F482179

General Info

Members Datasets Scaffolds Average Seq Length
819 216 1638 259

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0039882|Ga0395905_0039882_944_1816
Length 290
Sequence MAMIEAPGASMRRTAPNQESAMATVSRVSASKTKIPVRKISDEDLRWSLRQGLADFGDLRGDLVFAGLIYTFIGLAAVVMTTNGPLMPFFLPVVAGVGLMGPVAAVGFYELARRREAGQEVHWFNFLDVRKRPSVDDMGIVAGLLLAIFFAWLLAAGALYVALFGWATPTSIGGFITSVFTTPRGWALIILGGAIGAIFGWIVLAFSVASMPMLVDCDISAAEAVSASWRAAHANKAEMIRWGIIVTALLFLGSLPLFVGLAFVLPWLGYATWHLYTRLIDRDSLARRCD

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 2.44
Rhizosphere 97.07
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0039882 3300037471 Bacteria 4405
2 JGI24740J21852_10003553 3300001979 Bacteria 6831
3 JGI24740J21852_10030528 3300001979 Bacteria 1751
4 JGI24739J22299_10016585 3300001989 Bacteria 2665
5 JGI24739J22299_10017154 3300001989 Bacteria 2615
6 JGI24739J22299_10031302 3300001989 Bacteria 1839
7 JGI24737J22298_10000542 3300001990 Bacteria 13246
8 JGI24737J22298_10000692 3300001990 Bacteria 11841
9 JGI24737J22298_10001584 3300001990 Bacteria 8090
10 JGI24737J22298_10016233 3300001990 Bacteria 2404
11 JGI24743J22301_10007926 3300001991 Bacteria 1853
12 JGI24743J22301_10027533 3300001991 Bacteria 1110
13 JGI24738J21930_10015309 3300002075 Bacteria 1634
14 JGI24738J21930_10020728 3300002075 Bacteria 1366
15 JGI24744J21845_10000329 3300002077 Bacteria 7969
16 rootL2_10016393 3300003322 Bacteria 2420
17 Ga0070658_10006175 3300005327 Bacteria 9714
18 Ga0070658_10025606 3300005327 Bacteria 4729
19 Ga0070658_10031623 3300005327 Bacteria 4251
20 Ga0070658_10054560 3300005327 Bacteria 3245
21 Ga0070658_10192827 3300005327 Bacteria 1718
22 Ga0070658_10204665 3300005327 Bacteria 1666
23 Ga0070658_10493271 3300005327 Bacteria 1057
24 Ga0070676_10009217 3300005328 Bacteria 5334
25 Ga0070676_10025188 3300005328 Bacteria 3360
26 Ga0070683_100000846 3300005329 Bacteria 22677
27 Ga0070683_100074027 3300005329 Bacteria 3181
28 Ga0070683_100140707 3300005329 Bacteria 2286
29 Ga0070683_100240111 3300005329 Bacteria 1723
30 Ga0070690_100015433 3300005330 Bacteria 4555
31 Ga0070690_100034476 3300005330 Bacteria 3172
32 Ga0070690_100370898 3300005330 Bacteria 1044
33 Ga0070670_100031775 3300005331 Bacteria 4547
34 Ga0070670_100040271 3300005331 Bacteria 4018
35 Ga0070670_100066321 3300005331 Bacteria 3097
36 Ga0070670_100068604 3300005331 Bacteria 3043
37 Ga0070670_100076321 3300005331 Bacteria 2879
38 Ga0070670_100228112 3300005331 Bacteria 1621
39 Ga0068869_100000728 3300005334 Bacteria 18720
40 Ga0068869_100092515 3300005334 Bacteria 2276
41 Ga0070666_10000784 3300005335 Bacteria 19242
42 Ga0070666_10003320 3300005335 Bacteria 9751
43 Ga0070666_10062089 3300005335 Bacteria 2530
44 Ga0070666_10098559 3300005335 Bacteria 2013
45 Ga0070666_10117760 3300005335 Bacteria 1840
46 Ga0070666_10213220 3300005335 Bacteria 1360
47 Ga0070680_100000971 3300005336 Bacteria 20306
48 Ga0070680_100016912 3300005336 Bacteria 5742
49 Ga0070680_100032124 3300005336 Bacteria 4223
50 Ga0070680_100072566 3300005336 Bacteria 2829
51 Ga0070682_100008674 3300005337 Bacteria 5734
52 Ga0070682_100125012 3300005337 Bacteria 1732
53 Ga0070682_100322990 3300005337 Bacteria 1141
54 Ga0070682_100354125 3300005337 Bacteria 1095
55 Ga0068868_100008379 3300005338 Bacteria 7401
56 Ga0068868_100010669 3300005338 Bacteria 6658
57 Ga0068868_100037007 3300005338 Bacteria 3781
58 Ga0068868_100054984 3300005338 Bacteria 3140
59 Ga0068868_100312205 3300005338 Bacteria 1338
60 Ga0070660_100004392 3300005339 Bacteria 9742
61 Ga0070660_100006501 3300005339 Bacteria 8107
62 Ga0070660_100011788 3300005339 Bacteria 6226
63 Ga0070660_100017265 3300005339 Bacteria 5258
64 Ga0070660_100024885 3300005339 Bacteria 4446
65 Ga0070660_100027054 3300005339 Bacteria 4277
66 Ga0070660_100062645 3300005339 Bacteria 2890
67 Ga0070660_100131426 3300005339 Bacteria 2004
68 Ga0070660_100180228 3300005339 Bacteria 1709
69 Ga0070660_100274541 3300005339 Bacteria 1378
70 Ga0070689_100277602 3300005340 Bacteria 1389
71 Ga0070691_10000317 3300005341 Bacteria 17038
72 Ga0070661_100003518 3300005344 Bacteria 10794
73 Ga0070661_100106266 3300005344 Bacteria 2093
74 Ga0070661_100163737 3300005344 Bacteria 1685
75 Ga0070661_100168430 3300005344 Bacteria 1663
76 Ga0070661_100345469 3300005344 Bacteria 1166
77 Ga0070661_100375654 3300005344 Bacteria 1120
78 Ga0070692_10005091 3300005345 Bacteria 5559
79 Ga0070669_100000565 3300005353 Bacteria 27565
80 Ga0070669_100047531 3300005353 Bacteria 3130
81 Ga0070669_100299215 3300005353 Bacteria 1293
82 Ga0070675_100047118 3300005354 Bacteria 3532
83 Ga0070675_100111392 3300005354 Bacteria 2316
84 Ga0070675_100464049 3300005354 Bacteria 1137
85 Ga0070671_100002084 3300005355 Bacteria 15396
86 Ga0070671_100009573 3300005355 Bacteria 7786
87 Ga0070671_100016983 3300005355 Bacteria 5885
88 Ga0070671_100023561 3300005355 Bacteria 5039
89 Ga0070674_100240171 3300005356 Bacteria 1418
90 Ga0070673_100003973 3300005364 Bacteria 9300
91 Ga0070673_100021894 3300005364 Bacteria 4645
92 Ga0070673_100028727 3300005364 Bacteria 4139
93 Ga0070673_100057329 3300005364 Bacteria 3077
94 Ga0070673_100075272 3300005364 Bacteria 2723
95 Ga0070673_100080104 3300005364 Bacteria 2645
96 Ga0070673_100126532 3300005364 Bacteria 2139
97 Ga0070673_100452846 3300005364 Bacteria 1155
98 Ga0070659_100000887 3300005366 Bacteria 21873
99 Ga0070659_100001567 3300005366 Bacteria 16465
100 Ga0070659_100032065 3300005366 Bacteria 4074
101 Ga0070659_100065993 3300005366 Bacteria 2867
102 Ga0070659_100069938 3300005366 Bacteria 2787
103 Ga0070659_100082828 3300005366 Bacteria 2563
104 Ga0070659_100100516 3300005366 Bacteria 2327
105 Ga0070659_100234005 3300005366 Bacteria 1519
106 Ga0070659_100248448 3300005366 Bacteria 1474
107 Ga0070659_100462408 3300005366 Unclassified 1078
108 Ga0070667_100000764 3300005367 Bacteria 30578
109 Ga0070667_100010885 3300005367 Bacteria 7523
110 Ga0070667_100035741 3300005367 Bacteria 4163
111 Ga0070667_100050410 3300005367 Bacteria 3508
112 Ga0070667_100075138 3300005367 Bacteria 2884
113 Ga0070667_100126572 3300005367 Bacteria 2227
114 Ga0070667_100244306 3300005367 Bacteria 1604
115 Ga0070709_10049343 3300005434 Bacteria 2631
116 Ga0070714_100335091 3300005435 Unclassified 1418
117 Ga0070714_100389813 3300005435 Bacteria 1315
118 Ga0070713_100210184 3300005436 Bacteria 1761
119 Ga0070694_100009204 3300005444 Bacteria 6057
120 Ga0070663_100001696 3300005455 Bacteria 12235
121 Ga0070663_100011726 3300005455 Bacteria 5514
122 Ga0070663_100043165 3300005455 Bacteria 3172
123 Ga0070663_100051506 3300005455 Bacteria 2933
124 Ga0070663_100171438 3300005455 Bacteria 1678
125 Ga0070678_100348807 3300005456 Bacteria 1272
126 Ga0070662_100000047 3300005457 Bacteria 66967
127 Ga0070662_100008398 3300005457 Bacteria 6732
128 Ga0070662_100026387 3300005457 Bacteria 4023
129 Ga0070662_100053388 3300005457 Bacteria 2925
130 Ga0070662_100070691 3300005457 Bacteria 2572
131 Ga0070662_100089457 3300005457 Bacteria 2309
132 Ga0070662_100099087 3300005457 Bacteria 2203
133 Ga0070662_100113433 3300005457 Bacteria 2068
134 Ga0070662_100189452 3300005457 Bacteria 1626
135 Ga0070681_10192961 3300005458 Bacteria 1956
136 Ga0068867_100012344 3300005459 Bacteria 6043
137 Ga0068867_100068213 3300005459 Unclassified 2654
138 Ga0070679_100061012 3300005530 Bacteria 3759
139 Ga0070679_100101931 3300005530 Bacteria 2857
140 Ga0070679_100131140 3300005530 Bacteria 2488
141 Ga0070679_100264835 3300005530 Unclassified 1674
142 Ga0070679_100347296 3300005530 Bacteria 1432
143 Ga0070679_100441914 3300005530 Bacteria 1245
144 Ga0070684_100015644 3300005535 Bacteria 6187
145 Ga0070684_100028521 3300005535 Bacteria 4723
146 Ga0070684_100187484 3300005535 Bacteria 1881
147 Ga0068853_100000033 3300005539 Bacteria 113700
148 Ga0068853_100005485 3300005539 Bacteria 9940
149 Ga0068853_100032634 3300005539 Bacteria 4412
150 Ga0068853_100125191 3300005539 Bacteria 2295
151 Ga0068853_100183860 3300005539 Bacteria 1896
152 Ga0068853_100230173 3300005539 Bacteria 1695
153 Ga0068853_100332233 3300005539 Bacteria 1411
154 Ga0070672_100010512 3300005543 Bacteria 6422
155 Ga0070672_100074735 3300005543 Bacteria 2704
156 Ga0070672_100204553 3300005543 Bacteria 1652
157 Ga0070686_100157745 3300005544 Bacteria 1595
158 Ga0070696_100199908 3300005546 Bacteria 1491
159 Ga0070693_100001255 3300005547 Bacteria 11477
160 Ga0070693_100105467 3300005547 Bacteria 1724
161 Ga0070693_100212860 3300005547 Bacteria 1262
162 Ga0070665_100009636 3300005548 Bacteria 9767
163 Ga0070665_100010704 3300005548 Bacteria 9286
164 Ga0070665_100022897 3300005548 Bacteria 6290
165 Ga0070665_100045989 3300005548 Bacteria 4384
166 Ga0070665_100067978 3300005548 Bacteria 3572
167 Ga0070704_100317540 3300005549 Bacteria 1304
168 Ga0068855_100005847 3300005563 Bacteria 15017
169 Ga0068855_100052849 3300005563 Bacteria 4782
170 Ga0068855_100072569 3300005563 Bacteria 4000
171 Ga0068855_100110052 3300005563 Bacteria 3163
172 Ga0068855_100222500 3300005563 Bacteria 2116
173 Ga0068855_100248015 3300005563 Unclassified 1987
174 Ga0068855_100250463 3300005563 Bacteria 1976
175 Ga0068855_100314468 3300005563 Bacteria 1732
176 Ga0068855_100387993 3300005563 Bacteria 1532
177 Ga0068855_100522439 3300005563 Bacteria 1288
178 Ga0070664_100000066 3300005564 Bacteria 65204
179 Ga0070664_100008785 3300005564 Bacteria 8184
180 Ga0070664_100012124 3300005564 Bacteria 7001
181 Ga0070664_100031007 3300005564 Bacteria 4464
182 Ga0070664_100036798 3300005564 Bacteria 4112
183 Ga0070664_100254465 3300005564 Bacteria 1579
184 Ga0070664_100405614 3300005564 Bacteria 1247
185 Ga0068857_100003003 3300005577 Bacteria 13924
186 Ga0068857_100007256 3300005577 Bacteria 9544
187 Ga0068857_100010273 3300005577 Bacteria 8136
188 Ga0068857_100020025 3300005577 Bacteria 5881
189 Ga0068857_100022914 3300005577 Bacteria 5494
190 Ga0068857_100027971 3300005577 Bacteria 4972
191 Ga0068857_100057007 3300005577 Bacteria 3467
192 Ga0068857_100115040 3300005577 Bacteria 2419
193 Ga0068854_100004155 3300005578 Bacteria 9104
194 Ga0068854_100009153 3300005578 Bacteria 6387
195 Ga0068854_100010935 3300005578 Bacteria 5888
196 Ga0068854_100034029 3300005578 Bacteria 3556
197 Ga0068854_100036074 3300005578 Bacteria 3464
198 Ga0068854_100089019 3300005578 Bacteria 2293
199 Ga0068854_100312939 3300005578 Unclassified 1274
200 Ga0068856_100000162 3300005614 Bacteria 69640
201 Ga0068856_100085927 3300005614 Bacteria 3125
202 Ga0068856_100103381 3300005614 Bacteria 2842
203 Ga0068856_100125238 3300005614 Bacteria 2573
204 Ga0068856_100229197 3300005614 Bacteria 1873
205 Ga0068856_100482665 3300005614 Bacteria 1260
206 Ga0068856_100814131 3300005614 Unclassified 953
207 Ga0068852_100002091 3300005616 Bacteria 13645
208 Ga0068852_100010396 3300005616 Bacteria 6953
209 Ga0068852_100045542 3300005616 Bacteria 3732
210 Ga0068852_100116450 3300005616 Bacteria 2438
211 Ga0068852_100132342 3300005616 Bacteria 2298
212 Ga0068852_100190166 3300005616 Bacteria 1936
213 Ga0068852_100197790 3300005616 Bacteria 1901
214 Ga0068852_100211182 3300005616 Unclassified 1841
215 Ga0068852_100268971 3300005616 Bacteria 1639
216 Ga0068859_100021639 3300005617 Bacteria 6453
217 Ga0068859_100275171 3300005617 Bacteria 1776
218 Ga0068859_100366815 3300005617 Bacteria 1535
219 Ga0068859_100742325 3300005617 Bacteria 1071
220 Ga0068864_100045578 3300005618 Bacteria 3761
221 Ga0068866_10081721 3300005718 Bacteria 1737
222 Ga0068866_10087687 3300005718 Unclassified 1687
223 Ga0068861_100039577 3300005719 Bacteria 3520
224 Ga0068851_10055765 3300005834 Bacteria 2014
225 Ga0068851_10104647 3300005834 Bacteria 1505
226 Ga0068870_10408811 3300005840 Unclassified 885
227 Ga0068863_100005669 3300005841 Bacteria 12265
228 Ga0068863_100007091 3300005841 Bacteria 10986
229 Ga0068863_100017811 3300005841 Bacteria 6799
230 Ga0068863_100023090 3300005841 Bacteria 5944
231 Ga0068863_100055734 3300005841 Bacteria 3743
232 Ga0068863_100728430 3300005841 Bacteria 987
233 Ga0068858_100006383 3300005842 Bacteria 11487
234 Ga0068858_100025462 3300005842 Bacteria 5504
235 Ga0068858_100041297 3300005842 Bacteria 4277
236 Ga0068858_100052236 3300005842 Bacteria 3781
237 Ga0068858_100246148 3300005842 Bacteria 1697
238 Ga0068858_100292225 3300005842 Bacteria 1554
239 Ga0068858_100482509 3300005842 Bacteria 1196
240 Ga0068860_100007040 3300005843 Bacteria 11261
241 Ga0068860_100051533 3300005843 Bacteria 3917
242 Ga0068860_100074629 3300005843 Unclassified 3225
243 Ga0068860_100615309 3300005843 Bacteria 1092
244 Ga0068862_100005282 3300005844 Bacteria 10824
245 Ga0068862_100077464 3300005844 Bacteria 2879
246 Ga0068862_100158906 3300005844 Bacteria 2016
247 Ga0068862_100247475 3300005844 Bacteria 1623
248 Ga0068862_100489479 3300005844 Bacteria 1165
249 Ga0070717_10010474 3300006028 Bacteria 7004
250 Ga0070712_100009442 3300006175 Bacteria 6148
251 Ga0070712_100565103 3300006175 Bacteria 960
252 Ga0097621_100055907 3300006237 Bacteria 3223
253 Ga0097621_100406897 3300006237 Bacteria 1219
254 Ga0068871_100066197 3300006358 Bacteria 2961
255 Ga0068865_100517064 3300006881 Bacteria 998
256 Ga0097620_100021638 3300006931 Bacteria 6453
257 Ga0097620_100275164 3300006931 Bacteria 1776
258 Ga0097620_100366790 3300006931 Bacteria 1535
259 Ga0097620_100742406 3300006931 Bacteria 1071
260 Ga0075435_100207109 3300007076 Bacteria 1663
261 Ga0105240_10032102 3300009093 Bacteria 6801
262 Ga0105240_10043569 3300009093 Bacteria 5709
263 Ga0105240_10070138 3300009093 Bacteria 4336
264 Ga0105240_10227895 3300009093 Bacteria 2167
265 Ga0105245_10000782 3300009098 Bacteria 28837
266 Ga0105245_10189780 3300009098 Unclassified 1968
267 Ga0105245_10420056 3300009098 Unclassified 1340
268 Ga0105245_10573464 3300009098 Bacteria 1152
269 Ga0105243_10169600 3300009148 Bacteria 1889
270 Ga0105243_10244561 3300009148 Bacteria 1598
271 Ga0105241_10030928 3300009174 Bacteria 4004
272 Ga0105241_10046203 3300009174 Bacteria 3306
273 Ga0105241_10117019 3300009174 Bacteria 2141
274 Ga0105241_10131570 3300009174 Bacteria 2026
275 Ga0105241_10603881 3300009174 Unclassified 991
276 Ga0105242_10053531 3300009176 Bacteria 3296
277 Ga0105242_10154828 3300009176 Bacteria 2001
278 Ga0105248_10003721 3300009177 Bacteria 16908
279 Ga0105248_10012199 3300009177 Bacteria 9479
280 Ga0105248_10048261 3300009177 Bacteria 4776
281 Ga0105248_10081065 3300009177 Bacteria 3648
282 Ga0105248_10191344 3300009177 Bacteria 2306
283 Ga0105237_10010459 3300009545 Bacteria 9865
284 Ga0105237_10078383 3300009545 Unclassified 3294
285 Ga0105238_10037975 3300009551 Bacteria 4894
286 Ga0105238_10041123 3300009551 Bacteria 4682
287 Ga0105238_10046723 3300009551 Bacteria 4367
288 Ga0105238_10096775 3300009551 Bacteria 2937
289 Ga0105238_10121785 3300009551 Bacteria 2588
290 Ga0105238_10384755 3300009551 Bacteria 1395
291 Ga0105238_10399044 3300009551 Bacteria 1368
292 Ga0105249_10129924 3300009553 Unclassified 2403
293 Ga0105249_10290631 3300009553 Bacteria 1636
294 Ga0105249_10749572 3300009553 Bacteria 1039
295 Ga0105239_10235909 3300010375 Unclassified 2053
296 Ga0105239_10300502 3300010375 Unclassified 1807
297 Ga0105246_10064863 3300011119 Bacteria 2553
298 Ga0105246_10229467 3300011119 Bacteria 1461
299 Ga0105246_10381103 3300011119 Bacteria 1165
300 Ga0157373_10004543 3300013100 Bacteria 10431
301 Ga0157373_10012009 3300013100 Bacteria 6366
302 Ga0157373_10026182 3300013100 Bacteria 4215
303 Ga0157373_10032530 3300013100 Bacteria 3754
304 Ga0157373_10039353 3300013100 Bacteria 3386
305 Ga0157373_10052668 3300013100 Bacteria 2895
306 Ga0157373_10076014 3300013100 Bacteria 2370
307 Ga0157373_10088159 3300013100 Bacteria 2186
308 Ga0157373_10130908 3300013100 Bacteria 1765
309 Ga0157373_10201820 3300013100 Bacteria 1402
310 Ga0157371_10039467 3300013102 Bacteria 3375
311 Ga0157371_10081208 3300013102 Bacteria 2295
312 Ga0157371_10093477 3300013102 Bacteria 2131
313 Ga0157371_10106406 3300013102 Bacteria 1990
314 Ga0157371_10151371 3300013102 Bacteria 1655
315 Ga0157371_10172066 3300013102 Bacteria 1548
316 Ga0157371_10183291 3300013102 Bacteria 1498
317 Ga0157370_10009228 3300013104 Bacteria 10573
318 Ga0157370_10009365 3300013104 Bacteria 10475
319 Ga0157370_10042285 3300013104 Bacteria 4393
320 Ga0157369_10011303 3300013105 Bacteria 10143
321 Ga0157369_10026642 3300013105 Bacteria 6411
322 Ga0157369_10029866 3300013105 Bacteria 6019
323 Ga0157369_10086612 3300013105 Bacteria 3345
324 Ga0157369_10111223 3300013105 Unclassified 2911
325 Ga0157369_10154089 3300013105 Bacteria 2428
326 Ga0157369_10190590 3300013105 Bacteria 2155
327 Ga0157369_10213548 3300013105 Bacteria 2022
328 Ga0157369_10318242 3300013105 Bacteria 1618
329 Ga0157369_10546448 3300013105 Bacteria 1197
330 Ga0157374_10012401 3300013296 Bacteria 7415
331 Ga0157374_10320997 3300013296 Bacteria 1535
332 Ga0157378_10341621 3300013297 Bacteria 1460
333 Ga0157378_10511267 3300013297 Bacteria 1201
334 Ga0157378_10786420 3300013297 Bacteria 976
335 Ga0163162_10037065 3300013306 Bacteria 4864
336 Ga0163162_10063325 3300013306 Bacteria 3740
337 Ga0163162_10120409 3300013306 Unclassified 2728
338 Ga0157372_10056188 3300013307 Bacteria 4398
339 Ga0157372_10065516 3300013307 Bacteria 4079
340 Ga0157372_10119882 3300013307 Bacteria 3020
341 Ga0157372_10525572 3300013307 Bacteria 1379
342 Ga0157372_10691631 3300013307 Bacteria 1187
343 Ga0157375_10180307 3300013308 Bacteria 2263
344 Ga0157375_10319983 3300013308 Bacteria 1716
345 Ga0163163_10217594 3300014325 Bacteria 1959
346 Ga0182008_10064369 3300014497 Bacteria 1805
347 Ga0157377_10058397 3300014745 Bacteria 2197
348 Ga0157377_10080839 3300014745 Bacteria 1900
349 Ga0157379_10017407 3300014968 Bacteria 6330
350 Ga0157376_10003636 3300014969 Bacteria 10641
351 Ga0197907_10160736 3300020069 Bacteria 1260
352 Ga0206356_11518027 3300020070 Bacteria 1056
353 Ga0224712_10135891 3300022467 Bacteria 1078
354 Ga0207697_10000162 3300025315 Bacteria 33553
355 Ga0207697_10024732 3300025315 Bacteria 2457
356 Ga0207697_10034827 3300025315 Bacteria 2061
357 Ga0207656_10201455 3300025321 Bacteria 961
358 Ga0207642_10063885 3300025899 Bacteria 1723
359 Ga0207688_10000909 3300025901 Bacteria 14961
360 Ga0207680_10001490 3300025903 Bacteria 11062
361 Ga0207680_10013511 3300025903 Bacteria 4197
362 Ga0207647_10000073 3300025904 Bacteria 76404
363 Ga0207647_10001093 3300025904 Bacteria 20911
364 Ga0207647_10001424 3300025904 Bacteria 18340
365 Ga0207647_10007124 3300025904 Bacteria 8108
366 Ga0207647_10027780 3300025904 Bacteria 3685
367 Ga0207647_10063967 3300025904 Bacteria 2236
368 Ga0207647_10114561 3300025904 Bacteria 1593
369 Ga0207647_10163935 3300025904 Bacteria 1296
370 Ga0207699_10046160 3300025906 Bacteria 2546
371 Ga0207645_10005215 3300025907 Bacteria 9473
372 Ga0207645_10025315 3300025907 Bacteria 3840
373 Ga0207645_10084702 3300025907 Bacteria 2035
374 Ga0207645_10090463 3300025907 Bacteria 1968
375 Ga0207705_10005195 3300025909 Bacteria 9759
376 Ga0207705_10043846 3300025909 Bacteria 3214
377 Ga0207705_10240702 3300025909 Bacteria 1378
378 Ga0207705_10246754 3300025909 Bacteria 1361
379 Ga0207654_10027047 3300025911 Bacteria 3114
380 Ga0207707_10084991 3300025912 Bacteria 2764
381 Ga0207707_10210340 3300025912 Bacteria 1695
382 Ga0207695_10012117 3300025913 Bacteria 10363
383 Ga0207695_10116166 3300025913 Bacteria 2650
384 Ga0207695_10184346 3300025913 Bacteria 2007
385 Ga0207671_10163149 3300025914 Bacteria 1726
386 Ga0207693_10012012 3300025915 Bacteria 7001
387 Ga0207693_10027018 3300025915 Bacteria 4539
388 Ga0207660_10001465 3300025917 Bacteria 15872
389 Ga0207660_10161929 3300025917 Bacteria 1727
390 Ga0207660_10362985 3300025917 Bacteria 1162
391 Ga0207660_10442184 3300025917 Bacteria 1051
392 Ga0207657_10005786 3300025919 Bacteria 12891
393 Ga0207657_10007431 3300025919 Bacteria 11239
394 Ga0207657_10009175 3300025919 Bacteria 9975
395 Ga0207657_10009587 3300025919 Bacteria 9719
396 Ga0207657_10030651 3300025919 Bacteria 4880
397 Ga0207657_10033906 3300025919 Bacteria 4597
398 Ga0207657_10034062 3300025919 Bacteria 4584
399 Ga0207657_10039012 3300025919 Bacteria 4223
400 Ga0207657_10040290 3300025919 Bacteria 4141
401 Ga0207657_10066559 3300025919 Bacteria 3066
402 Ga0207657_10075768 3300025919 Bacteria 2839
403 Ga0207657_10263064 3300025919 Unclassified 1372
404 Ga0207649_10002318 3300025920 Bacteria 10692
405 Ga0207649_10009296 3300025920 Bacteria 5377
406 Ga0207649_10013315 3300025920 Bacteria 4589
407 Ga0207649_10057339 3300025920 Bacteria 2435
408 Ga0207649_10091128 3300025920 Bacteria 1996
409 Ga0207649_10095186 3300025920 Bacteria 1959
410 Ga0207649_10212739 3300025920 Bacteria 1372
411 Ga0207649_10245283 3300025920 Bacteria 1288
412 Ga0207649_10368720 3300025920 Bacteria 1067
413 Ga0207652_10193911 3300025921 Bacteria 1827
414 Ga0207652_10202000 3300025921 Unclassified 1789
415 Ga0207652_10215420 3300025921 Bacteria 1730
416 Ga0207652_10249866 3300025921 Bacteria 1599
417 Ga0207681_10487061 3300025923 Bacteria 1008
418 Ga0207681_10652510 3300025923 Unclassified 872
419 Ga0207694_10003870 3300025924 Bacteria 11838
420 Ga0207694_10028276 3300025924 Bacteria 4274
421 Ga0207694_10045103 3300025924 Unclassified 3405
422 Ga0207650_10022685 3300025925 Bacteria 4446
423 Ga0207650_10051253 3300025925 Bacteria 3054
424 Ga0207650_10069072 3300025925 Bacteria 2654
425 Ga0207650_10100108 3300025925 Bacteria 2230
426 Ga0207650_10127311 3300025925 Bacteria 1989
427 Ga0207650_10150517 3300025925 Bacteria 1836
428 Ga0207650_10177023 3300025925 Bacteria 1698
429 Ga0207659_10062757 3300025926 Bacteria 2683
430 Ga0207659_10125168 3300025926 Bacteria 1975
431 Ga0207687_10008779 3300025927 Bacteria 6605
432 Ga0207687_10156335 3300025927 Bacteria 1745
433 Ga0207687_10268254 3300025927 Unclassified 1363
434 Ga0207700_10140519 3300025928 Bacteria 1983
435 Ga0207664_10270215 3300025929 Bacteria 1489
436 Ga0207664_10382513 3300025929 Unclassified 1249
437 Ga0207644_10030510 3300025931 Bacteria 3750
438 Ga0207644_10078102 3300025931 Bacteria 2439
439 Ga0207644_10116681 3300025931 Bacteria 2026
440 Ga0207644_10123093 3300025931 Unclassified 1977
441 Ga0207644_10472246 3300025931 Bacteria 1032
442 Ga0207690_10000777 3300025932 Bacteria 20661
443 Ga0207690_10002539 3300025932 Bacteria 11030
444 Ga0207690_10012424 3300025932 Bacteria 5092
445 Ga0207690_10031983 3300025932 Bacteria 3372
446 Ga0207690_10034134 3300025932 Unclassified 3276
447 Ga0207690_10064193 3300025932 Unclassified 2506
448 Ga0207690_10066305 3300025932 Bacteria 2472
449 Ga0207690_10093466 3300025932 Bacteria 2131
450 Ga0207690_10216174 3300025932 Bacteria 1464
451 Ga0207690_10410545 3300025932 Bacteria 1081
452 Ga0207690_10572433 3300025932 Bacteria 920
453 Ga0207706_10001063 3300025933 Bacteria 27913
454 Ga0207706_10006873 3300025933 Bacteria 10519
455 Ga0207706_10008071 3300025933 Bacteria 9716
456 Ga0207706_10020060 3300025933 Bacteria 6006
457 Ga0207706_10045866 3300025933 Bacteria 3871
458 Ga0207706_10057661 3300025933 Bacteria 3421
459 Ga0207706_10060769 3300025933 Bacteria 3328
460 Ga0207706_10388058 3300025933 Bacteria 1211
461 Ga0207686_10063874 3300025934 Bacteria 2343
462 Ga0207709_10167581 3300025935 Bacteria 1538
463 Ga0207709_10209660 3300025935 Bacteria 1397
464 Ga0207709_10297572 3300025935 Bacteria 1199
465 Ga0207669_10192884 3300025937 Bacteria 1471
466 Ga0207691_10001499 3300025940 Bacteria 23257
467 Ga0207691_10012981 3300025940 Bacteria 7977
468 Ga0207691_10051374 3300025940 Bacteria 3769
469 Ga0207691_10112349 3300025940 Bacteria 2422
470 Ga0207711_10000174 3300025941 Bacteria 69263
471 Ga0207711_10002763 3300025941 Bacteria 15458
472 Ga0207711_10006114 3300025941 Bacteria 10167
473 Ga0207711_10012069 3300025941 Bacteria 7182
474 Ga0207711_10185701 3300025941 Bacteria 1892
475 Ga0207711_10217053 3300025941 Bacteria 1748
476 Ga0207711_10545103 3300025941 Unclassified 1082
477 Ga0207689_10000167 3300025942 Bacteria 57116
478 Ga0207689_10054262 3300025942 Bacteria 3301
479 Ga0207689_10083687 3300025942 Bacteria 2623
480 Ga0207689_10136316 3300025942 Bacteria 2021
481 Ga0207661_10023773 3300025944 Bacteria 4635
482 Ga0207661_10033964 3300025944 Bacteria 3962
483 Ga0207661_10145331 3300025944 Unclassified 2045
484 Ga0207661_10209057 3300025944 Bacteria 1719
485 Ga0207661_10429043 3300025944 Bacteria 1201
486 Ga0207679_10000150 3300025945 Bacteria 57426
487 Ga0207679_10030926 3300025945 Bacteria 3743
488 Ga0207679_10064246 3300025945 Bacteria 2743
489 Ga0207679_10274539 3300025945 Bacteria 1443
490 Ga0207679_10388833 3300025945 Unclassified 1224
491 Ga0207679_10406272 3300025945 Unclassified 1199
492 Ga0207667_10000443 3300025949 Bacteria 55591
493 Ga0207667_10012419 3300025949 Bacteria 9816
494 Ga0207667_10084992 3300025949 Bacteria 3275
495 Ga0207667_10095828 3300025949 Bacteria 3063
496 Ga0207667_10115121 3300025949 Bacteria 2771
497 Ga0207667_10130830 3300025949 Bacteria 2585
498 Ga0207667_10200743 3300025949 Bacteria 2046
499 Ga0207667_10647519 3300025949 Bacteria 1062
500 Ga0207667_10735103 3300025949 Bacteria 987
501 Ga0207667_10825876 3300025949 Bacteria 922
502 Ga0207667_10870317 3300025949 Unclassified 894
503 Ga0207651_10011170 3300025960 Bacteria 5013
504 Ga0207651_10043708 3300025960 Bacteria 2993
505 Ga0207651_10083644 3300025960 Bacteria 2308
506 Ga0207651_10087729 3300025960 Bacteria 2265
507 Ga0207651_10103766 3300025960 Bacteria 2116
508 Ga0207651_10127485 3300025960 Bacteria 1942
509 Ga0207651_10168464 3300025960 Bacteria 1725
510 Ga0207712_10011567 3300025961 Bacteria 5626
511 Ga0207668_10119060 3300025972 Bacteria 1996
512 Ga0207668_10160699 3300025972 Bacteria 1750
513 Ga0207640_10029943 3300025981 Bacteria 3348
514 Ga0207640_10071530 3300025981 Bacteria 2336
515 Ga0207640_10122069 3300025981 Bacteria 1868
516 Ga0207640_10136322 3300025981 Bacteria 1782
517 Ga0207640_10616283 3300025981 Bacteria 921
518 Ga0207658_10004413 3300025986 Bacteria 9786
519 Ga0207658_10005682 3300025986 Bacteria 8529
520 Ga0207658_10006022 3300025986 Bacteria 8284
521 Ga0207658_10114190 3300025986 Bacteria 2141
522 Ga0207658_10423650 3300025986 Bacteria 1174
523 Ga0207677_10003531 3300026023 Bacteria 8284
524 Ga0207677_10141284 3300026023 Bacteria 1844
525 Ga0207677_10146424 3300026023 Bacteria 1816
526 Ga0207677_10282027 3300026023 Bacteria 1364
527 Ga0207677_10304529 3300026023 Bacteria 1318
528 Ga0207703_10004057 3300026035 Bacteria 12096
529 Ga0207703_10014553 3300026035 Bacteria 6138
530 Ga0207703_10020601 3300026035 Bacteria 5159
531 Ga0207703_10023164 3300026035 Bacteria 4877
532 Ga0207703_10037572 3300026035 Bacteria 3857
533 Ga0207703_10274036 3300026035 Bacteria 1530
534 Ga0207703_10382311 3300026035 Unclassified 1302
535 Ga0207703_10478409 3300026035 Bacteria 1167
536 Ga0207703_10720787 3300026035 Bacteria 949
537 Ga0207639_10000144 3300026041 Bacteria 53312
538 Ga0207639_10000851 3300026041 Bacteria 20742
539 Ga0207639_10008734 3300026041 Bacteria 6957
540 Ga0207639_10027181 3300026041 Bacteria 4165
541 Ga0207639_10031620 3300026041 Bacteria 3891
542 Ga0207639_10042855 3300026041 Bacteria 3394
543 Ga0207639_10111985 3300026041 Bacteria 2226
544 Ga0207639_10118008 3300026041 Bacteria 2175
545 Ga0207639_10138524 3300026041 Bacteria 2025
546 Ga0207639_10163407 3300026041 Bacteria 1878
547 Ga0207678_10005023 3300026067 Bacteria 11868
548 Ga0207678_10021716 3300026067 Bacteria 5629
549 Ga0207678_10024585 3300026067 Bacteria 5261
550 Ga0207678_10039002 3300026067 Bacteria 4124
551 Ga0207678_10041699 3300026067 Bacteria 3979
552 Ga0207678_10052954 3300026067 Bacteria 3499
553 Ga0207678_10062108 3300026067 Bacteria 3212
554 Ga0207702_10005597 3300026078 Bacteria 10968
555 Ga0207702_10010053 3300026078 Bacteria 7931
556 Ga0207702_10037906 3300026078 Bacteria 4037
557 Ga0207702_10186975 3300026078 Bacteria 1911
558 Ga0207702_10195004 3300026078 Bacteria 1874
559 Ga0207641_10011660 3300026088 Bacteria 7217
560 Ga0207641_10016621 3300026088 Bacteria 6024
561 Ga0207641_10175380 3300026088 Bacteria 1960
562 Ga0207641_10355789 3300026088 Bacteria 1396
563 Ga0207641_10394895 3300026088 Bacteria 1327
564 Ga0207648_10023887 3300026089 Bacteria 5466
565 Ga0207648_10046120 3300026089 Bacteria 3821
566 Ga0207648_10058078 3300026089 Unclassified 3375
567 Ga0207648_10138611 3300026089 Bacteria 2143
568 Ga0207676_10002947 3300026095 Bacteria 12135
569 Ga0207676_10374005 3300026095 Bacteria 1324
570 Ga0207676_10462491 3300026095 Unclassified 1198
571 Ga0207674_10002073 3300026116 Bacteria 25416
572 Ga0207674_10005768 3300026116 Bacteria 14688
573 Ga0207674_10007637 3300026116 Bacteria 12593
574 Ga0207674_10009450 3300026116 Bacteria 11141
575 Ga0207674_10016402 3300026116 Bacteria 8110
576 Ga0207674_10019921 3300026116 Bacteria 7259
577 Ga0207674_10033866 3300026116 Bacteria 5344
578 Ga0207674_10081185 3300026116 Bacteria 3244
579 Ga0207674_10107894 3300026116 Bacteria 2761
580 Ga0207674_10119424 3300026116 Bacteria 2605
581 Ga0207674_10482367 3300026116 Bacteria 1198
582 Ga0207675_100046661 3300026118 Bacteria 4048
583 Ga0207675_100268810 3300026118 Bacteria 1654
584 Ga0207683_10026205 3300026121 Bacteria 5032
585 Ga0207683_10296509 3300026121 Bacteria 1479
586 Ga0207698_10002267 3300026142 Bacteria 11384
587 Ga0207698_10006878 3300026142 Bacteria 7116
588 Ga0207698_10020567 3300026142 Bacteria 4545
589 Ga0207698_10030800 3300026142 Bacteria 3864
590 Ga0207698_10041600 3300026142 Bacteria 3426
591 Ga0207698_10085736 3300026142 Bacteria 2559
592 Ga0207698_10101990 3300026142 Bacteria 2381
593 Ga0207698_10152858 3300026142 Bacteria 2006
594 Ga0207698_10160349 3300026142 Bacteria 1966
595 Ga0207698_10378278 3300026142 Bacteria 1346
596 Ga0207698_10503527 3300026142 Bacteria 1179
597 Ga0207698_10633887 3300026142 Bacteria 1057
598 Ga0268266_10014546 3300028379 Bacteria 6762
599 Ga0268266_10025415 3300028379 Bacteria 5038
600 Ga0268266_10088056 3300028379 Bacteria 2717
601 Ga0268265_10008862 3300028380 Bacteria 6798
602 Ga0268265_10026471 3300028380 Bacteria 4127
603 Ga0268265_10060149 3300028380 Bacteria 2910
604 Ga0268264_10001230 3300028381 Bacteria 24597
605 Ga0268264_10008487 3300028381 Bacteria 8542
606 Ga0268264_10074618 3300028381 Bacteria 2882
607 Ga0268264_10216856 3300028381 Bacteria 1760
608 Ga0307408_100051958 3300031548 Bacteria 2955
609 Ga0307405_10341223 3300031731 Unclassified 1152
610 Ga0307413_10144753 3300031824 Bacteria 1648
611 Ga0307413_10193030 3300031824 Bacteria 1464
612 Ga0307410_10008595 3300031852 Bacteria 5672
613 Ga0307410_10012752 3300031852 Bacteria 4874
614 Ga0307407_10051571 3300031903 Bacteria 2359
615 Ga0307407_10130099 3300031903 Bacteria 1609
616 Ga0307409_100008491 3300031995 Bacteria 6240
617 Ga0307409_100104360 3300031995 Bacteria 2360
618 Ga0307409_100380131 3300031995 Bacteria 1342
619 Ga0307409_100489379 3300031995 Bacteria 1195
620 Ga0307414_10131779 3300032004 Bacteria 1942
621 Ga0307414_10217176 3300032004 Bacteria 1567
622 Ga0307411_10041808 3300032005 Bacteria 2920
623 Ga0307411_10099180 3300032005 Bacteria 2055
624 Ga0307411_10650256 3300032005 Bacteria 913
625 Ga0307415_100019598 3300032126 Bacteria 4111
626 Ga0307415_100216363 3300032126 Unclassified 1532
627 Ga0373932_0093526 3300035112 Bacteria 968
628 Ga0373941_0044643 3300035115 Bacteria 1384
629 Ga0373943_0010052 3300035170 Bacteria 4244
630 Ga0373931_0007229 3300035691 Bacteria 5226
631 Ga0373935_0033605 3300035692 Bacteria 3193
632 Ga0373927_0030225 3300035695 Bacteria 3535
633 Ga0395899_0001070 3300037312 Bacteria 24709
634 Ga0395899_0003599 3300037312 Bacteria 12253
635 Ga0395899_0004952 3300037312 Bacteria 10362
636 Ga0395899_0013798 3300037312 Bacteria 6176
637 Ga0395899_0043275 3300037312 Bacteria 3359
638 Ga0395899_0051492 3300037312 Bacteria 3055
639 Ga0395899_0052893 3300037312 Bacteria 3008
640 Ga0395899_0061498 3300037312 Unclassified 2766
641 Ga0395899_0064142 3300037312 Bacteria 2701
642 Ga0395899_0079880 3300037312 Bacteria 2382
643 Ga0395899_0158291 3300037312 Bacteria 1601
644 Ga0395899_0228285 3300037312 Bacteria 1286
645 Ga0395899_0247244 3300037312 Bacteria 1225
646 Ga0395900_0001041 3300037418 Bacteria 35559
647 Ga0395900_0011436 3300037418 Bacteria 9085
648 Ga0395900_0011750 3300037418 Bacteria 8952
649 Ga0395900_0015887 3300037418 Bacteria 7668
650 Ga0395900_0016938 3300037418 Bacteria 7438
651 Ga0395900_0018396 3300037418 Bacteria 7125
652 Ga0395900_0030614 3300037418 Bacteria 5526
653 Ga0395900_0036432 3300037418 Bacteria 5072
654 Ga0395900_0051015 3300037418 Bacteria 4262
655 Ga0395900_0051432 3300037418 Bacteria 4244
656 Ga0395900_0055439 3300037418 Bacteria 4081
657 Ga0395900_0060798 3300037418 Bacteria 3886
658 Ga0395900_0069555 3300037418 Bacteria 3618
659 Ga0395900_0073055 3300037418 Bacteria 3526
660 Ga0395900_0089716 3300037418 Bacteria 3159
661 Ga0395900_0135243 3300037418 Bacteria 2525
662 Ga0395900_0211647 3300037418 Bacteria 1957
663 Ga0395900_0256408 3300037418 Bacteria 1748
664 Ga0395900_0317046 3300037418 Bacteria 1540
665 Ga0395900_0342415 3300037418 Bacteria 1470
666 Ga0395900_0442876 3300037418 Unclassified 1256
667 Ga0395898_0000274 3300037466 Bacteria 125922
668 Ga0395898_0010300 3300037466 Bacteria 9783
669 Ga0395898_0012715 3300037466 Bacteria 8693
670 Ga0395898_0018438 3300037466 Bacteria 7116
671 Ga0395898_0018633 3300037466 Bacteria 7077
672 Ga0395898_0026753 3300037466 Bacteria 5798
673 Ga0395898_0052351 3300037466 Bacteria 3988
674 Ga0395898_0057015 3300037466 Bacteria 3806
675 Ga0395898_0070310 3300037466 Bacteria 3384
676 Ga0395898_0082203 3300037466 Bacteria 3105
677 Ga0395898_0098696 3300037466 Bacteria 2804
678 Ga0395898_0103557 3300037466 Bacteria 2731
679 Ga0395898_0110180 3300037466 Bacteria 2639
680 Ga0395898_0119310 3300037466 Bacteria 2526
681 Ga0395898_0128875 3300037466 Bacteria 2424
682 Ga0395898_0182841 3300037466 Bacteria 2003
683 Ga0395898_0204619 3300037466 Bacteria 1884
684 Ga0395898_0530800 3300037466 Bacteria 1118
685 Ga0395905_0000006 3300037471 Bacteria 549428
686 Ga0395905_0002330 3300037471 Bacteria 21202
687 Ga0395905_0006965 3300037471 Bacteria 11301
688 Ga0395905_0007371 3300037471 Bacteria 10948
689 Ga0395905_0008869 3300037471 Bacteria 9879
690 Ga0395905_0009804 3300037471 Bacteria 9334
691 Ga0395905_0012465 3300037471 Bacteria 8184
692 Ga0395905_0014564 3300037471 Bacteria 7502
693 Ga0395905_0015854 3300037471 Bacteria 7158
694 Ga0395905_0024002 3300037471 Bacteria 5757
695 Ga0395905_0028407 3300037471 Bacteria 5274
696 Ga0395905_0028927 3300037471 Bacteria 5223
697 Ga0395905_0030832 3300037471 Bacteria 5050
698 Ga0395905_0040679 3300037471 Bacteria 4361
699 Ga0395905_0041117 3300037471 Bacteria 4337
700 Ga0395905_0041722 3300037471 Bacteria 4306
701 Ga0395905_0043636 3300037471 Bacteria 4206
702 Ga0395905_0043749 3300037471 Bacteria 4200
703 Ga0395905_0066910 3300037471 Bacteria 3365
704 Ga0395905_0079934 3300037471 Bacteria 3064
705 Ga0395905_0100472 3300037471 Bacteria 2716
706 Ga0395905_0123550 3300037471 Unclassified 2434
707 Ga0395905_0146543 3300037471 Bacteria 2221
708 Ga0395905_0158139 3300037471 Bacteria 2131
709 Ga0395905_0217418 3300037471 Bacteria 1789
710 Ga0395905_0217989 3300037471 Bacteria 1786
711 Ga0395905_0222917 3300037471 Bacteria 1764
712 Ga0395905_0241556 3300037471 Bacteria 1688
713 Ga0395905_0282326 3300037471 Bacteria 1546
714 Ga0395905_0292166 3300037471 Bacteria 1516
715 Ga0395905_0380693 3300037471 Unclassified 1305
716 Ga0395905_0547511 3300037471 Bacteria 1058
717 Ga0395905_0592253 3300037471 Bacteria 1010
718 Ga0395901_0001959 3300038443 Bacteria 21168
719 Ga0395901_0009696 3300038443 Bacteria 9767
720 Ga0395901_0019006 3300038443 Bacteria 7024
721 Ga0395901_0026433 3300038443 Bacteria 5960
722 Ga0395901_0027042 3300038443 Bacteria 5892
723 Ga0395901_0032560 3300038443 Bacteria 5379
724 Ga0395901_0040796 3300038443 Bacteria 4807
725 Ga0395901_0055766 3300038443 Bacteria 4110
726 Ga0395901_0067747 3300038443 Bacteria 3718
727 Ga0395901_0070145 3300038443 Bacteria 3651
728 Ga0395901_0070313 3300038443 Bacteria 3646
729 Ga0395901_0070384 3300038443 Bacteria 3644
730 Ga0395901_0091439 3300038443 Bacteria 3185
731 Ga0395901_0092854 3300038443 Bacteria 3159
732 Ga0395901_0093959 3300038443 Bacteria 3141
733 Ga0395901_0105170 3300038443 Bacteria 2962
734 Ga0395901_0155176 3300038443 Bacteria 2404
735 Ga0395901_0158354 3300038443 Bacteria 2378
736 Ga0395901_0544706 3300038443 Bacteria 1176
737 Ga0436365_0088937 3300039437 Bacteria 9210
738 Ga0436363_0494724 3300039450 Unclassified 3087
739 Ga0439448_0084479 3300042005 Bacteria 1069
740 Ga0439458_0000160 3300042157 Bacteria 14953
741 Ga0439458_0000210 3300042157 Bacteria 13702
742 Ga0439464_0001497 3300042439 Bacteria 5519
743 Ga0466969_0084563 3300044656 Bacteria 1510
744 Ga0466972_0059130 3300044658 Unclassified 1840
745 Ga0466966_0065027 3300044684 Bacteria 2294
746 Ga0466966_0090485 3300044684 Unclassified 1900
747 Ga0466961_0062189 3300044693 Bacteria 2372
748 Ga0466963_0002633 3300044694 Bacteria 10082
749 Ga0466963_0018355 3300044694 Bacteria 4372
750 Ga0466963_0036678 3300044694 Bacteria 3198
751 Ga0466963_0044717 3300044694 Bacteria 2915
752 Ga0466963_0048807 3300044694 Bacteria 2798
753 Ga0466963_0086494 3300044694 Bacteria 2130
754 Ga0466963_0128728 3300044694 Bacteria 1747
755 Ga0466963_0149665 3300044694 Bacteria 1620
756 Ga0466964_0038586 3300044706 Unclassified 1921
757 Ga0466968_0007068 3300044735 Bacteria 4256
758 Ga0466970_0017655 3300044765 Bacteria 3688
759 Ga0466970_0206689 3300044765 Unclassified 1093
760 Ga0466957_0010777 3300044842 Bacteria 5256
761 Ga0466957_0044633 3300044842 Bacteria 2687
762 Ga0466957_0052930 3300044842 Bacteria 2473
763 Ga0466957_0143719 3300044842 Bacteria 1539
764 Ga0466957_0171484 3300044842 Bacteria 1413
765 Ga0466957_0191531 3300044842 Bacteria 1340
766 Ga0466957_0323511 3300044842 Unclassified 1041
767 Ga0466960_0096498 3300044901 Bacteria 1516
768 Ga0466959_0102285 3300045049 Bacteria 2050
769 Ga0466959_0166311 3300045049 Bacteria 1549
770 Ga0466958_0025655 3300045836 Unclassified 3477
771 Ga0466958_0084515 3300045836 Bacteria 1957
772 Ga0466958_0145083 3300045836 Bacteria 1496
773 Ga0466958_0366852 3300045836 Bacteria 928
774 Ga0466967_0001266 3300045976 Bacteria 14316
775 Ga0466967_0001564 3300045976 Bacteria 13420
776 Ga0466967_0016471 3300045976 Bacteria 5831
777 Ga0466967_0026824 3300045976 Bacteria 4780
778 Ga0466967_0041175 3300045976 Bacteria 3981
779 Ga0466967_0114265 3300045976 Bacteria 2485
780 Ga0466967_0159908 3300045976 Bacteria 2113
781 Ga0466967_0421432 3300045976 Bacteria 1301
782 Ga0466967_0450821 3300045976 Bacteria 1257
783 Ga0466967_0544825 3300045976 Bacteria 1142
784 Ga0495598_0002323 3300046537 Bacteria 3914
785 Ga0495621_0013285 3300046539 Bacteria 2583
786 Ga0495669_0000565 3300046684 Bacteria 16363
787 Ga0495669_0015372 3300046684 Bacteria 3277
788 Ga0495669_0049680 3300046684 Bacteria 1879
789 Ga0495669_0092589 3300046684 Bacteria 1397
790 Ga0495670_0002417 3300046691 Bacteria 9216
791 Ga0495680_0443954 3300047322 Bacteria 889
792 Ga0495677_0098655 3300047445 Bacteria 1104
793 Ga0496102_0118775 3300048905 Bacteria 2468
794 Ga0496102_0770591 3300048905 Bacteria 885
795 Ga0496103_0139436 3300048906 Bacteria 1550
796 Ga0496103_0230677 3300048906 Bacteria 1191
797 Ga0496105_0113231 3300048908 Bacteria 2239
798 Ga0496105_0495936 3300048908 Unclassified 959
799 Ga0496107_0038682 3300048910 Bacteria 3421
800 Ga0496108_0000974 3300048911 Bacteria 22322
801 Ga0496108_0019724 3300048911 Bacteria 5538
802 Ga0496109_0072772 3300048912 Bacteria 3158
803 Ga0496110_0016722 3300048913 Bacteria 6127
804 Ga0496110_0127035 3300048913 Bacteria 2301
805 Ga0496111_0038294 3300048914 Bacteria 3435
806 Ga0496111_0118684 3300048914 Bacteria 1953
807 Ga0496112_0001713 3300048915 Bacteria 17129
808 Ga0496112_0067660 3300048915 Bacteria 3526
809 Ga0496112_0098255 3300048915 Bacteria 2897
810 Ga0496112_0111558 3300048915 Bacteria 2704
811 Ga0496113_0014119 3300048916 Bacteria 5437
812 Ga0496113_0040294 3300048916 Unclassified 3442
813 Ga0501074_0363173 3300049590 Bacteria 1027
814 Ga0501079_0271079 3300049741 Bacteria 1327
815 Ga0501080_0019604 3300049742 Bacteria 6266
816 Ga0501268_012010 3300049765 Bacteria 1378
817 nmdc:mga0n895_311061_c1 3300050512 Bacteria 1596
818 nmdc:mga0sz30_175949_c1 3300050516 Bacteria 949
819 Ga0466962_0138593 3300061719 Unclassified 1178
820 Ga0395905_0039882
821 JGI24740J21852_10003553
822 JGI24740J21852_10030528
823 JGI24739J22299_10016585
824 JGI24739J22299_10017154
825 JGI24739J22299_10031302
826 JGI24737J22298_10000542
827 JGI24737J22298_10000692
828 JGI24737J22298_10001584
829 JGI24737J22298_10016233
830 JGI24743J22301_10007926
831 JGI24743J22301_10027533
832 JGI24738J21930_10015309
833 JGI24738J21930_10020728
834 JGI24744J21845_10000329
835 rootL2_10016393
836 Ga0070658_10006175
837 Ga0070658_10025606
838 Ga0070658_10031623
839 Ga0070658_10054560
840 Ga0070658_10192827
841 Ga0070658_10204665
842 Ga0070658_10493271
843 Ga0070676_10009217
844 Ga0070676_10025188
845 Ga0070683_100000846
846 Ga0070683_100074027
847 Ga0070683_100140707
848 Ga0070683_100240111
849 Ga0070690_100015433
850 Ga0070690_100034476
851 Ga0070690_100370898
852 Ga0070670_100031775
853 Ga0070670_100040271
854 Ga0070670_100066321
855 Ga0070670_100068604
856 Ga0070670_100076321
857 Ga0070670_100228112
858 Ga0068869_100000728
859 Ga0068869_100092515
860 Ga0070666_10000784
861 Ga0070666_10003320
862 Ga0070666_10062089
863 Ga0070666_10098559
864 Ga0070666_10117760
865 Ga0070666_10213220
866 Ga0070680_100000971
867 Ga0070680_100016912
868 Ga0070680_100032124
869 Ga0070680_100072566
870 Ga0070682_100008674
871 Ga0070682_100125012
872 Ga0070682_100322990
873 Ga0070682_100354125
874 Ga0068868_100008379
875 Ga0068868_100010669
876 Ga0068868_100037007
877 Ga0068868_100054984
878 Ga0068868_100312205
879 Ga0070660_100004392
880 Ga0070660_100006501
881 Ga0070660_100011788
882 Ga0070660_100017265
883 Ga0070660_100024885
884 Ga0070660_100027054
885 Ga0070660_100062645
886 Ga0070660_100131426
887 Ga0070660_100180228
888 Ga0070660_100274541
889 Ga0070689_100277602
890 Ga0070691_10000317
891 Ga0070661_100003518
892 Ga0070661_100106266
893 Ga0070661_100163737
894 Ga0070661_100168430
895 Ga0070661_100345469
896 Ga0070661_100375654
897 Ga0070692_10005091
898 Ga0070669_100000565
899 Ga0070669_100047531
900 Ga0070669_100299215
901 Ga0070675_100047118
902 Ga0070675_100111392
903 Ga0070675_100464049
904 Ga0070671_100002084
905 Ga0070671_100009573
906 Ga0070671_100016983
907 Ga0070671_100023561
908 Ga0070674_100240171
909 Ga0070673_100003973
910 Ga0070673_100021894
911 Ga0070673_100028727
912 Ga0070673_100057329
913 Ga0070673_100075272
914 Ga0070673_100080104
915 Ga0070673_100126532
916 Ga0070673_100452846
917 Ga0070659_100000887
918 Ga0070659_100001567
919 Ga0070659_100032065
920 Ga0070659_100065993
921 Ga0070659_100069938
922 Ga0070659_100082828
923 Ga0070659_100100516
924 Ga0070659_100234005
925 Ga0070659_100248448
926 Ga0070659_100462408
927 Ga0070667_100000764
928 Ga0070667_100010885
929 Ga0070667_100035741
930 Ga0070667_100050410
931 Ga0070667_100075138
932 Ga0070667_100126572
933 Ga0070667_100244306
934 Ga0070709_10049343
935 Ga0070714_100335091
936 Ga0070714_100389813
937 Ga0070713_100210184
938 Ga0070694_100009204
939 Ga0070663_100001696
940 Ga0070663_100011726
941 Ga0070663_100043165
942 Ga0070663_100051506
943 Ga0070663_100171438
944 Ga0070678_100348807
945 Ga0070662_100000047
946 Ga0070662_100008398
947 Ga0070662_100026387
948 Ga0070662_100053388
949 Ga0070662_100070691
950 Ga0070662_100089457
951 Ga0070662_100099087
952 Ga0070662_100113433
953 Ga0070662_100189452
954 Ga0070681_10192961
955 Ga0068867_100012344
956 Ga0068867_100068213
957 Ga0070679_100061012
958 Ga0070679_100101931
959 Ga0070679_100131140
960 Ga0070679_100264835
961 Ga0070679_100347296
962 Ga0070679_100441914
963 Ga0070684_100015644
964 Ga0070684_100028521
965 Ga0070684_100187484
966 Ga0068853_100000033
967 Ga0068853_100005485
968 Ga0068853_100032634
969 Ga0068853_100125191
970 Ga0068853_100183860
971 Ga0068853_100230173
972 Ga0068853_100332233
973 Ga0070672_100010512
974 Ga0070672_100074735
975 Ga0070672_100204553
976 Ga0070686_100157745
977 Ga0070696_100199908
978 Ga0070693_100001255
979 Ga0070693_100105467
980 Ga0070693_100212860
981 Ga0070665_100009636
982 Ga0070665_100010704
983 Ga0070665_100022897
984 Ga0070665_100045989
985 Ga0070665_100067978
986 Ga0070704_100317540
987 Ga0068855_100005847
988 Ga0068855_100052849
989 Ga0068855_100072569
990 Ga0068855_100110052
991 Ga0068855_100222500
992 Ga0068855_100248015
993 Ga0068855_100250463
994 Ga0068855_100314468
995 Ga0068855_100387993
996 Ga0068855_100522439
997 Ga0070664_100000066
998 Ga0070664_100008785
999 Ga0070664_100012124
1000 Ga0070664_100031007
1001 Ga0070664_100036798
1002 Ga0070664_100254465
1003 Ga0070664_100405614
1004 Ga0068857_100003003
1005 Ga0068857_100007256
1006 Ga0068857_100010273
1007 Ga0068857_100020025
1008 Ga0068857_100022914
1009 Ga0068857_100027971
1010 Ga0068857_100057007
1011 Ga0068857_100115040
1012 Ga0068854_100004155
1013 Ga0068854_100009153
1014 Ga0068854_100010935
1015 Ga0068854_100034029
1016 Ga0068854_100036074
1017 Ga0068854_100089019
1018 Ga0068854_100312939
1019 Ga0068856_100000162
1020 Ga0068856_100085927
1021 Ga0068856_100103381
1022 Ga0068856_100125238
1023 Ga0068856_100229197
1024 Ga0068856_100482665
1025 Ga0068856_100814131
1026 Ga0068852_100002091
1027 Ga0068852_100010396
1028 Ga0068852_100045542
1029 Ga0068852_100116450
1030 Ga0068852_100132342
1031 Ga0068852_100190166
1032 Ga0068852_100197790
1033 Ga0068852_100211182
1034 Ga0068852_100268971
1035 Ga0068859_100021639
1036 Ga0068859_100275171
1037 Ga0068859_100366815
1038 Ga0068859_100742325
1039 Ga0068864_100045578
1040 Ga0068866_10081721
1041 Ga0068866_10087687
1042 Ga0068861_100039577
1043 Ga0068851_10055765
1044 Ga0068851_10104647
1045 Ga0068870_10408811
1046 Ga0068863_100005669
1047 Ga0068863_100007091
1048 Ga0068863_100017811
1049 Ga0068863_100023090
1050 Ga0068863_100055734
1051 Ga0068863_100728430
1052 Ga0068858_100006383
1053 Ga0068858_100025462
1054 Ga0068858_100041297
1055 Ga0068858_100052236
1056 Ga0068858_100246148
1057 Ga0068858_100292225
1058 Ga0068858_100482509
1059 Ga0068860_100007040
1060 Ga0068860_100051533
1061 Ga0068860_100074629
1062 Ga0068860_100615309
1063 Ga0068862_100005282
1064 Ga0068862_100077464
1065 Ga0068862_100158906
1066 Ga0068862_100247475
1067 Ga0068862_100489479
1068 Ga0070717_10010474
1069 Ga0070712_100009442
1070 Ga0070712_100565103
1071 Ga0097621_100055907
1072 Ga0097621_100406897
1073 Ga0068871_100066197
1074 Ga0068865_100517064
1075 Ga0097620_100021638
1076 Ga0097620_100275164
1077 Ga0097620_100366790
1078 Ga0097620_100742406
1079 Ga0075435_100207109
1080 Ga0105240_10032102
1081 Ga0105240_10043569
1082 Ga0105240_10070138
1083 Ga0105240_10227895
1084 Ga0105245_10000782
1085 Ga0105245_10189780
1086 Ga0105245_10420056
1087 Ga0105245_10573464
1088 Ga0105243_10169600
1089 Ga0105243_10244561
1090 Ga0105241_10030928
1091 Ga0105241_10046203
1092 Ga0105241_10117019
1093 Ga0105241_10131570
1094 Ga0105241_10603881
1095 Ga0105242_10053531
1096 Ga0105242_10154828
1097 Ga0105248_10003721
1098 Ga0105248_10012199
1099 Ga0105248_10048261
1100 Ga0105248_10081065
1101 Ga0105248_10191344
1102 Ga0105237_10010459
1103 Ga0105237_10078383
1104 Ga0105238_10037975
1105 Ga0105238_10041123
1106 Ga0105238_10046723
1107 Ga0105238_10096775
1108 Ga0105238_10121785
1109 Ga0105238_10384755
1110 Ga0105238_10399044
1111 Ga0105249_10129924
1112 Ga0105249_10290631
1113 Ga0105249_10749572
1114 Ga0105239_10235909
1115 Ga0105239_10300502
1116 Ga0105246_10064863
1117 Ga0105246_10229467
1118 Ga0105246_10381103
1119 Ga0157373_10004543
1120 Ga0157373_10012009
1121 Ga0157373_10026182
1122 Ga0157373_10032530
1123 Ga0157373_10039353
1124 Ga0157373_10052668
1125 Ga0157373_10076014
1126 Ga0157373_10088159
1127 Ga0157373_10130908
1128 Ga0157373_10201820
1129 Ga0157371_10039467
1130 Ga0157371_10081208
1131 Ga0157371_10093477
1132 Ga0157371_10106406
1133 Ga0157371_10151371
1134 Ga0157371_10172066
1135 Ga0157371_10183291
1136 Ga0157370_10009228
1137 Ga0157370_10009365
1138 Ga0157370_10042285
1139 Ga0157369_10011303
1140 Ga0157369_10026642
1141 Ga0157369_10029866
1142 Ga0157369_10086612
1143 Ga0157369_10111223
1144 Ga0157369_10154089
1145 Ga0157369_10190590
1146 Ga0157369_10213548
1147 Ga0157369_10318242
1148 Ga0157369_10546448
1149 Ga0157374_10012401
1150 Ga0157374_10320997
1151 Ga0157378_10341621
1152 Ga0157378_10511267
1153 Ga0157378_10786420
1154 Ga0163162_10037065
1155 Ga0163162_10063325
1156 Ga0163162_10120409
1157 Ga0157372_10056188
1158 Ga0157372_10065516
1159 Ga0157372_10119882
1160 Ga0157372_10525572
1161 Ga0157372_10691631
1162 Ga0157375_10180307
1163 Ga0157375_10319983
1164 Ga0163163_10217594
1165 Ga0182008_10064369
1166 Ga0157377_10058397
1167 Ga0157377_10080839
1168 Ga0157379_10017407
1169 Ga0157376_10003636
1170 Ga0197907_10160736
1171 Ga0206356_11518027
1172 Ga0224712_10135891
1173 Ga0207697_10000162
1174 Ga0207697_10024732
1175 Ga0207697_10034827
1176 Ga0207656_10201455
1177 Ga0207642_10063885
1178 Ga0207688_10000909
1179 Ga0207680_10001490
1180 Ga0207680_10013511
1181 Ga0207647_10000073
1182 Ga0207647_10001093
1183 Ga0207647_10001424
1184 Ga0207647_10007124
1185 Ga0207647_10027780
1186 Ga0207647_10063967
1187 Ga0207647_10114561
1188 Ga0207647_10163935
1189 Ga0207699_10046160
1190 Ga0207645_10005215
1191 Ga0207645_10025315
1192 Ga0207645_10084702
1193 Ga0207645_10090463
1194 Ga0207705_10005195
1195 Ga0207705_10043846
1196 Ga0207705_10240702
1197 Ga0207705_10246754
1198 Ga0207654_10027047
1199 Ga0207707_10084991
1200 Ga0207707_10210340
1201 Ga0207695_10012117
1202 Ga0207695_10116166
1203 Ga0207695_10184346
1204 Ga0207671_10163149
1205 Ga0207693_10012012
1206 Ga0207693_10027018
1207 Ga0207660_10001465
1208 Ga0207660_10161929
1209 Ga0207660_10362985
1210 Ga0207660_10442184
1211 Ga0207657_10005786
1212 Ga0207657_10007431
1213 Ga0207657_10009175
1214 Ga0207657_10009587
1215 Ga0207657_10030651
1216 Ga0207657_10033906
1217 Ga0207657_10034062
1218 Ga0207657_10039012
1219 Ga0207657_10040290
1220 Ga0207657_10066559
1221 Ga0207657_10075768
1222 Ga0207657_10263064
1223 Ga0207649_10002318
1224 Ga0207649_10009296
1225 Ga0207649_10013315
1226 Ga0207649_10057339
1227 Ga0207649_10091128
1228 Ga0207649_10095186
1229 Ga0207649_10212739
1230 Ga0207649_10245283
1231 Ga0207649_10368720
1232 Ga0207652_10193911
1233 Ga0207652_10202000
1234 Ga0207652_10215420
1235 Ga0207652_10249866
1236 Ga0207681_10487061
1237 Ga0207681_10652510
1238 Ga0207694_10003870
1239 Ga0207694_10028276
1240 Ga0207694_10045103
1241 Ga0207650_10022685
1242 Ga0207650_10051253
1243 Ga0207650_10069072
1244 Ga0207650_10100108
1245 Ga0207650_10127311
1246 Ga0207650_10150517
1247 Ga0207650_10177023
1248 Ga0207659_10062757
1249 Ga0207659_10125168
1250 Ga0207687_10008779
1251 Ga0207687_10156335
1252 Ga0207687_10268254
1253 Ga0207700_10140519
1254 Ga0207664_10270215
1255 Ga0207664_10382513
1256 Ga0207644_10030510
1257 Ga0207644_10078102
1258 Ga0207644_10116681
1259 Ga0207644_10123093
1260 Ga0207644_10472246
1261 Ga0207690_10000777
1262 Ga0207690_10002539
1263 Ga0207690_10012424
1264 Ga0207690_10031983
1265 Ga0207690_10034134
1266 Ga0207690_10064193
1267 Ga0207690_10066305
1268 Ga0207690_10093466
1269 Ga0207690_10216174
1270 Ga0207690_10410545
1271 Ga0207690_10572433
1272 Ga0207706_10001063
1273 Ga0207706_10006873
1274 Ga0207706_10008071
1275 Ga0207706_10020060
1276 Ga0207706_10045866
1277 Ga0207706_10057661
1278 Ga0207706_10060769
1279 Ga0207706_10388058
1280 Ga0207686_10063874
1281 Ga0207709_10167581
1282 Ga0207709_10209660
1283 Ga0207709_10297572
1284 Ga0207669_10192884
1285 Ga0207691_10001499
1286 Ga0207691_10012981
1287 Ga0207691_10051374
1288 Ga0207691_10112349
1289 Ga0207711_10000174
1290 Ga0207711_10002763
1291 Ga0207711_10006114
1292 Ga0207711_10012069
1293 Ga0207711_10185701
1294 Ga0207711_10217053
1295 Ga0207711_10545103
1296 Ga0207689_10000167
1297 Ga0207689_10054262
1298 Ga0207689_10083687
1299 Ga0207689_10136316
1300 Ga0207661_10023773
1301 Ga0207661_10033964
1302 Ga0207661_10145331
1303 Ga0207661_10209057
1304 Ga0207661_10429043
1305 Ga0207679_10000150
1306 Ga0207679_10030926
1307 Ga0207679_10064246
1308 Ga0207679_10274539
1309 Ga0207679_10388833
1310 Ga0207679_10406272
1311 Ga0207667_10000443
1312 Ga0207667_10012419
1313 Ga0207667_10084992
1314 Ga0207667_10095828
1315 Ga0207667_10115121
1316 Ga0207667_10130830
1317 Ga0207667_10200743
1318 Ga0207667_10647519
1319 Ga0207667_10735103
1320 Ga0207667_10825876
1321 Ga0207667_10870317
1322 Ga0207651_10011170
1323 Ga0207651_10043708
1324 Ga0207651_10083644
1325 Ga0207651_10087729
1326 Ga0207651_10103766
1327 Ga0207651_10127485
1328 Ga0207651_10168464
1329 Ga0207712_10011567
1330 Ga0207668_10119060
1331 Ga0207668_10160699
1332 Ga0207640_10029943
1333 Ga0207640_10071530
1334 Ga0207640_10122069
1335 Ga0207640_10136322
1336 Ga0207640_10616283
1337 Ga0207658_10004413
1338 Ga0207658_10005682
1339 Ga0207658_10006022
1340 Ga0207658_10114190
1341 Ga0207658_10423650
1342 Ga0207677_10003531
1343 Ga0207677_10141284
1344 Ga0207677_10146424
1345 Ga0207677_10282027
1346 Ga0207677_10304529
1347 Ga0207703_10004057
1348 Ga0207703_10014553
1349 Ga0207703_10020601
1350 Ga0207703_10023164
1351 Ga0207703_10037572
1352 Ga0207703_10274036
1353 Ga0207703_10382311
1354 Ga0207703_10478409
1355 Ga0207703_10720787
1356 Ga0207639_10000144
1357 Ga0207639_10000851
1358 Ga0207639_10008734
1359 Ga0207639_10027181
1360 Ga0207639_10031620
1361 Ga0207639_10042855
1362 Ga0207639_10111985
1363 Ga0207639_10118008
1364 Ga0207639_10138524
1365 Ga0207639_10163407
1366 Ga0207678_10005023
1367 Ga0207678_10021716
1368 Ga0207678_10024585
1369 Ga0207678_10039002
1370 Ga0207678_10041699
1371 Ga0207678_10052954
1372 Ga0207678_10062108
1373 Ga0207702_10005597
1374 Ga0207702_10010053
1375 Ga0207702_10037906
1376 Ga0207702_10186975
1377 Ga0207702_10195004
1378 Ga0207641_10011660
1379 Ga0207641_10016621
1380 Ga0207641_10175380
1381 Ga0207641_10355789
1382 Ga0207641_10394895
1383 Ga0207648_10023887
1384 Ga0207648_10046120
1385 Ga0207648_10058078
1386 Ga0207648_10138611
1387 Ga0207676_10002947
1388 Ga0207676_10374005
1389 Ga0207676_10462491
1390 Ga0207674_10002073
1391 Ga0207674_10005768
1392 Ga0207674_10007637
1393 Ga0207674_10009450
1394 Ga0207674_10016402
1395 Ga0207674_10019921
1396 Ga0207674_10033866
1397 Ga0207674_10081185
1398 Ga0207674_10107894
1399 Ga0207674_10119424
1400 Ga0207674_10482367
1401 Ga0207675_100046661
1402 Ga0207675_100268810
1403 Ga0207683_10026205
1404 Ga0207683_10296509
1405 Ga0207698_10002267
1406 Ga0207698_10006878
1407 Ga0207698_10020567
1408 Ga0207698_10030800
1409 Ga0207698_10041600
1410 Ga0207698_10085736
1411 Ga0207698_10101990
1412 Ga0207698_10152858
1413 Ga0207698_10160349
1414 Ga0207698_10378278
1415 Ga0207698_10503527
1416 Ga0207698_10633887
1417 Ga0268266_10014546
1418 Ga0268266_10025415
1419 Ga0268266_10088056
1420 Ga0268265_10008862
1421 Ga0268265_10026471
1422 Ga0268265_10060149
1423 Ga0268264_10001230
1424 Ga0268264_10008487
1425 Ga0268264_10074618
1426 Ga0268264_10216856
1427 Ga0307408_100051958
1428 Ga0307405_10341223
1429 Ga0307413_10144753
1430 Ga0307413_10193030
1431 Ga0307410_10008595
1432 Ga0307410_10012752
1433 Ga0307407_10051571
1434 Ga0307407_10130099
1435 Ga0307409_100008491
1436 Ga0307409_100104360
1437 Ga0307409_100380131
1438 Ga0307409_100489379
1439 Ga0307414_10131779
1440 Ga0307414_10217176
1441 Ga0307411_10041808
1442 Ga0307411_10099180
1443 Ga0307411_10650256
1444 Ga0307415_100019598
1445 Ga0307415_100216363
1446 Ga0373932_0093526
1447 Ga0373941_0044643
1448 Ga0373943_0010052
1449 Ga0373931_0007229
1450 Ga0373935_0033605
1451 Ga0373927_0030225
1452 Ga0395899_0001070
1453 Ga0395899_0003599
1454 Ga0395899_0004952
1455 Ga0395899_0013798
1456 Ga0395899_0043275
1457 Ga0395899_0051492
1458 Ga0395899_0052893
1459 Ga0395899_0061498
1460 Ga0395899_0064142
1461 Ga0395899_0079880
1462 Ga0395899_0158291
1463 Ga0395899_0228285
1464 Ga0395899_0247244
1465 Ga0395900_0001041
1466 Ga0395900_0011436
1467 Ga0395900_0011750
1468 Ga0395900_0015887
1469 Ga0395900_0016938
1470 Ga0395900_0018396
1471 Ga0395900_0030614
1472 Ga0395900_0036432
1473 Ga0395900_0051015
1474 Ga0395900_0051432
1475 Ga0395900_0055439
1476 Ga0395900_0060798
1477 Ga0395900_0069555
1478 Ga0395900_0073055
1479 Ga0395900_0089716
1480 Ga0395900_0135243
1481 Ga0395900_0211647
1482 Ga0395900_0256408
1483 Ga0395900_0317046
1484 Ga0395900_0342415
1485 Ga0395900_0442876
1486 Ga0395898_0000274
1487 Ga0395898_0010300
1488 Ga0395898_0012715
1489 Ga0395898_0018438
1490 Ga0395898_0018633
1491 Ga0395898_0026753
1492 Ga0395898_0052351
1493 Ga0395898_0057015
1494 Ga0395898_0070310
1495 Ga0395898_0082203
1496 Ga0395898_0098696
1497 Ga0395898_0103557
1498 Ga0395898_0110180
1499 Ga0395898_0119310
1500 Ga0395898_0128875
1501 Ga0395898_0182841
1502 Ga0395898_0204619
1503 Ga0395898_0530800
1504 Ga0395905_0000006
1505 Ga0395905_0002330
1506 Ga0395905_0006965
1507 Ga0395905_0007371
1508 Ga0395905_0008869
1509 Ga0395905_0009804
1510 Ga0395905_0012465
1511 Ga0395905_0014564
1512 Ga0395905_0015854
1513 Ga0395905_0024002
1514 Ga0395905_0028407
1515 Ga0395905_0028927
1516 Ga0395905_0030832
1517 Ga0395905_0040679
1518 Ga0395905_0041117
1519 Ga0395905_0041722
1520 Ga0395905_0043636
1521 Ga0395905_0043749
1522 Ga0395905_0066910
1523 Ga0395905_0079934
1524 Ga0395905_0100472
1525 Ga0395905_0123550
1526 Ga0395905_0146543
1527 Ga0395905_0158139
1528 Ga0395905_0217418
1529 Ga0395905_0217989
1530 Ga0395905_0222917
1531 Ga0395905_0241556
1532 Ga0395905_0282326
1533 Ga0395905_0292166
1534 Ga0395905_0380693
1535 Ga0395905_0547511
1536 Ga0395905_0592253
1537 Ga0395901_0001959
1538 Ga0395901_0009696
1539 Ga0395901_0019006
1540 Ga0395901_0026433
1541 Ga0395901_0027042
1542 Ga0395901_0032560
1543 Ga0395901_0040796
1544 Ga0395901_0055766
1545 Ga0395901_0067747
1546 Ga0395901_0070145
1547 Ga0395901_0070313
1548 Ga0395901_0070384
1549 Ga0395901_0091439
1550 Ga0395901_0092854
1551 Ga0395901_0093959
1552 Ga0395901_0105170
1553 Ga0395901_0155176
1554 Ga0395901_0158354
1555 Ga0395901_0544706
1556 Ga0436365_0088937
1557 Ga0436363_0494724
1558 Ga0439448_0084479
1559 Ga0439458_0000160
1560 Ga0439458_0000210
1561 Ga0439464_0001497
1562 Ga0466969_0084563
1563 Ga0466972_0059130
1564 Ga0466966_0065027
1565 Ga0466966_0090485
1566 Ga0466961_0062189
1567 Ga0466963_0002633
1568 Ga0466963_0018355
1569 Ga0466963_0036678
1570 Ga0466963_0044717
1571 Ga0466963_0048807
1572 Ga0466963_0086494
1573 Ga0466963_0128728
1574 Ga0466963_0149665
1575 Ga0466964_0038586
1576 Ga0466968_0007068
1577 Ga0466970_0017655
1578 Ga0466970_0206689
1579 Ga0466957_0010777
1580 Ga0466957_0044633
1581 Ga0466957_0052930
1582 Ga0466957_0143719
1583 Ga0466957_0171484
1584 Ga0466957_0191531
1585 Ga0466957_0323511
1586 Ga0466960_0096498
1587 Ga0466959_0102285
1588 Ga0466959_0166311
1589 Ga0466958_0025655
1590 Ga0466958_0084515
1591 Ga0466958_0145083
1592 Ga0466958_0366852
1593 Ga0466967_0001266
1594 Ga0466967_0001564
1595 Ga0466967_0016471
1596 Ga0466967_0026824
1597 Ga0466967_0041175
1598 Ga0466967_0114265
1599 Ga0466967_0159908
1600 Ga0466967_0421432
1601 Ga0466967_0450821
1602 Ga0466967_0544825
1603 Ga0495598_0002323
1604 Ga0495621_0013285
1605 Ga0495669_0000565
1606 Ga0495669_0015372
1607 Ga0495669_0049680
1608 Ga0495669_0092589
1609 Ga0495670_0002417
1610 Ga0495680_0443954
1611 Ga0495677_0098655
1612 Ga0496102_0118775
1613 Ga0496102_0770591
1614 Ga0496103_0139436
1615 Ga0496103_0230677
1616 Ga0496105_0113231
1617 Ga0496105_0495936
1618 Ga0496107_0038682
1619 Ga0496108_0000974
1620 Ga0496108_0019724
1621 Ga0496109_0072772
1622 Ga0496110_0016722
1623 Ga0496110_0127035
1624 Ga0496111_0038294
1625 Ga0496111_0118684
1626 Ga0496112_0001713
1627 Ga0496112_0067660
1628 Ga0496112_0098255
1629 Ga0496112_0111558
1630 Ga0496113_0014119
1631 Ga0496113_0040294
1632 Ga0501074_0363173
1633 Ga0501079_0271079
1634 Ga0501080_0019604
1635 Ga0501268_012010
1636 nmdc:mga0n895_311061_c1
1637 nmdc:mga0sz30_175949_c1
1638 Ga0466962_0138593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09955

DUF2189

Predicted integral membrane protein (DUF2189)

90

216

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.5352 40 230
3tx3-assembly1.cif.gz_B cysz, a putative sulfate permease 0.5122 21 240
3tx3-assembly1.cif.gz_B cysz, a putative sulfate permease 0.5 21 240
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.4413 40 230
6ffc-assembly1.cif.gz_A structure of an inhibitor-bound abc transporter 0.3175 27 225
ID Description Score Start End Superfamily
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4278 14 233 1.20.1070.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3942 14 233 1.20.1070.10
af_Q18000_173_429_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3414 1 234 1.20.1070.10
af_Q18000_173_429_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.329 1 234 1.20.1070.10
af_A0A0R4IDZ8_1844_1969_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.3143 26 185 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A848U517-F1-model_v4 DUF2189 domain-containing protein 0.8111 12 244 GO:0016020
AF-A0A7W6WV38-F1-model_v4 Putative membrane protein 0.8077 13 245 GO:0016020
AF-A0A7Y5UKM6-F1-model_v4 DUF2189 domain-containing protein 0.8062 4 237 GO:0016020
AF-X7EH69-F1-model_v4 Cytochrome C oxidase subunit I 0.8036 14 237 GO:0016020
AF-A0A4V3CX01-F1-model_v4 Putative membrane protein 0.8025 13 237 GO:0016020

Map