ0-F1-model_v4 DUF72 domain-containing protein 0.9848 4 247
AF-A0A3S0E6S4-F1-model_v4 DUF72 domain-containing protein 0.9837 3 247
AF-A0A208XN79-F1-model_v4 DUF72 domain-containing protein 0.9815 6 247

Map