F482180
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 569 | 1638 | 391 |
Family's Representative Sequence
| Representative Sequence | 3300038725|Ga0400484_39394|Ga0400484_39394_6405_7679 |
| Length | 424 |
| Sequence | MRIKNKPQRRKERRGLEKNLRVLRASAVKLEEEKMSFAKRVSHLQEEGAYAVLARAQELERNGRTIIHLEIGEPDFETGANVSMAGIRAISEGRTRYNPPRGIAELREVIAADAGQRRGMEIRPSQVVVGPGAKPTLFFPTLALVEPGDEVIYPNPGFPTYEAMIGAAGGVPVPVPLREEKQFSFDLAVFDQLVNEKTRLIVLNSPSNPTGGVMPVADLEHIAALAQKNDCWVLSDEIYSRMVYDDTAVPSIASLPGMAERTVIADGFSKTYAMTGWRLGYGIMPEALADRIQLLLTHTIGCTAHFTQYAGIEALTGPQDWVDKMVASYRRRRDLLVNGLNAIPGINCQIPQGAFYVFPNVKELGISSAELANYILEEAGVALLPGTAFGKYGEGYLRLSYANSLENLERAMILMATALAKKTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 79 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 80 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 123 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 128 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 129 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 132 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 133 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 134 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 139 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 141 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 144 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 148 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 152 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 153 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 156 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 157 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 158 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 159 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 160 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 161 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 211 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 212 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 213 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 250 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 263 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 265 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 267 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 268 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 270 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 274 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 275 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 276 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 277 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 278 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 279 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 280 | 2512875024 | |||
| 281 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 282 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 283 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 284 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 285 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 286 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 287 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 288 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 289 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 290 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 291 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 292 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 293 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 294 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 295 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 296 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 297 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 298 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 299 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 300 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 301 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 302 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 303 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 304 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 305 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 306 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 307 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 308 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 309 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 310 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 311 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 312 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 313 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 314 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 315 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 316 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 317 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 318 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 319 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 320 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 321 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 322 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 323 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 324 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 325 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 326 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 327 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 328 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 329 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 330 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 331 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 332 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 333 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 334 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 335 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 336 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 337 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 338 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 339 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 340 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 341 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 342 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 343 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 344 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 345 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 346 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 347 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 348 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 349 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 350 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 351 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 352 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 353 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 354 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 355 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 356 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 357 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 358 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 359 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 360 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 361 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 362 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 363 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 364 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 365 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 366 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 367 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 368 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 369 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 370 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 371 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 372 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 373 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 374 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 375 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 376 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 377 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 378 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 379 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 380 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 381 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 382 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 383 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 384 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 385 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 386 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 387 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 388 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 389 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 390 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 391 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 392 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 393 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 394 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 395 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 396 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 397 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 398 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 399 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 400 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 401 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 402 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 403 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 404 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 405 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 406 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 407 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 408 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 409 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 410 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 411 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 412 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 413 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 414 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 415 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 416 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 417 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 418 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 419 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 420 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 421 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 422 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 423 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 424 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 425 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 426 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 427 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 428 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 429 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 430 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 431 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 432 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 433 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 434 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 435 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 436 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 437 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 438 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 439 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 440 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 441 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 442 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 443 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 444 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 445 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 446 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 447 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 448 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 449 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 450 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 451 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 452 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 453 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 454 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 455 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 456 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 457 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 458 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 459 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 460 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 461 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 462 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 463 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 464 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 465 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 466 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 467 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 468 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 469 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 470 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 471 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 472 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 473 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 474 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 475 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 476 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 477 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 478 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 479 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 480 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 481 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 482 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 483 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 484 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 485 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 486 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 487 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 488 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 489 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 490 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 491 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 492 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 493 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 494 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 495 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 496 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 497 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 498 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 499 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 500 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 501 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 502 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 503 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 504 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 505 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 506 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 507 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 508 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 509 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 510 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 511 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 512 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 513 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 514 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 515 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 516 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 517 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 518 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 519 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 520 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 521 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 522 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 523 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 524 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 525 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 526 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 527 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 528 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 529 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 530 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 531 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 532 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 533 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 534 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 535 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 536 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 537 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 538 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 539 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 540 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 541 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 542 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 543 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 544 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 545 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 546 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 547 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 548 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 549 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 550 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 551 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 552 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 553 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 554 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 555 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 556 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 557 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 558 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 559 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 560 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 561 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 562 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 563 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 564 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 565 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 566 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 567 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 568 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 569 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.61 |
| Metatranscriptomes | 0.12 |
| Isolates | 36.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.88 |
| Nodule | 28.21 |
| Rhizoplane | 3.91 |
| Rhizosphere | 52.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400484_39394 | 3300038725 | Bacteria | 11243 |
| 2 | JGI24735J21928_10031910 | 3300002067 | Bacteria | 1561 |
| 3 | JGI25156J39149_1007095 | 3300002705 | Bacteria | 2982 |
| 4 | JGI25157J39369_1000706 | 3300002741 | Bacteria | 18004 |
| 5 | JGI25159J45721_1004883 | 3300002987 | Bacteria | 4322 |
| 6 | JGI25151J46595_10000436 | 3300003187 | Bacteria | 41270 |
| 7 | JGI25165J46597_1000042 | 3300003214 | Bacteria | 271606 |
| 8 | JGI25153J46596_10003217 | 3300003215 | Bacteria | 9178 |
| 9 | JGI25160J50197_1017137 | 3300003354 | Bacteria | 2306 |
| 10 | Ga0055542_1000761 | 3300003762 | Bacteria | 24456 |
| 11 | Ga0065712_10001938 | 3300005290 | Bacteria | 5677 |
| 12 | Ga0065712_10143452 | 3300005290 | Unclassified | 1429 |
| 13 | Ga0070680_100020062 | 3300005336 | Bacteria | 5300 |
| 14 | Ga0068868_100079930 | 3300005338 | Bacteria | 2619 |
| 15 | Ga0070691_10024536 | 3300005341 | Bacteria | 2802 |
| 16 | Ga0070691_10052663 | 3300005341 | Bacteria | 1946 |
| 17 | Ga0070687_100002321 | 3300005343 | Bacteria | 7080 |
| 18 | Ga0070668_100205235 | 3300005347 | Bacteria | 1619 |
| 19 | Ga0070675_100258997 | 3300005354 | Bacteria | 1524 |
| 20 | Ga0070674_100000478 | 3300005356 | Bacteria | 20201 |
| 21 | Ga0070688_100001954 | 3300005365 | Bacteria | 10358 |
| 22 | Ga0070703_10001434 | 3300005406 | Bacteria | 7187 |
| 23 | Ga0070709_10126477 | 3300005434 | Bacteria | 1739 |
| 24 | Ga0070701_10019338 | 3300005438 | Bacteria | 3216 |
| 25 | Ga0070705_100001394 | 3300005440 | Bacteria | 12811 |
| 26 | Ga0070700_100003215 | 3300005441 | Bacteria | 8395 |
| 27 | Ga0070694_100002550 | 3300005444 | Bacteria | 10759 |
| 28 | Ga0070708_100006906 | 3300005445 | Bacteria | 9055 |
| 29 | Ga0070708_100014663 | 3300005445 | Bacteria | 6456 |
| 30 | Ga0070663_100046982 | 3300005455 | Bacteria | 3057 |
| 31 | Ga0070678_100154570 | 3300005456 | Bacteria | 1852 |
| 32 | Ga0070662_100047111 | 3300005457 | Bacteria | 3099 |
| 33 | Ga0070662_100080774 | 3300005457 | Bacteria | 2421 |
| 34 | Ga0070681_10174780 | 3300005458 | Bacteria | 2069 |
| 35 | Ga0068867_100162151 | 3300005459 | Bacteria | 1764 |
| 36 | Ga0070706_100000232 | 3300005467 | Bacteria | 68304 |
| 37 | Ga0070706_100022752 | 3300005467 | Bacteria | 5773 |
| 38 | Ga0070707_100006355 | 3300005468 | Bacteria | 10990 |
| 39 | Ga0070707_100011702 | 3300005468 | Bacteria | 8188 |
| 40 | Ga0070698_100005421 | 3300005471 | Bacteria | 13939 |
| 41 | Ga0070699_100012031 | 3300005518 | Bacteria | 7470 |
| 42 | Ga0070699_100220178 | 3300005518 | Bacteria | 1691 |
| 43 | Ga0070679_100041157 | 3300005530 | Bacteria | 4599 |
| 44 | Ga0070684_100296732 | 3300005535 | Bacteria | 1482 |
| 45 | Ga0070697_100005908 | 3300005536 | Bacteria | 9448 |
| 46 | Ga0070697_100175677 | 3300005536 | Bacteria | 1814 |
| 47 | Ga0070697_100209410 | 3300005536 | Bacteria | 1659 |
| 48 | Ga0068853_100014287 | 3300005539 | Bacteria | 6498 |
| 49 | Ga0070695_100001172 | 3300005545 | Bacteria | 14398 |
| 50 | Ga0070695_100009322 | 3300005545 | Bacteria | 5837 |
| 51 | Ga0070696_100001543 | 3300005546 | Bacteria | 15094 |
| 52 | Ga0070693_100031015 | 3300005547 | Bacteria | 2927 |
| 53 | Ga0070665_100026701 | 3300005548 | Bacteria | 5815 |
| 54 | Ga0070665_100054407 | 3300005548 | Bacteria | 4014 |
| 55 | Ga0070665_100169391 | 3300005548 | Bacteria | 2185 |
| 56 | Ga0070704_100043512 | 3300005549 | Bacteria | 3113 |
| 57 | Ga0068855_100053133 | 3300005563 | Bacteria | 4767 |
| 58 | Ga0068857_100070483 | 3300005577 | Bacteria | 3114 |
| 59 | Ga0068856_100019963 | 3300005614 | Bacteria | 6505 |
| 60 | Ga0070702_100036778 | 3300005615 | Bacteria | 2715 |
| 61 | Ga0068852_100198937 | 3300005616 | Bacteria | 1895 |
| 62 | Ga0068864_100014202 | 3300005618 | Bacteria | 6612 |
| 63 | Ga0068861_100090712 | 3300005719 | Bacteria | 2411 |
| 64 | Ga0068861_100099490 | 3300005719 | Bacteria | 2310 |
| 65 | Ga0068862_100007019 | 3300005844 | Bacteria | 9353 |
| 66 | Ga0081455_10216358 | 3300005937 | Bacteria | 1424 |
| 67 | Ga0081538_10027435 | 3300005981 | Bacteria | 3948 |
| 68 | Ga0081540_1010027 | 3300005983 | Bacteria | 6449 |
| 69 | Ga0081540_1011749 | 3300005983 | Bacteria | 5826 |
| 70 | Ga0081539_10000609 | 3300005985 | Bacteria | 72508 |
| 71 | Ga0081539_10021387 | 3300005985 | Bacteria | 4324 |
| 72 | Ga0070717_10001033 | 3300006028 | Bacteria | 18652 |
| 73 | Ga0070717_10003023 | 3300006028 | Bacteria | 11987 |
| 74 | Ga0075363_100032940 | 3300006048 | Bacteria | 2695 |
| 75 | Ga0075364_10004279 | 3300006051 | Bacteria | 8197 |
| 76 | Ga0075367_10005385 | 3300006178 | Bacteria | 6347 |
| 77 | Ga0075367_10058724 | 3300006178 | Bacteria | 2289 |
| 78 | Ga0075367_10073349 | 3300006178 | Bacteria | 2062 |
| 79 | Ga0075428_100031858 | 3300006844 | Bacteria | 5824 |
| 80 | Ga0075428_100032615 | 3300006844 | Bacteria | 5752 |
| 81 | Ga0075428_100054425 | 3300006844 | Bacteria | 4386 |
| 82 | Ga0075428_100056314 | 3300006844 | Bacteria | 4307 |
| 83 | Ga0075428_100071008 | 3300006844 | Bacteria | 3806 |
| 84 | Ga0075430_100074413 | 3300006846 | Bacteria | 2848 |
| 85 | Ga0075430_100175236 | 3300006846 | Bacteria | 1784 |
| 86 | Ga0075431_100001046 | 3300006847 | Bacteria | 24694 |
| 87 | Ga0075431_100002212 | 3300006847 | Bacteria | 18636 |
| 88 | Ga0075431_100045647 | 3300006847 | Bacteria | 4517 |
| 89 | Ga0105240_10016012 | 3300009093 | Bacteria | 10165 |
| 90 | Ga0105240_10104652 | 3300009093 | Bacteria | 3437 |
| 91 | Ga0111539_10224306 | 3300009094 | Bacteria | 2189 |
| 92 | Ga0111539_10297056 | 3300009094 | Bacteria | 1880 |
| 93 | Ga0111539_10507537 | 3300009094 | Bacteria | 1404 |
| 94 | Ga0114129_10016469 | 3300009147 | Bacteria | 10523 |
| 95 | Ga0114129_10148020 | 3300009147 | Bacteria | 3215 |
| 96 | Ga0114129_10421602 | 3300009147 | Bacteria | 1755 |
| 97 | Ga0105243_10149681 | 3300009148 | Bacteria | 2001 |
| 98 | Ga0105238_10012662 | 3300009551 | Bacteria | 8513 |
| 99 | Ga0105249_10006261 | 3300009553 | Bacteria | 10337 |
| 100 | Ga0157373_10173325 | 3300013100 | Bacteria | 1518 |
| 101 | Ga0157374_10239902 | 3300013296 | Bacteria | 1782 |
| 102 | Ga0163162_10153750 | 3300013306 | Bacteria | 2419 |
| 103 | Ga0157379_10132939 | 3300014968 | Bacteria | 2240 |
| 104 | Ga0182007_10012507 | 3300015262 | Bacteria | 3262 |
| 105 | Ga0206353_11955115 | 3300020082 | Bacteria | 2116 |
| 106 | Ga0213872_10063372 | 3300021361 | Bacteria | 1671 |
| 107 | Ga0213876_10000915 | 3300021384 | Bacteria | 19496 |
| 108 | Ga0213876_10072220 | 3300021384 | Bacteria | 1822 |
| 109 | Ga0213875_10000391 | 3300021388 | Bacteria | 39122 |
| 110 | Ga0213875_10003194 | 3300021388 | Bacteria | 9421 |
| 111 | Ga0213875_10006561 | 3300021388 | Bacteria | 6089 |
| 112 | Ga0213871_10011082 | 3300021441 | Bacteria | 2061 |
| 113 | Ga0224572_1001846 | 3300024225 | Bacteria | 3263 |
| 114 | Ga0209026_1000029 | 3300025250 | Bacteria | 337109 |
| 115 | Ga0209148_1000080 | 3300025254 | Bacteria | 277806 |
| 116 | Ga0209759_1000040 | 3300025256 | Bacteria | 254501 |
| 117 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 118 | Ga0209233_1003389 | 3300025261 | Bacteria | 5620 |
| 119 | Ga0209455_1000171 | 3300025272 | Bacteria | 109696 |
| 120 | Ga0209130_1000167 | 3300025284 | Bacteria | 95517 |
| 121 | Ga0209025_1000077 | 3300025294 | Bacteria | 271958 |
| 122 | Ga0209025_1003608 | 3300025294 | Bacteria | 14413 |
| 123 | Ga0209025_1015789 | 3300025294 | Bacteria | 4518 |
| 124 | Ga0209758_1000036 | 3300025297 | Bacteria | 441671 |
| 125 | Ga0209758_1004420 | 3300025297 | Bacteria | 11708 |
| 126 | Ga0209758_1004860 | 3300025297 | Bacteria | 10834 |
| 127 | Ga0207426_1000239 | 3300025302 | Bacteria | 123307 |
| 128 | Ga0207653_10003312 | 3300025885 | Bacteria | 5083 |
| 129 | Ga0207699_10052251 | 3300025906 | Bacteria | 2418 |
| 130 | Ga0207643_10104917 | 3300025908 | Bacteria | 1660 |
| 131 | Ga0207705_10105819 | 3300025909 | Bacteria | 2074 |
| 132 | Ga0207684_10000489 | 3300025910 | Bacteria | 50446 |
| 133 | Ga0207707_10018671 | 3300025912 | Bacteria | 6047 |
| 134 | Ga0207695_10195990 | 3300025913 | Bacteria | 1936 |
| 135 | Ga0207663_10141100 | 3300025916 | Bacteria | 1679 |
| 136 | Ga0207652_10066221 | 3300025921 | Bacteria | 3130 |
| 137 | Ga0207652_10094416 | 3300025921 | Bacteria | 2634 |
| 138 | Ga0207646_10003498 | 3300025922 | Bacteria | 17706 |
| 139 | Ga0207646_10029731 | 3300025922 | Bacteria | 4961 |
| 140 | Ga0207646_10321722 | 3300025922 | Bacteria | 1398 |
| 141 | Ga0207700_10045456 | 3300025928 | Bacteria | 3240 |
| 142 | Ga0207664_10050419 | 3300025929 | Bacteria | 3282 |
| 143 | Ga0207644_10191508 | 3300025931 | Bacteria | 1608 |
| 144 | Ga0207689_10030419 | 3300025942 | Bacteria | 4499 |
| 145 | Ga0207661_10080104 | 3300025944 | Bacteria | 2694 |
| 146 | Ga0207703_10153903 | 3300026035 | Bacteria | 2008 |
| 147 | Ga0207678_10240532 | 3300026067 | Bacteria | 1550 |
| 148 | Ga0207708_10012179 | 3300026075 | Bacteria | 6415 |
| 149 | Ga0207708_10031759 | 3300026075 | Bacteria | 4010 |
| 150 | Ga0207702_10283613 | 3300026078 | Bacteria | 1567 |
| 151 | Ga0207641_10185394 | 3300026088 | Bacteria | 1909 |
| 152 | Ga0207676_10026932 | 3300026095 | Bacteria | 4277 |
| 153 | Ga0207674_10005484 | 3300026116 | Bacteria | 15067 |
| 154 | Ga0207675_100040029 | 3300026118 | Bacteria | 4374 |
| 155 | Ga0207675_100138927 | 3300026118 | Bacteria | 2307 |
| 156 | Ga0207683_10039963 | 3300026121 | Bacteria | 4092 |
| 157 | Ga0207698_10019455 | 3300026142 | Bacteria | 4650 |
| 158 | Ga0209813_10002328 | 3300027866 | Bacteria | 4351 |
| 159 | Ga0207428_10016982 | 3300027907 | Bacteria | 6254 |
| 160 | Ga0268266_10319078 | 3300028379 | Bacteria | 1454 |
| 161 | Ga0268265_10004578 | 3300028380 | Bacteria | 9558 |
| 162 | Ga0265318_10049959 | 3300028577 | Bacteria | 1572 |
| 163 | Ga0265322_10000068 | 3300028654 | Bacteria | 49602 |
| 164 | Ga0265325_10001708 | 3300031241 | Bacteria | 15269 |
| 165 | Ga0265325_10039960 | 3300031241 | Bacteria | 2466 |
| 166 | Ga0265325_10077814 | 3300031241 | Bacteria | 1653 |
| 167 | Ga0265340_10002223 | 3300031247 | Bacteria | 11099 |
| 168 | Ga0265340_10018326 | 3300031247 | Bacteria | 3611 |
| 169 | Ga0265339_10001551 | 3300031249 | Bacteria | 16995 |
| 170 | Ga0265339_10019507 | 3300031249 | Bacteria | 3980 |
| 171 | Ga0265339_10064232 | 3300031249 | Bacteria | 1970 |
| 172 | Ga0265316_10003139 | 3300031344 | Bacteria | 16822 |
| 173 | Ga0265316_10012132 | 3300031344 | Bacteria | 7736 |
| 174 | Ga0265316_10038081 | 3300031344 | Bacteria | 3878 |
| 175 | Ga0307513_10078364 | 3300031456 | Bacteria | 3418 |
| 176 | Ga0265313_10000448 | 3300031595 | Bacteria | 43625 |
| 177 | Ga0265313_10020220 | 3300031595 | Bacteria | 3679 |
| 178 | Ga0265313_10020466 | 3300031595 | Bacteria | 3649 |
| 179 | Ga0307508_10076676 | 3300031616 | Bacteria | 2921 |
| 180 | Ga0316579_10006580 | 3300031691 | Bacteria | 4749 |
| 181 | Ga0316579_10020859 | 3300031691 | Bacteria | 2913 |
| 182 | Ga0316579_10040775 | 3300031691 | Bacteria | 2154 |
| 183 | Ga0265314_10034245 | 3300031711 | Bacteria | 3715 |
| 184 | Ga0265314_10096143 | 3300031711 | Bacteria | 1917 |
| 185 | Ga0265342_10009206 | 3300031712 | Bacteria | 6989 |
| 186 | Ga0316576_10111976 | 3300031727 | Bacteria | 2046 |
| 187 | Ga0316578_10002543 | 3300031728 | Bacteria | 8053 |
| 188 | Ga0316578_10105925 | 3300031728 | Bacteria | 1687 |
| 189 | Ga0307516_10011659 | 3300031730 | Bacteria | 9538 |
| 190 | Ga0316577_10151465 | 3300031733 | Bacteria | 1307 |
| 191 | Ga0307410_10166749 | 3300031852 | Bacteria | 1656 |
| 192 | Ga0316580_10004219 | 3300032139 | Bacteria | 4151 |
| 193 | Ga0307510_10045718 | 3300033180 | Bacteria | 4720 |
| 194 | Ga0373926_0035757 | 3300035083 | Bacteria | 1763 |
| 195 | Ga0373956_0001924 | 3300035119 | Bacteria | 8571 |
| 196 | Ga0373957_0040217 | 3300035120 | Bacteria | 1757 |
| 197 | Ga0373924_0008451 | 3300035410 | Bacteria | 3743 |
| 198 | Ga0373935_0016237 | 3300035692 | Bacteria | 4507 |
| 199 | Ga0373935_0118736 | 3300035692 | Bacteria | 1764 |
| 200 | Ga0373927_0035758 | 3300035695 | Bacteria | 3230 |
| 201 | Ga0373933_0002515 | 3300035724 | Bacteria | 10296 |
| 202 | Ga0373947_0021014 | 3300035725 | Bacteria | 3775 |
| 203 | Ga0373937_0031797 | 3300036401 | Bacteria | 4784 |
| 204 | Ga0316582_0010511 | 3300036647 | Bacteria | 5074 |
| 205 | Ga0316582_0043042 | 3300036647 | Bacteria | 2832 |
| 206 | Ga0316582_0048188 | 3300036647 | Bacteria | 2693 |
| 207 | Ga0316584_0000872 | 3300036712 | Bacteria | 17133 |
| 208 | Ga0316584_0015819 | 3300036712 | Bacteria | 5402 |
| 209 | Ga0316584_0032464 | 3300036712 | Bacteria | 3865 |
| 210 | Ga0316584_0071843 | 3300036712 | Bacteria | 2593 |
| 211 | Ga0316584_0080005 | 3300036712 | Bacteria | 2449 |
| 212 | Ga0316584_0156634 | 3300036712 | Bacteria | 1693 |
| 213 | Ga0373925_0287994 | 3300037068 | Bacteria | 1324 |
| 214 | Ga0395900_0340203 | 3300037418 | Bacteria | 1476 |
| 215 | Ga0316581_0000782 | 3300037588 | Bacteria | 6570 |
| 216 | Ga0316581_0029635 | 3300037588 | Unclassified | 1645 |
| 217 | Ga0436364_0010042 | 3300037853 | Bacteria | 102214 |
| 218 | Ga0436364_0549528 | 3300037853 | Bacteria | 14336 |
| 219 | Ga0436364_0685371 | 3300037853 | Bacteria | 68284 |
| 220 | Ga0400483_017255 | 3300039062 | Bacteria | 9912 |
| 221 | Ga0400483_165172 | 3300039062 | Bacteria | 9498 |
| 222 | Ga0400483_183052 | 3300039062 | Bacteria | 3025 |
| 223 | Ga0400483_236881 | 3300039062 | Bacteria | 5331 |
| 224 | Ga0400483_265909 | 3300039062 | Bacteria | 8765 |
| 225 | Ga0436365_0167783 | 3300039437 | Bacteria | 30845 |
| 226 | Ga0436365_0536235 | 3300039437 | Bacteria | 9986 |
| 227 | Ga0436365_0693504 | 3300039437 | Bacteria | 82758 |
| 228 | Ga0436365_0831867 | 3300039437 | Bacteria | 2044 |
| 229 | Ga0436360_0064987 | 3300039438 | Bacteria | 2565 |
| 230 | Ga0436361_0301719 | 3300039447 | Bacteria | 1847 |
| 231 | Ga0436361_0340312 | 3300039447 | Bacteria | 4192 |
| 232 | Ga0436361_0349975 | 3300039447 | Bacteria | 2462 |
| 233 | Ga0436361_1209447 | 3300039447 | Bacteria | 1691 |
| 234 | Ga0436363_0573820 | 3300039450 | Bacteria | 8262 |
| 235 | Ga0436363_0715384 | 3300039450 | Bacteria | 10341 |
| 236 | Ga0436363_1484825 | 3300039450 | Bacteria | 1339 |
| 237 | Ga0436363_1547701 | 3300039450 | Bacteria | 8513 |
| 238 | Ga0436362_0969859 | 3300039453 | Bacteria | 3323 |
| 239 | Ga0439440_0023721 | 3300042993 | Unclassified | 1401 |
| 240 | Ga0453683_0054776 | 3300044673 | Bacteria | 2496 |
| 241 | Ga0453684_0001430 | 3300044712 | Bacteria | 68343 |
| 242 | Ga0453684_0040212 | 3300044712 | Bacteria | 6356 |
| 243 | Ga0453684_0056492 | 3300044712 | Bacteria | 5091 |
| 244 | Ga0453684_0059934 | 3300044712 | Bacteria | 4901 |
| 245 | Ga0453684_0340199 | 3300044712 | Bacteria | 1694 |
| 246 | Ga0466968_0002176 | 3300044735 | Bacteria | 7148 |
| 247 | Ga0466968_0005181 | 3300044735 | Bacteria | 4876 |
| 248 | Ga0466960_0037682 | 3300044901 | Bacteria | 2269 |
| 249 | Ga0451576_0000009 | 3300045051 | Bacteria | 712666 |
| 250 | Ga0451576_0002127 | 3300045051 | Bacteria | 30771 |
| 251 | Ga0451576_0558292 | 3300045051 | Bacteria | 1203 |
| 252 | Ga0466967_0188526 | 3300045976 | Bacteria | 1948 |
| 253 | Ga0495629_0012044 | 3300046459 | Bacteria | 6268 |
| 254 | Ga0495638_0003543 | 3300046460 | Bacteria | 12235 |
| 255 | Ga0495638_0054870 | 3300046460 | Bacteria | 2476 |
| 256 | Ga0495651_0003394 | 3300046462 | Bacteria | 12218 |
| 257 | Ga0495653_0004556 | 3300046463 | Bacteria | 11199 |
| 258 | Ga0495580_0072748 | 3300046472 | Bacteria | 2400 |
| 259 | Ga0495582_0047458 | 3300046473 | Bacteria | 2366 |
| 260 | Ga0495608_0002249 | 3300046511 | Bacteria | 13939 |
| 261 | Ga0495610_0013771 | 3300046512 | Bacteria | 4785 |
| 262 | Ga0495618_0001172 | 3300046514 | Bacteria | 17756 |
| 263 | Ga0495628_0034175 | 3300046516 | Bacteria | 4092 |
| 264 | Ga0495643_0092242 | 3300046522 | Bacteria | 1561 |
| 265 | Ga0495652_0004437 | 3300046529 | Bacteria | 13417 |
| 266 | Ga0495640_0005042 | 3300046533 | Bacteria | 10490 |
| 267 | Ga0495587_0021831 | 3300046536 | Bacteria | 3949 |
| 268 | Ga0495667_0044894 | 3300046559 | Bacteria | 2926 |
| 269 | Ga0495634_0007035 | 3300046642 | Bacteria | 8485 |
| 270 | Ga0495625_0038244 | 3300046660 | Bacteria | 3514 |
| 271 | Ga0495635_0005384 | 3300046663 | Bacteria | 8903 |
| 272 | Ga0495657_0025526 | 3300046675 | Bacteria | 4195 |
| 273 | Ga0495623_0011358 | 3300046679 | Bacteria | 5761 |
| 274 | Ga0495646_0006441 | 3300046680 | Bacteria | 7444 |
| 275 | Ga0495613_0091243 | 3300046689 | Bacteria | 2206 |
| 276 | Ga0495670_0022015 | 3300046691 | Bacteria | 3147 |
| 277 | Ga0495600_0001574 | 3300046809 | Bacteria | 12692 |
| 278 | Ga0495604_0000150 | 3300047317 | Bacteria | 60582 |
| 279 | Ga0495674_0040568 | 3300047319 | Bacteria | 4163 |
| 280 | Ga0495676_0016306 | 3300047321 | Bacteria | 6598 |
| 281 | Ga0495680_0000699 | 3300047322 | Bacteria | 37651 |
| 282 | Ga0495675_0007130 | 3300047444 | Bacteria | 6878 |
| 283 | Ga0495686_0069331 | 3300047472 | Bacteria | 2174 |
| 284 | Ga0496100_0249835 | 3300048903 | Bacteria | 1312 |
| 285 | Ga0496102_0039194 | 3300048905 | Bacteria | 4280 |
| 286 | Ga0496102_0199713 | 3300048905 | Bacteria | 1885 |
| 287 | Ga0496104_0001490 | 3300048907 | Bacteria | 20205 |
| 288 | Ga0496104_0003654 | 3300048907 | Bacteria | 13281 |
| 289 | Ga0496104_0006182 | 3300048907 | Bacteria | 10515 |
| 290 | Ga0496105_0002850 | 3300048908 | Bacteria | 12652 |
| 291 | Ga0496105_0003480 | 3300048908 | Bacteria | 11651 |
| 292 | Ga0496105_0051925 | 3300048908 | Bacteria | 3385 |
| 293 | Ga0496106_0011468 | 3300048909 | Bacteria | 6554 |
| 294 | Ga0496106_0206710 | 3300048909 | Bacteria | 1563 |
| 295 | Ga0496108_0003952 | 3300048911 | Bacteria | 11907 |
| 296 | Ga0496108_0005160 | 3300048911 | Bacteria | 10558 |
| 297 | Ga0496109_0003935 | 3300048912 | Bacteria | 12413 |
| 298 | Ga0496109_0004749 | 3300048912 | Bacteria | 11355 |
| 299 | Ga0496110_0000113 | 3300048913 | Bacteria | 44443 |
| 300 | Ga0496110_0017309 | 3300048913 | Bacteria | 6029 |
| 301 | Ga0496110_0035124 | 3300048913 | Bacteria | 4347 |
| 302 | Ga0496111_0000458 | 3300048914 | Bacteria | 20697 |
| 303 | Ga0496111_0000718 | 3300048914 | Bacteria | 17646 |
| 304 | Ga0496111_0020182 | 3300048914 | Bacteria | 4637 |
| 305 | Ga0496112_0019676 | 3300048915 | Bacteria | 6378 |
| 306 | Ga0496112_0098480 | 3300048915 | Bacteria | 2894 |
| 307 | Ga0496112_0301066 | 3300048915 | Bacteria | 1549 |
| 308 | Ga0496113_0002796 | 3300048916 | Bacteria | 10267 |
| 309 | Ga0496113_0014258 | 3300048916 | Bacteria | 5418 |
| 310 | Ga0496114_0016673 | 3300048917 | Bacteria | 5925 |
| 311 | Ga0496115_0014819 | 3300048918 | Bacteria | 5912 |
| 312 | Ga0496115_0042790 | 3300048918 | Bacteria | 3610 |
| 313 | Ga0496118_0055136 | 3300048921 | Bacteria | 3003 |
| 314 | Ga0496118_0111385 | 3300048921 | Bacteria | 1815 |
| 315 | Ga0496119_0001398 | 3300048922 | Bacteria | 29250 |
| 316 | Ga0496120_0001370 | 3300048923 | Bacteria | 29844 |
| 317 | Ga0496121_0070628 | 3300048924 | Bacteria | 2812 |
| 318 | Ga0496121_0115011 | 3300048924 | Bacteria | 2044 |
| 319 | Ga0496122_0001032 | 3300048925 | Bacteria | 48968 |
| 320 | Ga0496123_0000806 | 3300048926 | Bacteria | 50579 |
| 321 | Ga0496123_0051165 | 3300048926 | Bacteria | 2753 |
| 322 | Ga0496125_0104048 | 3300048928 | Bacteria | 2081 |
| 323 | Ga0501031_0005116 | 3300049568 | Bacteria | 8542 |
| 324 | Ga0501032_0000238 | 3300049569 | Bacteria | 45642 |
| 325 | Ga0501032_0017280 | 3300049569 | Bacteria | 5065 |
| 326 | Ga0501032_0073694 | 3300049569 | Bacteria | 2274 |
| 327 | Ga0501032_0081690 | 3300049569 | Bacteria | 2150 |
| 328 | Ga0501032_0086333 | 3300049569 | Bacteria | 2085 |
| 329 | Ga0501032_0142155 | 3300049569 | Bacteria | 1580 |
| 330 | Ga0501033_0016486 | 3300049570 | Bacteria | 5595 |
| 331 | Ga0501033_0023537 | 3300049570 | Bacteria | 4644 |
| 332 | Ga0501033_0120707 | 3300049570 | Bacteria | 1902 |
| 333 | Ga0501033_0185071 | 3300049570 | Bacteria | 1492 |
| 334 | Ga0501034_0002653 | 3300049571 | Bacteria | 21171 |
| 335 | Ga0501034_0004312 | 3300049571 | Bacteria | 15860 |
| 336 | Ga0501034_0014877 | 3300049571 | Bacteria | 8003 |
| 337 | Ga0501034_0020143 | 3300049571 | Bacteria | 6810 |
| 338 | Ga0501034_0030547 | 3300049571 | Bacteria | 5477 |
| 339 | Ga0501034_0032884 | 3300049571 | Bacteria | 5266 |
| 340 | Ga0501034_0049137 | 3300049571 | Bacteria | 4257 |
| 341 | Ga0501034_0083119 | 3300049571 | Bacteria | 3203 |
| 342 | Ga0501034_0097390 | 3300049571 | Bacteria | 2937 |
| 343 | Ga0501034_0391603 | 3300049571 | Bacteria | 1313 |
| 344 | Ga0501036_0001536 | 3300049572 | Bacteria | 17831 |
| 345 | Ga0501036_0003303 | 3300049572 | Bacteria | 12872 |
| 346 | Ga0501036_0058034 | 3300049572 | Bacteria | 3279 |
| 347 | Ga0501036_0107592 | 3300049572 | Bacteria | 2357 |
| 348 | Ga0501036_0129714 | 3300049572 | Bacteria | 2129 |
| 349 | Ga0501036_0143885 | 3300049572 | Bacteria | 2011 |
| 350 | Ga0501037_0039910 | 3300049573 | Bacteria | 3454 |
| 351 | Ga0501037_0043039 | 3300049573 | Bacteria | 3319 |
| 352 | Ga0501037_0160884 | 3300049573 | Bacteria | 1600 |
| 353 | Ga0501037_0188373 | 3300049573 | Bacteria | 1461 |
| 354 | Ga0501038_0009911 | 3300049574 | Bacteria | 8723 |
| 355 | Ga0501038_0019076 | 3300049574 | Bacteria | 6184 |
| 356 | Ga0501038_0035281 | 3300049574 | Bacteria | 4391 |
| 357 | Ga0501038_0076939 | 3300049574 | Bacteria | 2818 |
| 358 | Ga0501038_0079017 | 3300049574 | Bacteria | 2775 |
| 359 | Ga0501038_0095692 | 3300049574 | Bacteria | 2480 |
| 360 | Ga0501039_0024279 | 3300049575 | Bacteria | 4655 |
| 361 | Ga0501039_0039572 | 3300049575 | Bacteria | 3641 |
| 362 | Ga0501039_0143449 | 3300049575 | Bacteria | 1876 |
| 363 | Ga0501039_0162768 | 3300049575 | Bacteria | 1754 |
| 364 | Ga0501039_0163233 | 3300049575 | Bacteria | 1751 |
| 365 | Ga0501040_0013655 | 3300049576 | Bacteria | 5341 |
| 366 | Ga0501040_0027140 | 3300049576 | Bacteria | 3854 |
| 367 | Ga0501040_0041823 | 3300049576 | Bacteria | 3122 |
| 368 | Ga0501040_0209081 | 3300049576 | Bacteria | 1387 |
| 369 | Ga0501041_0031061 | 3300049577 | Bacteria | 3225 |
| 370 | Ga0501041_0078819 | 3300049577 | Bacteria | 2027 |
| 371 | Ga0501041_0103783 | 3300049577 | Bacteria | 1761 |
| 372 | Ga0501042_0007935 | 3300049578 | Bacteria | 6982 |
| 373 | Ga0501042_0010639 | 3300049578 | Bacteria | 6180 |
| 374 | Ga0501042_0199105 | 3300049578 | Bacteria | 1444 |
| 375 | Ga0501043_0000736 | 3300049579 | Bacteria | 29004 |
| 376 | Ga0501043_0010338 | 3300049579 | Bacteria | 7316 |
| 377 | Ga0501043_0105872 | 3300049579 | Bacteria | 2209 |
| 378 | Ga0501043_0180562 | 3300049579 | Bacteria | 1644 |
| 379 | Ga0501043_0196328 | 3300049579 | Bacteria | 1567 |
| 380 | Ga0501046_0007945 | 3300049580 | Bacteria | 9282 |
| 381 | Ga0501046_0030399 | 3300049580 | Bacteria | 4383 |
| 382 | Ga0501046_0074525 | 3300049580 | Bacteria | 2633 |
| 383 | Ga0501046_0116631 | 3300049580 | Bacteria | 2035 |
| 384 | Ga0501047_0000124 | 3300049581 | Bacteria | 94721 |
| 385 | Ga0501047_0012748 | 3300049581 | Bacteria | 7964 |
| 386 | Ga0501047_0029328 | 3300049581 | Bacteria | 5307 |
| 387 | Ga0501047_0043610 | 3300049581 | Bacteria | 4333 |
| 388 | Ga0501047_0096714 | 3300049581 | Bacteria | 2831 |
| 389 | Ga0501047_0141056 | 3300049581 | Bacteria | 2288 |
| 390 | Ga0501047_0180580 | 3300049581 | Bacteria | 1977 |
| 391 | Ga0501047_0199073 | 3300049581 | Bacteria | 1864 |
| 392 | Ga0501047_0202112 | 3300049581 | Bacteria | 1848 |
| 393 | Ga0501047_0223703 | 3300049581 | Bacteria | 1737 |
| 394 | Ga0501048_0008611 | 3300049582 | Bacteria | 7703 |
| 395 | Ga0501048_0115145 | 3300049582 | Bacteria | 1899 |
| 396 | Ga0501067_0001307 | 3300049583 | Bacteria | 13493 |
| 397 | Ga0501067_0004048 | 3300049583 | Bacteria | 8083 |
| 398 | Ga0501067_0045980 | 3300049583 | Bacteria | 2423 |
| 399 | Ga0501067_0062591 | 3300049583 | Bacteria | 2060 |
| 400 | Ga0501068_0008727 | 3300049584 | Bacteria | 5652 |
| 401 | Ga0501068_0020629 | 3300049584 | Bacteria | 3841 |
| 402 | Ga0501068_0036089 | 3300049584 | Bacteria | 2954 |
| 403 | Ga0501068_0063858 | 3300049584 | Bacteria | 2240 |
| 404 | Ga0501068_0071661 | 3300049584 | Bacteria | 2115 |
| 405 | Ga0501069_0075408 | 3300049585 | Bacteria | 1894 |
| 406 | Ga0501069_0115901 | 3300049585 | Bacteria | 1528 |
| 407 | Ga0501070_0000229 | 3300049586 | Bacteria | 52795 |
| 408 | Ga0501070_0005227 | 3300049586 | Bacteria | 11067 |
| 409 | Ga0501070_0010861 | 3300049586 | Bacteria | 7692 |
| 410 | Ga0501070_0041971 | 3300049586 | Bacteria | 3809 |
| 411 | Ga0501070_0050657 | 3300049586 | Bacteria | 3446 |
| 412 | Ga0501070_0078669 | 3300049586 | Bacteria | 2729 |
| 413 | Ga0501070_0155796 | 3300049586 | Bacteria | 1884 |
| 414 | Ga0501071_0011715 | 3300049587 | Bacteria | 5918 |
| 415 | Ga0501071_0012733 | 3300049587 | Bacteria | 5719 |
| 416 | Ga0501071_0220436 | 3300049587 | Bacteria | 1427 |
| 417 | Ga0501071_0250773 | 3300049587 | Bacteria | 1336 |
| 418 | Ga0501072_0002828 | 3300049588 | Bacteria | 13022 |
| 419 | Ga0501072_0009532 | 3300049588 | Bacteria | 7385 |
| 420 | Ga0501072_0085666 | 3300049588 | Bacteria | 2500 |
| 421 | Ga0501073_0009708 | 3300049589 | Bacteria | 7090 |
| 422 | Ga0501073_0010790 | 3300049589 | Bacteria | 6689 |
| 423 | Ga0501073_0017780 | 3300049589 | Bacteria | 5146 |
| 424 | Ga0501073_0021727 | 3300049589 | Bacteria | 4623 |
| 425 | Ga0501073_0041756 | 3300049589 | Bacteria | 3240 |
| 426 | Ga0501073_0069535 | 3300049589 | Bacteria | 2453 |
| 427 | Ga0501073_0077738 | 3300049589 | Bacteria | 2309 |
| 428 | Ga0501073_0129309 | 3300049589 | Bacteria | 1750 |
| 429 | Ga0501074_0023598 | 3300049590 | Bacteria | 4471 |
| 430 | Ga0501074_0028354 | 3300049590 | Bacteria | 4058 |
| 431 | Ga0501074_0119904 | 3300049590 | Bacteria | 1881 |
| 432 | Ga0501074_0160520 | 3300049590 | Bacteria | 1605 |
| 433 | Ga0501075_0005275 | 3300049591 | Bacteria | 8833 |
| 434 | Ga0501075_0114962 | 3300049591 | Bacteria | 2046 |
| 435 | Ga0501076_0006327 | 3300049592 | Bacteria | 8581 |
| 436 | Ga0501076_0025489 | 3300049592 | Bacteria | 4575 |
| 437 | Ga0501076_0093490 | 3300049592 | Bacteria | 2420 |
| 438 | Ga0501077_0098593 | 3300049593 | Bacteria | 1852 |
| 439 | Ga0501079_0016277 | 3300049741 | Bacteria | 5682 |
| 440 | Ga0501079_0035052 | 3300049741 | Bacteria | 3861 |
| 441 | Ga0501079_0042222 | 3300049741 | Bacteria | 3522 |
| 442 | Ga0501079_0065430 | 3300049741 | Bacteria | 2804 |
| 443 | Ga0501080_0000130 | 3300049742 | Bacteria | 53465 |
| 444 | Ga0501080_0007746 | 3300049742 | Bacteria | 9710 |
| 445 | Ga0501080_0016328 | 3300049742 | Bacteria | 6855 |
| 446 | Ga0501080_0024231 | 3300049742 | Bacteria | 5626 |
| 447 | Ga0501080_0027681 | 3300049742 | Bacteria | 5270 |
| 448 | Ga0501080_0043335 | 3300049742 | Bacteria | 4190 |
| 449 | Ga0501080_0089934 | 3300049742 | Bacteria | 2852 |
| 450 | Ga0501080_0103359 | 3300049742 | Bacteria | 2642 |
| 451 | Ga0501080_0110525 | 3300049742 | Bacteria | 2547 |
| 452 | Ga0501080_0149062 | 3300049742 | Bacteria | 2163 |
| 453 | Ga0501080_0367428 | 3300049742 | Bacteria | 1297 |
| 454 | Ga0501081_0003672 | 3300049743 | Bacteria | 9825 |
| 455 | Ga0501081_0103416 | 3300049743 | Bacteria | 2015 |
| 456 | Ga0501083_0000480 | 3300049744 | Bacteria | 25565 |
| 457 | Ga0501083_0011760 | 3300049744 | Bacteria | 6135 |
| 458 | Ga0501083_0011873 | 3300049744 | Bacteria | 6103 |
| 459 | Ga0501083_0013234 | 3300049744 | Bacteria | 5766 |
| 460 | Ga0501083_0077118 | 3300049744 | Bacteria | 2212 |
| 461 | Ga0501083_0083711 | 3300049744 | Bacteria | 2113 |
| 462 | Ga0501083_0087651 | 3300049744 | Bacteria | 2058 |
| 463 | Ga0501035_0000373 | 3300049822 | Bacteria | 51518 |
| 464 | Ga0501035_0004040 | 3300049822 | Bacteria | 13976 |
| 465 | Ga0501035_0164738 | 3300049822 | Bacteria | 1917 |
| 466 | Ga0501035_0180185 | 3300049822 | Bacteria | 1820 |
| 467 | Ga0501035_0210966 | 3300049822 | Bacteria | 1661 |
| 468 | Ga0501044_0023125 | 3300049823 | Bacteria | 6616 |
| 469 | Ga0501044_0039770 | 3300049823 | Bacteria | 4904 |
| 470 | Ga0501044_0060321 | 3300049823 | Bacteria | 3884 |
| 471 | Ga0501044_0075405 | 3300049823 | Bacteria | 3424 |
| 472 | Ga0501044_0135969 | 3300049823 | Bacteria | 2449 |
| 473 | Ga0501044_0185250 | 3300049823 | Bacteria | 2047 |
| 474 | Ga0501044_0228418 | 3300049823 | Bacteria | 1809 |
| 475 | Ga0501045_0011533 | 3300049824 | Bacteria | 6207 |
| 476 | Ga0501045_0104871 | 3300049824 | Bacteria | 2094 |
| 477 | Ga0501045_0178045 | 3300049824 | Bacteria | 1584 |
| 478 | nmdc:mga03n38_33757_c1 | 3300050490 | Bacteria | 2180 |
| 479 | nmdc:mga06z11_35768_c1 | 3300050494 | Bacteria | 2447 |
| 480 | nmdc:mga04h51_971_c1 | 3300050495 | Bacteria | 6630 |
| 481 | nmdc:mga07m45_37653_c1 | 3300050496 | Bacteria | 2698 |
| 482 | nmdc:mga05p37_156440_c1 | 3300050507 | Bacteria | 2785 |
| 483 | nmdc:mga05p37_182147_c1 | 3300050507 | Bacteria | 2555 |
| 484 | nmdc:mga05p37_313720_c1 | 3300050507 | Bacteria | 1858 |
| 485 | nmdc:mga05p37_82638_c1 | 3300050507 | Bacteria | 3958 |
| 486 | nmdc:mga09592_29249_c1 | 3300050508 | Bacteria | 4582 |
| 487 | nmdc:mga0qj67_35336_c1 | 3300050509 | Bacteria | 3907 |
| 488 | nmdc:mga0qj67_7547_c1 | 3300050509 | Bacteria | 8036 |
| 489 | nmdc:mga06r32_1985_c1 | 3300050510 | Bacteria | 18277 |
| 490 | nmdc:mga06r32_52676_c1 | 3300050510 | Bacteria | 3898 |
| 491 | nmdc:mga06r32_55613_c1 | 3300050510 | Bacteria | 3796 |
| 492 | nmdc:mga06r32_86904_c1 | 3300050510 | Bacteria | 3050 |
| 493 | nmdc:mga08y16_20054_c1 | 3300050511 | Bacteria | 7053 |
| 494 | nmdc:mga08x19_167701_c1 | 3300050514 | Bacteria | 1494 |
| 495 | nmdc:mga0a205_88269_c1 | 3300050515 | Bacteria | 2997 |
| 496 | Ga0495612_0010743 | 3300053078 | Bacteria | 3697 |
| 497 | Ga0495595_0000221 | 3300053084 | Bacteria | 22745 |
| 498 | Ga0500651_0118691 | 3300053093 | Bacteria | 1608 |
| 499 | Ga0500651_0144565 | 3300053093 | Bacteria | 1431 |
| 500 | Ga0500555_002895 | 3300053103 | Bacteria | 4914 |
| 501 | Ga0500556_0000068 | 3300053104 | Bacteria | 103123 |
| 502 | Ga0500658_0078164 | 3300053134 | Bacteria | 1410 |
| 503 | Ga0500568_0000177 | 3300053139 | Bacteria | 55762 |
| 504 | Ga0500568_0044613 | 3300053139 | Bacteria | 1767 |
| 505 | Ga0500604_0009366 | 3300053151 | Bacteria | 2609 |
| 506 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 507 | Ga0500620_000267 | 3300053155 | Bacteria | 10143 |
| 508 | Ga0500620_001565 | 3300053155 | Bacteria | 4290 |
| 509 | Ga0500645_000051 | 3300053730 | Bacteria | 98521 |
| 510 | Ga0501084_0009054 | 3300054114 | Bacteria | 8236 |
| 511 | Ga0501084_0010394 | 3300054114 | Bacteria | 7695 |
| 512 | Ga0501084_0012288 | 3300054114 | Bacteria | 7091 |
| 513 | Ga0501084_0019577 | 3300054114 | Bacteria | 5640 |
| 514 | Ga0501084_0024425 | 3300054114 | Bacteria | 5042 |
| 515 | Ga0501084_0072722 | 3300054114 | Bacteria | 2880 |
| 516 | Ga0501084_0130091 | 3300054114 | Bacteria | 2119 |
| 517 | Ga0501082_0000046 | 3300060353 | Bacteria | 86307 |
| 518 | Ga0501082_0006510 | 3300060353 | Bacteria | 10128 |
| 519 | Ga0501082_0015911 | 3300060353 | Bacteria | 6470 |
| 520 | Ga0501082_0055241 | 3300060353 | Bacteria | 3421 |
| 521 | Ga0501082_0096097 | 3300060353 | Bacteria | 2561 |
| 522 | Ga0530510_0073466 | 3300061734 | Bacteria | 2482 |
| 523 | 2503199982 | 2503198000 | Bacteria | 6884444 |
| 524 | 2509118504 | 2508501123 | Bacteria | 6283661 |
| 525 | 2509142568 | 2508501127 | Bacteria | 7037543 |
| 526 | 2510319275 | 2510065059 | Bacteria | 6847884 |
| 527 | 2511390315 | 2511231027 | Bacteria | 5013807 |
| 528 | 2512932550 | 2512875016 | Bacteria | 6529530 |
| 529 | 2512960567 | 2512875024 | Bacteria | 7195110 |
| 530 | 2513608662 | 2513237090 | Bacteria | 7096802 |
| 531 | 2514036343 | 2513237164 | Bacteria | 7563725 |
| 532 | 2514416476 | 2513237305 | Bacteria | 7293571 |
| 533 | 2514587561 | 2513237351 | Bacteria | 6968952 |
| 534 | 2545674357 | 2545555834 | Bacteria | 8130841 |
| 535 | 2596377279 | 2595698237 | Bacteria | 6712432 |
| 536 | 2599936418 | 2599185301 | Bacteria | 6161860 |
| 537 | 2643758839 | 2643221547 | Bacteria | 4740017 |
| 538 | 2643774394 | 2643221550 | Bacteria | 4619371 |
| 539 | 2643776549 | 2643221551 | Bacteria | 3750538 |
| 540 | 2643794996 | 2643221555 | Bacteria | 3749717 |
| 541 | 2643839080 | 2643221564 | Bacteria | 4193379 |
| 542 | 2643984857 | 2643221595 | Bacteria | 6565519 |
| 543 | 2644133233 | 2643221623 | Bacteria | 5239945 |
| 544 | 2644153187 | 2643221627 | Bacteria | 6761570 |
| 545 | 2688597228 | 2687453392 | Bacteria | 6880454 |
| 546 | 2694628708 | 2693429783 | Bacteria | 7019804 |
| 547 | 2694637378 | 2693429784 | Bacteria | 7241525 |
| 548 | 2723574432 | 2721755686 | Bacteria | 7343952 |
| 549 | 2739307505 | 2738543024 | Bacteria | 5603683 |
| 550 | 2756671519 | 2756170246 | Bacteria | 7451806 |
| 551 | 2765466365 | 2765235802 | Bacteria | 5618596 |
| 552 | 2770198996 | 2767802442 | Bacteria | 5747986 |
| 553 | 2776285006 | 2775506904 | Bacteria | 5954060 |
| 554 | 2792747984 | 2791355123 | Bacteria | 8049106 |
| 555 | 2828308625 | 2828305725 | Bacteria | 4916900 |
| 556 | 2837654175 | 2837651117 | Bacteria | 3772164 |
| 557 | 2839998288 | 2839993093 | Bacteria | 5512535 |
| 558 | 2840769124 | 2840764183 | Bacteria | 6358399 |
| 559 | 2842696661 | 2842694124 | Bacteria | 4063419 |
| 560 | 2842872285 | 2842871566 | Bacteria | 4827117 |
| 561 | 2844008570 | 2844002411 | Bacteria | 7168230 |
| 562 | 2844012609 | 2844009547 | Bacteria | 6728125 |
| 563 | 2847675025 | 2847670302 | Bacteria | 6165597 |
| 564 | 2856320743 | 2856314179 | Bacteria | 6477897 |
| 565 | 2856323089 | 2856320880 | Bacteria | 7263508 |
| 566 | 2856334849 | 2856328259 | Bacteria | 6528202 |
| 567 | 2856341600 | 2856334872 | Bacteria | 7037011 |
| 568 | 2856347358 | 2856342000 | Bacteria | 7176905 |
| 569 | 2856354141 | 2856349417 | Bacteria | 6230045 |
| 570 | 2856360380 | 2856356410 | Bacteria | 6297484 |
| 571 | 2856368050 | 2856364286 | Bacteria | 6939991 |
| 572 | 2857351802 | 2857349434 | Bacteria | 7926032 |
| 573 | 2857373939 | 2857367948 | Bacteria | 6965560 |
| 574 | 2861696691 | 2861691609 | Bacteria | 5628931 |
| 575 | 2869163818 | 2869162929 | Bacteria | 6399702 |
| 576 | 2869172420 | 2869169390 | Bacteria | 6659796 |
| 577 | 2869237045 | 2869234852 | Bacteria | 6654993 |
| 578 | 2869246822 | 2869242130 | Bacteria | 6609239 |
| 579 | 2869251577 | 2869249662 | Bacteria | 6868783 |
| 580 | 2869260114 | 2869256925 | Bacteria | 6981691 |
| 581 | 2869271085 | 2869264136 | Bacteria | 6880765 |
| 582 | 2869277757 | 2869271264 | Bacteria | 6908218 |
| 583 | 2869282640 | 2869278585 | Bacteria | 7077053 |
| 584 | 2869290331 | 2869285874 | Bacteria | 6901219 |
| 585 | 2870789699 | 2870782633 | Bacteria | 9624083 |
| 586 | 2871432615 | 2871429161 | Bacteria | 6547891 |
| 587 | 2871436934 | 2871435913 | Bacteria | 6880295 |
| 588 | 2871444624 | 2871444079 | Bacteria | 6423508 |
| 589 | 2871453800 | 2871451962 | Bacteria | 7336357 |
| 590 | 2871461225 | 2871459585 | Bacteria | 6866887 |
| 591 | 2871469073 | 2871466892 | Bacteria | 6923287 |
| 592 | 2871483824 | 2871481445 | Bacteria | 6700002 |
| 593 | 2871493233 | 2871488783 | Bacteria | 6929816 |
| 594 | 2871496790 | 2871495908 | Bacteria | 6935695 |
| 595 | 2874109129 | 2874102143 | Bacteria | 6342645 |
| 596 | 2874116412 | 2874109183 | Bacteria | 6517025 |
| 597 | 2874122773 | 2874116593 | Bacteria | 6674494 |
| 598 | 2874124074 | 2874123672 | Bacteria | 7238285 |
| 599 | 2874134519 | 2874131515 | Bacteria | 6820270 |
| 600 | 2874142297 | 2874139085 | Bacteria | 7021506 |
| 601 | 2874152582 | 2874146452 | Bacteria | 7533118 |
| 602 | 2874159982 | 2874155637 | Bacteria | 6724144 |
| 603 | 2874167973 | 2874162495 | Bacteria | 6174670 |
| 604 | 2874174800 | 2874168670 | Bacteria | 8062617 |
| 605 | 2876365198 | 2876363079 | Bacteria | 6544991 |
| 606 | 2876375753 | 2876369609 | Bacteria | 6807521 |
| 607 | 2876385897 | 2876377896 | Bacteria | 6565995 |
| 608 | 2876387921 | 2876386047 | Bacteria | 6698674 |
| 609 | 2876398010 | 2876392853 | Bacteria | 6660880 |
| 610 | 2876402844 | 2876399893 | Bacteria | 6927900 |
| 611 | 2876410510 | 2876406927 | Bacteria | 6191900 |
| 612 | 2876418498 | 2876413966 | Bacteria | 6831344 |
| 613 | 2876422971 | 2876420981 | Bacteria | 6687741 |
| 614 | 2878035923 | 2878035449 | Bacteria | 6555736 |
| 615 | 2878734848 | 2878730984 | Bacteria | 6380721 |
| 616 | 2878744520 | 2878738818 | Bacteria | 7136951 |
| 617 | 2878750229 | 2878745973 | Bacteria | 6867388 |
| 618 | 2878757278 | 2878753008 | Bacteria | 6922523 |
| 619 | 2878761014 | 2878760144 | Bacteria | 6823465 |
| 620 | 2878767978 | 2878767105 | Bacteria | 6898628 |
| 621 | 2878774962 | 2878774303 | Bacteria | 6108671 |
| 622 | 2878784356 | 2878781027 | Bacteria | 6834456 |
| 623 | 2881149908 | 2881147464 | Bacteria | 7779814 |
| 624 | 2881161054 | 2881155292 | Bacteria | 6461656 |
| 625 | 2881166789 | 2881161766 | Bacteria | 7127907 |
| 626 | 2881857993 | 2881853255 | Bacteria | 6698367 |
| 627 | 2882632549 | 2882632389 | Bacteria | 8154593 |
| 628 | 2882916298 | 2882912400 | Bacteria | 6801539 |
| 629 | 2885308305 | 2885305155 | Bacteria | 7348390 |
| 630 | 2885312902 | 2885312484 | Bacteria | 6415165 |
| 631 | 2885320514 | 2885318864 | Bacteria | 6729568 |
| 632 | 2885330830 | 2885326080 | Bacteria | 7134805 |
| 633 | 2885342487 | 2885334103 | Bacteria | 7216818 |
| 634 | 2885345263 | 2885342637 | Bacteria | 7011821 |
| 635 | 2885357264 | 2885350715 | Bacteria | 6787678 |
| 636 | 2888338309 | 2888337043 | Bacteria | 6629336 |
| 637 | 2888345914 | 2888343758 | Bacteria | 6611049 |
| 638 | 2888355146 | 2888350351 | Bacteria | 7372807 |
| 639 | 2889010125 | 2889010040 | Bacteria | 6749192 |
| 640 | 2889018204 | 2889016732 | Bacteria | 6700763 |
| 641 | 2889308443 | 2889306138 | Bacteria | 6358934 |
| 642 | 2889792912 | 2889790730 | Bacteria | 5689708 |
| 643 | 2889919072 | 2889914905 | Bacteria | 5702301 |
| 644 | 2894655591 | 2894652903 | Bacteria | 4587256 |
| 645 | 2902335163 | 2902330777 | Bacteria | 6395352 |
| 646 | 2902410619 | 2902405164 | Bacteria | 6784948 |
| 647 | 2903450198 | 2903448605 | Bacteria | 7357801 |
| 648 | 2903501005 | 2903492973 | Bacteria | 13473544 |
| 649 | 2903504447 | 2903492973 | Bacteria | 13473544 |
| 650 | 2903518628 | 2903513507 | Bacteria | 6344008 |
| 651 | 2903522067 | 2903521522 | Bacteria | 6525694 |
| 652 | 2903528445 | 2903528002 | Bacteria | 6586099 |
| 653 | 2903541586 | 2903540706 | Bacteria | 7062119 |
| 654 | 2904582248 | 2904578770 | Bacteria | 5302906 |
| 655 | 2904664661 | 2904659560 | Bacteria | 6685615 |
| 656 | 2906312587 | 2906308376 | Bacteria | 6841989 |
| 657 | 2906325296 | 2906321335 | Bacteria | 6579571 |
| 658 | 2906330694 | 2906328253 | Bacteria | 6585166 |
| 659 | 2906369646 | 2906363423 | Bacteria | 6856682 |
| 660 | 2906376953 | 2906370794 | Bacteria | 6881062 |
| 661 | 2906383587 | 2906378014 | Bacteria | 6911440 |
| 662 | 2906388710 | 2906386501 | Bacteria | 5977019 |
| 663 | 2906403226 | 2906401398 | Bacteria | 6693206 |
| 664 | 2906411340 | 2906408224 | Bacteria | 6162342 |
| 665 | 2906419808 | 2906414383 | Bacteria | 6580790 |
| 666 | 2906430842 | 2906427513 | Bacteria | 6375796 |
| 667 | 2909046428 | 2909042592 | Bacteria | 6499737 |
| 668 | 2919122971 | 2919119836 | Bacteria | 5208557 |
| 669 | 2919452288 | 2919450847 | Bacteria | 5631160 |
| 670 | 2922134240 | 2922130491 | Bacteria | 7173936 |
| 671 | 2922155911 | 2922151315 | Bacteria | 6902399 |
| 672 | 2922158895 | 2922158528 | Bacteria | 6573167 |
| 673 | 2922177608 | 2922172374 | Bacteria | 6167644 |
| 674 | 2922181258 | 2922178524 | Bacteria | 6025201 |
| 675 | 2922190392 | 2922185730 | Bacteria | 7113964 |
| 676 | 2924711180 | 2924710171 | Bacteria | 6752351 |
| 677 | 2924722799 | 2924718760 | Bacteria | 6331356 |
| 678 | 2924731691 | 2924726620 | Bacteria | 6271473 |
| 679 | 2924737891 | 2924733363 | Bacteria | 7574837 |
| 680 | 2924747568 | 2924741084 | Bacteria | 6661321 |
| 681 | 2924749714 | 2924748358 | Bacteria | 6154725 |
| 682 | 2924768129 | 2924762789 | Bacteria | 6561353 |
| 683 | 2924782550 | 2924776078 | Bacteria | 7492003 |
| 684 | 2924786583 | 2924784321 | Bacteria | 7416538 |
| 685 | 2928130730 | 2928125067 | Bacteria | 5937560 |
| 686 | 2928524209 | 2928521798 | Bacteria | 4960112 |
| 687 | 2937819268 | 2937813078 | Bacteria | 7783518 |
| 688 | 2937842627 | 2937836603 | Bacteria | 6811263 |
| 689 | 2937848381 | 2937843397 | Bacteria | 5256375 |
| 690 | 2937852014 | 2937848649 | Bacteria | 6983481 |
| 691 | 2937862674 | 2937861824 | Bacteria | 6660327 |
| 692 | 2937874647 | 2937868953 | Bacteria | 6639878 |
| 693 | 2937881192 | 2937877337 | Bacteria | 7246526 |
| 694 | 2937977283 | 2937972304 | Bacteria | 7532020 |
| 695 | 2937995443 | 2937994558 | Bacteria | 7036190 |
| 696 | 2938021119 | 2938014810 | Bacteria | 6700592 |
| 697 | 2954013157 | 2954011201 | Bacteria | 4762601 |
| 698 | 2958039423 | 2958034702 | Bacteria | 6989922 |
| 699 | 2958052948 | 2958041894 | Bacteria | 13082850 |
| 700 | 2958064931 | 2958064165 | Bacteria | 7158582 |
| 701 | 2958073774 | 2958071322 | Bacteria | 6815895 |
| 702 | 2958088251 | 2958084443 | Bacteria | 7312792 |
| 703 | 2958096770 | 2958092219 | Bacteria | 6861151 |
| 704 | 2958102165 | 2958100919 | Bacteria | 6800575 |
| 705 | 2958109805 | 2958108152 | Bacteria | 6681128 |
| 706 | 2958115502 | 2958115193 | Bacteria | 6923548 |
| 707 | 2958129807 | 2958122699 | Bacteria | 7280457 |
| 708 | 2958134719 | 2958130278 | Bacteria | 6897202 |
| 709 | 2958138847 | 2958137437 | Bacteria | 6050276 |
| 710 | 2958147687 | 2958144490 | Bacteria | 6677056 |
| 711 | 2958158856 | 2958158011 | Bacteria | 6058449 |
| 712 | 2958165916 | 2958165035 | Bacteria | 6906348 |
| 713 | 2958175237 | 2958172287 | Bacteria | 6716688 |
| 714 | 2958186526 | 2958179912 | Bacteria | 6874908 |
| 715 | 2961085025 | 2961077736 | Bacteria | 7079850 |
| 716 | 2961119659 | 2961114664 | Bacteria | 6680456 |
| 717 | 2961133876 | 2961127735 | Bacteria | 7196641 |
| 718 | 2961139811 | 2961136820 | Bacteria | 6775228 |
| 719 | 2961164379 | 2961163497 | Bacteria | 6901077 |
| 720 | 2961175393 | 2961170736 | Bacteria | 7072258 |
| 721 | 2961184383 | 2961183825 | Bacteria | 6688536 |
| 722 | 2963646653 | 2963644680 | Bacteria | 6530403 |
| 723 | 2965019365 | 2965018300 | Bacteria | 6883036 |
| 724 | 2965027604 | 2965025482 | Bacteria | 6532201 |
| 725 | 2965036274 | 2965032056 | Bacteria | 6887443 |
| 726 | 2965043313 | 2965040258 | Bacteria | 6855979 |
| 727 | 2965051529 | 2965047637 | Bacteria | 6623551 |
| 728 | 2965093495 | 2965089291 | Bacteria | 6866420 |
| 729 | 2965116048 | 2965110997 | Bacteria | 6693150 |
| 730 | 2965126585 | 2965119406 | Bacteria | 6956431 |
| 731 | 2967999605 | 2967996073 | Bacteria | 6787468 |
| 732 | 2968007963 | 2968003550 | Bacteria | 6929263 |
| 733 | 2968020750 | 2968016561 | Bacteria | 7022047 |
| 734 | 2968090554 | 2968083720 | Bacteria | 7351627 |
| 735 | 2968094760 | 2968091066 | Bacteria | 6052692 |
| 736 | 2968099329 | 2968097103 | Bacteria | 6107094 |
| 737 | 2968115914 | 2968110612 | Bacteria | 6814636 |
| 738 | 2968119299 | 2968117919 | Bacteria | 6536078 |
| 739 | 2968133670 | 2968128360 | Bacteria | 6270294 |
| 740 | 2968146532 | 2968138860 | Bacteria | 6605449 |
| 741 | 2968172780 | 2968171901 | Bacteria | 6894245 |
| 742 | 2970474047 | 2970469710 | Bacteria | 6969209 |
| 743 | 2970490687 | 2970489779 | Bacteria | 6517260 |
| 744 | 2970507981 | 2970503327 | Bacteria | 7099517 |
| 745 | 2970515314 | 2970510686 | Bacteria | 7006402 |
| 746 | 2970527367 | 2970524798 | Bacteria | 6840927 |
| 747 | 2970534292 | 2970532167 | Bacteria | 6553173 |
| 748 | 2970552305 | 2970547951 | Bacteria | 6931819 |
| 749 | 2970555872 | 2970554993 | Bacteria | 6814252 |
| 750 | 2970597249 | 2970593180 | Bacteria | 7073582 |
| 751 | 2970622761 | 2970619444 | Bacteria | 6986144 |
| 752 | 2970632723 | 2970627176 | Bacteria | 6680862 |
| 753 | 2977826437 | 2977821940 | Bacteria | 6906439 |
| 754 | 2977832671 | 2977828996 | Bacteria | 7007971 |
| 755 | 2977848375 | 2977843712 | Bacteria | 6753583 |
| 756 | 2977855579 | 2977851361 | Bacteria | 6694324 |
| 757 | 2977860920 | 2977858184 | Bacteria | 6215359 |
| 758 | 2977865158 | 2977864932 | Bacteria | 7534097 |
| 759 | 2977880121 | 2977872689 | Bacteria | 7270173 |
| 760 | 2977899141 | 2977898635 | Bacteria | 6675551 |
| 761 | 2977910146 | 2977907340 | Bacteria | 6577984 |
| 762 | 2977918109 | 2977915119 | Bacteria | 6829656 |
| 763 | 2977922971 | 2977922695 | Bacteria | 6956781 |
| 764 | 2977940314 | 2977935797 | Bacteria | 6252826 |
| 765 | 2977944747 | 2977942078 | Bacteria | 7570577 |
| 766 | 2977953129 | 2977950692 | Bacteria | 6893264 |
| 767 | 2977962313 | 2977957713 | Bacteria | 6877875 |
| 768 | 2977976051 | 2977971508 | Bacteria | 7472917 |
| 769 | 2977990136 | 2977986579 | Bacteria | 6581278 |
| 770 | 2979715116 | 2979710463 | Bacteria | 6785254 |
| 771 | 2979749048 | 2979742915 | Bacteria | 7301278 |
| 772 | 2979766347 | 2979764755 | Bacteria | 6610066 |
| 773 | 2979776139 | 2979772303 | Bacteria | 6618277 |
| 774 | 2979785309 | 2979779861 | Bacteria | 6219781 |
| 775 | 2979813165 | 2979808191 | Bacteria | 7179355 |
| 776 | 2987638986 | 2987636660 | Bacteria | 8088555 |
| 777 | 2987647979 | 2987645492 | Bacteria | 6117018 |
| 778 | 2987653665 | 2987652177 | Bacteria | 6969023 |
| 779 | 2987660383 | 2987659509 | Bacteria | 6966464 |
| 780 | 2987671449 | 2987666974 | Bacteria | 6509233 |
| 781 | 2987675405 | 2987673487 | Bacteria | 6884027 |
| 782 | 2996312096 | 2996310559 | Bacteria | 6357320 |
| 783 | 2996338721 | 2996336353 | Bacteria | 5511628 |
| 784 | 2996344256 | 2996341866 | Bacteria | 6643098 |
| 785 | 2996352633 | 2996348954 | Bacteria | 7239054 |
| 786 | 2996390013 | 2996386984 | Bacteria | 6978667 |
| 787 | 3000139616 | 3000135777 | Bacteria | 6891109 |
| 788 | 3002145117 | 3002141150 | Bacteria | 5254435 |
| 789 | 3003667394 | 3003665799 | Bacteria | 7279786 |
| 790 | 3004167645 | 3004167301 | Bacteria | 8330599 |
| 791 | 3004189434 | 3004188549 | Bacteria | 6952365 |
| 792 | 3004199810 | 3004195979 | Bacteria | 6776956 |
| 793 | 3004204771 | 3004203850 | Bacteria | 7307914 |
| 794 | 3004218048 | 3004211236 | Bacteria | 7417683 |
| 795 | 3004220905 | 3004218560 | Bacteria | 7421728 |
| 796 | 3004235701 | 3004232784 | Bacteria | 6662140 |
| 797 | 3004245301 | 3004239961 | Bacteria | 6892290 |
| 798 | 3004279315 | 3004275668 | Bacteria | 7114440 |
| 799 | 3004335750 | 3004334049 | Bacteria | 8449246 |
| 800 | 637075644 | 637000159 | Bacteria | 7596297 |
| 801 | 641645039 | 641522639 | Bacteria | 7737025 |
| 802 | 643599412 | 643348564 | Bacteria | 8839022 |
| 803 | 649871782 | 649633066 | Bacteria | 6690028 |
| 804 | 8001845965 | 8001845381 | Bacteria | 5804942 |
| 805 | 8002291657 | 8002285264 | Bacteria | 6717907 |
| 806 | 8004303897 | 8004300914 | Bacteria | 6132239 |
| 807 | 8004321191 | 8004312739 | Bacteria | 7444653 |
| 808 | 8004363745 | 8004361976 | Bacteria | 6858373 |
| 809 | 8004378853 | 8004374579 | Bacteria | 6898112 |
| 810 | 8004392537 | 8004387939 | Bacteria | 7049250 |
| 811 | 8004395855 | 8004395343 | Bacteria | 6620908 |
| 812 | 8004446516 | 8004445564 | Bacteria | 6322258 |
| 813 | 8004635419 | 8004633249 | Bacteria | 6723080 |
| 814 | 8004645139 | 8004640170 | Bacteria | 6723001 |
| 815 | 8004712066 | 8004703790 | Bacteria | 8006957 |
| 816 | 8004718846 | 8004714634 | Bacteria | 6776161 |
| 817 | 8004730422 | 8004727605 | Bacteria | 6643904 |
| 818 | 8054566246 | 8054563764 | Bacteria | 5592885 |
| 819 | 8055619461 | 8055617313 | Bacteria | 7548464 |
| 820 | Ga0400484_39394 | |||
| 821 | JGI24735J21928_10031910 | |||
| 822 | JGI25156J39149_1007095 | |||
| 823 | JGI25157J39369_1000706 | |||
| 824 | JGI25159J45721_1004883 | |||
| 825 | JGI25151J46595_10000436 | |||
| 826 | JGI25165J46597_1000042 | |||
| 827 | JGI25153J46596_10003217 | |||
| 828 | JGI25160J50197_1017137 | |||
| 829 | Ga0055542_1000761 | |||
| 830 | Ga0065712_10001938 | |||
| 831 | Ga0065712_10143452 | |||
| 832 | Ga0070680_100020062 | |||
| 833 | Ga0068868_100079930 | |||
| 834 | Ga0070691_10024536 | |||
| 835 | Ga0070691_10052663 | |||
| 836 | Ga0070687_100002321 | |||
| 837 | Ga0070668_100205235 | |||
| 838 | Ga0070675_100258997 | |||
| 839 | Ga0070674_100000478 | |||
| 840 | Ga0070688_100001954 | |||
| 841 | Ga0070703_10001434 | |||
| 842 | Ga0070709_10126477 | |||
| 843 | Ga0070701_10019338 | |||
| 844 | Ga0070705_100001394 | |||
| 845 | Ga0070700_100003215 | |||
| 846 | Ga0070694_100002550 | |||
| 847 | Ga0070708_100006906 | |||
| 848 | Ga0070708_100014663 | |||
| 849 | Ga0070663_100046982 | |||
| 850 | Ga0070678_100154570 | |||
| 851 | Ga0070662_100047111 | |||
| 852 | Ga0070662_100080774 | |||
| 853 | Ga0070681_10174780 | |||
| 854 | Ga0068867_100162151 | |||
| 855 | Ga0070706_100000232 | |||
| 856 | Ga0070706_100022752 | |||
| 857 | Ga0070707_100006355 | |||
| 858 | Ga0070707_100011702 | |||
| 859 | Ga0070698_100005421 | |||
| 860 | Ga0070699_100012031 | |||
| 861 | Ga0070699_100220178 | |||
| 862 | Ga0070679_100041157 | |||
| 863 | Ga0070684_100296732 | |||
| 864 | Ga0070697_100005908 | |||
| 865 | Ga0070697_100175677 | |||
| 866 | Ga0070697_100209410 | |||
| 867 | Ga0068853_100014287 | |||
| 868 | Ga0070695_100001172 | |||
| 869 | Ga0070695_100009322 | |||
| 870 | Ga0070696_100001543 | |||
| 871 | Ga0070693_100031015 | |||
| 872 | Ga0070665_100026701 | |||
| 873 | Ga0070665_100054407 | |||
| 874 | Ga0070665_100169391 | |||
| 875 | Ga0070704_100043512 | |||
| 876 | Ga0068855_100053133 | |||
| 877 | Ga0068857_100070483 | |||
| 878 | Ga0068856_100019963 | |||
| 879 | Ga0070702_100036778 | |||
| 880 | Ga0068852_100198937 | |||
| 881 | Ga0068864_100014202 | |||
| 882 | Ga0068861_100090712 | |||
| 883 | Ga0068861_100099490 | |||
| 884 | Ga0068862_100007019 | |||
| 885 | Ga0081455_10216358 | |||
| 886 | Ga0081538_10027435 | |||
| 887 | Ga0081540_1010027 | |||
| 888 | Ga0081540_1011749 | |||
| 889 | Ga0081539_10000609 | |||
| 890 | Ga0081539_10021387 | |||
| 891 | Ga0070717_10001033 | |||
| 892 | Ga0070717_10003023 | |||
| 893 | Ga0075363_100032940 | |||
| 894 | Ga0075364_10004279 | |||
| 895 | Ga0075367_10005385 | |||
| 896 | Ga0075367_10058724 | |||
| 897 | Ga0075367_10073349 | |||
| 898 | Ga0075428_100031858 | |||
| 899 | Ga0075428_100032615 | |||
| 900 | Ga0075428_100054425 | |||
| 901 | Ga0075428_100056314 | |||
| 902 | Ga0075428_100071008 | |||
| 903 | Ga0075430_100074413 | |||
| 904 | Ga0075430_100175236 | |||
| 905 | Ga0075431_100001046 | |||
| 906 | Ga0075431_100002212 | |||
| 907 | Ga0075431_100045647 | |||
| 908 | Ga0105240_10016012 | |||
| 909 | Ga0105240_10104652 | |||
| 910 | Ga0111539_10224306 | |||
| 911 | Ga0111539_10297056 | |||
| 912 | Ga0111539_10507537 | |||
| 913 | Ga0114129_10016469 | |||
| 914 | Ga0114129_10148020 | |||
| 915 | Ga0114129_10421602 | |||
| 916 | Ga0105243_10149681 | |||
| 917 | Ga0105238_10012662 | |||
| 918 | Ga0105249_10006261 | |||
| 919 | Ga0157373_10173325 | |||
| 920 | Ga0157374_10239902 | |||
| 921 | Ga0163162_10153750 | |||
| 922 | Ga0157379_10132939 | |||
| 923 | Ga0182007_10012507 | |||
| 924 | Ga0206353_11955115 | |||
| 925 | Ga0213872_10063372 | |||
| 926 | Ga0213876_10000915 | |||
| 927 | Ga0213876_10072220 | |||
| 928 | Ga0213875_10000391 | |||
| 929 | Ga0213875_10003194 | |||
| 930 | Ga0213875_10006561 | |||
| 931 | Ga0213871_10011082 | |||
| 932 | Ga0224572_1001846 | |||
| 933 | Ga0209026_1000029 | |||
| 934 | Ga0209148_1000080 | |||
| 935 | Ga0209759_1000040 | |||
| 936 | Ga0209233_1000028 | |||
| 937 | Ga0209233_1003389 | |||
| 938 | Ga0209455_1000171 | |||
| 939 | Ga0209130_1000167 | |||
| 940 | Ga0209025_1000077 | |||
| 941 | Ga0209025_1003608 | |||
| 942 | Ga0209025_1015789 | |||
| 943 | Ga0209758_1000036 | |||
| 944 | Ga0209758_1004420 | |||
| 945 | Ga0209758_1004860 | |||
| 946 | Ga0207426_1000239 | |||
| 947 | Ga0207653_10003312 | |||
| 948 | Ga0207699_10052251 | |||
| 949 | Ga0207643_10104917 | |||
| 950 | Ga0207705_10105819 | |||
| 951 | Ga0207684_10000489 | |||
| 952 | Ga0207707_10018671 | |||
| 953 | Ga0207695_10195990 | |||
| 954 | Ga0207663_10141100 | |||
| 955 | Ga0207652_10066221 | |||
| 956 | Ga0207652_10094416 | |||
| 957 | Ga0207646_10003498 | |||
| 958 | Ga0207646_10029731 | |||
| 959 | Ga0207646_10321722 | |||
| 960 | Ga0207700_10045456 | |||
| 961 | Ga0207664_10050419 | |||
| 962 | Ga0207644_10191508 | |||
| 963 | Ga0207689_10030419 | |||
| 964 | Ga0207661_10080104 | |||
| 965 | Ga0207703_10153903 | |||
| 966 | Ga0207678_10240532 | |||
| 967 | Ga0207708_10012179 | |||
| 968 | Ga0207708_10031759 | |||
| 969 | Ga0207702_10283613 | |||
| 970 | Ga0207641_10185394 | |||
| 971 | Ga0207676_10026932 | |||
| 972 | Ga0207674_10005484 | |||
| 973 | Ga0207675_100040029 | |||
| 974 | Ga0207675_100138927 | |||
| 975 | Ga0207683_10039963 | |||
| 976 | Ga0207698_10019455 | |||
| 977 | Ga0209813_10002328 | |||
| 978 | Ga0207428_10016982 | |||
| 979 | Ga0268266_10319078 | |||
| 980 | Ga0268265_10004578 | |||
| 981 | Ga0265318_10049959 | |||
| 982 | Ga0265322_10000068 | |||
| 983 | Ga0265325_10001708 | |||
| 984 | Ga0265325_10039960 | |||
| 985 | Ga0265325_10077814 | |||
| 986 | Ga0265340_10002223 | |||
| 987 | Ga0265340_10018326 | |||
| 988 | Ga0265339_10001551 | |||
| 989 | Ga0265339_10019507 | |||
| 990 | Ga0265339_10064232 | |||
| 991 | Ga0265316_10003139 | |||
| 992 | Ga0265316_10012132 | |||
| 993 | Ga0265316_10038081 | |||
| 994 | Ga0307513_10078364 | |||
| 995 | Ga0265313_10000448 | |||
| 996 | Ga0265313_10020220 | |||
| 997 | Ga0265313_10020466 | |||
| 998 | Ga0307508_10076676 | |||
| 999 | Ga0316579_10006580 | |||
| 1000 | Ga0316579_10020859 | |||
| 1001 | Ga0316579_10040775 | |||
| 1002 | Ga0265314_10034245 | |||
| 1003 | Ga0265314_10096143 | |||
| 1004 | Ga0265342_10009206 | |||
| 1005 | Ga0316576_10111976 | |||
| 1006 | Ga0316578_10002543 | |||
| 1007 | Ga0316578_10105925 | |||
| 1008 | Ga0307516_10011659 | |||
| 1009 | Ga0316577_10151465 | |||
| 1010 | Ga0307410_10166749 | |||
| 1011 | Ga0316580_10004219 | |||
| 1012 | Ga0307510_10045718 | |||
| 1013 | Ga0373926_0035757 | |||
| 1014 | Ga0373956_0001924 | |||
| 1015 | Ga0373957_0040217 | |||
| 1016 | Ga0373924_0008451 | |||
| 1017 | Ga0373935_0016237 | |||
| 1018 | Ga0373935_0118736 | |||
| 1019 | Ga0373927_0035758 | |||
| 1020 | Ga0373933_0002515 | |||
| 1021 | Ga0373947_0021014 | |||
| 1022 | Ga0373937_0031797 | |||
| 1023 | Ga0316582_0010511 | |||
| 1024 | Ga0316582_0043042 | |||
| 1025 | Ga0316582_0048188 | |||
| 1026 | Ga0316584_0000872 | |||
| 1027 | Ga0316584_0015819 | |||
| 1028 | Ga0316584_0032464 | |||
| 1029 | Ga0316584_0071843 | |||
| 1030 | Ga0316584_0080005 | |||
| 1031 | Ga0316584_0156634 | |||
| 1032 | Ga0373925_0287994 | |||
| 1033 | Ga0395900_0340203 | |||
| 1034 | Ga0316581_0000782 | |||
| 1035 | Ga0316581_0029635 | |||
| 1036 | Ga0436364_0010042 | |||
| 1037 | Ga0436364_0549528 | |||
| 1038 | Ga0436364_0685371 | |||
| 1039 | Ga0400483_017255 | |||
| 1040 | Ga0400483_165172 | |||
| 1041 | Ga0400483_183052 | |||
| 1042 | Ga0400483_236881 | |||
| 1043 | Ga0400483_265909 | |||
| 1044 | Ga0436365_0167783 | |||
| 1045 | Ga0436365_0536235 | |||
| 1046 | Ga0436365_0693504 | |||
| 1047 | Ga0436365_0831867 | |||
| 1048 | Ga0436360_0064987 | |||
| 1049 | Ga0436361_0301719 | |||
| 1050 | Ga0436361_0340312 | |||
| 1051 | Ga0436361_0349975 | |||
| 1052 | Ga0436361_1209447 | |||
| 1053 | Ga0436363_0573820 | |||
| 1054 | Ga0436363_0715384 | |||
| 1055 | Ga0436363_1484825 | |||
| 1056 | Ga0436363_1547701 | |||
| 1057 | Ga0436362_0969859 | |||
| 1058 | Ga0439440_0023721 | |||
| 1059 | Ga0453683_0054776 | |||
| 1060 | Ga0453684_0001430 | |||
| 1061 | Ga0453684_0040212 | |||
| 1062 | Ga0453684_0056492 | |||
| 1063 | Ga0453684_0059934 | |||
| 1064 | Ga0453684_0340199 | |||
| 1065 | Ga0466968_0002176 | |||
| 1066 | Ga0466968_0005181 | |||
| 1067 | Ga0466960_0037682 | |||
| 1068 | Ga0451576_0000009 | |||
| 1069 | Ga0451576_0002127 | |||
| 1070 | Ga0451576_0558292 | |||
| 1071 | Ga0466967_0188526 | |||
| 1072 | Ga0495629_0012044 | |||
| 1073 | Ga0495638_0003543 | |||
| 1074 | Ga0495638_0054870 | |||
| 1075 | Ga0495651_0003394 | |||
| 1076 | Ga0495653_0004556 | |||
| 1077 | Ga0495580_0072748 | |||
| 1078 | Ga0495582_0047458 | |||
| 1079 | Ga0495608_0002249 | |||
| 1080 | Ga0495610_0013771 | |||
| 1081 | Ga0495618_0001172 | |||
| 1082 | Ga0495628_0034175 | |||
| 1083 | Ga0495643_0092242 | |||
| 1084 | Ga0495652_0004437 | |||
| 1085 | Ga0495640_0005042 | |||
| 1086 | Ga0495587_0021831 | |||
| 1087 | Ga0495667_0044894 | |||
| 1088 | Ga0495634_0007035 | |||
| 1089 | Ga0495625_0038244 | |||
| 1090 | Ga0495635_0005384 | |||
| 1091 | Ga0495657_0025526 | |||
| 1092 | Ga0495623_0011358 | |||
| 1093 | Ga0495646_0006441 | |||
| 1094 | Ga0495613_0091243 | |||
| 1095 | Ga0495670_0022015 | |||
| 1096 | Ga0495600_0001574 | |||
| 1097 | Ga0495604_0000150 | |||
| 1098 | Ga0495674_0040568 | |||
| 1099 | Ga0495676_0016306 | |||
| 1100 | Ga0495680_0000699 | |||
| 1101 | Ga0495675_0007130 | |||
| 1102 | Ga0495686_0069331 | |||
| 1103 | Ga0496100_0249835 | |||
| 1104 | Ga0496102_0039194 | |||
| 1105 | Ga0496102_0199713 | |||
| 1106 | Ga0496104_0001490 | |||
| 1107 | Ga0496104_0003654 | |||
| 1108 | Ga0496104_0006182 | |||
| 1109 | Ga0496105_0002850 | |||
| 1110 | Ga0496105_0003480 | |||
| 1111 | Ga0496105_0051925 | |||
| 1112 | Ga0496106_0011468 | |||
| 1113 | Ga0496106_0206710 | |||
| 1114 | Ga0496108_0003952 | |||
| 1115 | Ga0496108_0005160 | |||
| 1116 | Ga0496109_0003935 | |||
| 1117 | Ga0496109_0004749 | |||
| 1118 | Ga0496110_0000113 | |||
| 1119 | Ga0496110_0017309 | |||
| 1120 | Ga0496110_0035124 | |||
| 1121 | Ga0496111_0000458 | |||
| 1122 | Ga0496111_0000718 | |||
| 1123 | Ga0496111_0020182 | |||
| 1124 | Ga0496112_0019676 | |||
| 1125 | Ga0496112_0098480 | |||
| 1126 | Ga0496112_0301066 | |||
| 1127 | Ga0496113_0002796 | |||
| 1128 | Ga0496113_0014258 | |||
| 1129 | Ga0496114_0016673 | |||
| 1130 | Ga0496115_0014819 | |||
| 1131 | Ga0496115_0042790 | |||
| 1132 | Ga0496118_0055136 | |||
| 1133 | Ga0496118_0111385 | |||
| 1134 | Ga0496119_0001398 | |||
| 1135 | Ga0496120_0001370 | |||
| 1136 | Ga0496121_0070628 | |||
| 1137 | Ga0496121_0115011 | |||
| 1138 | Ga0496122_0001032 | |||
| 1139 | Ga0496123_0000806 | |||
| 1140 | Ga0496123_0051165 | |||
| 1141 | Ga0496125_0104048 | |||
| 1142 | Ga0501031_0005116 | |||
| 1143 | Ga0501032_0000238 | |||
| 1144 | Ga0501032_0017280 | |||
| 1145 | Ga0501032_0073694 | |||
| 1146 | Ga0501032_0081690 | |||
| 1147 | Ga0501032_0086333 | |||
| 1148 | Ga0501032_0142155 | |||
| 1149 | Ga0501033_0016486 | |||
| 1150 | Ga0501033_0023537 | |||
| 1151 | Ga0501033_0120707 | |||
| 1152 | Ga0501033_0185071 | |||
| 1153 | Ga0501034_0002653 | |||
| 1154 | Ga0501034_0004312 | |||
| 1155 | Ga0501034_0014877 | |||
| 1156 | Ga0501034_0020143 | |||
| 1157 | Ga0501034_0030547 | |||
| 1158 | Ga0501034_0032884 | |||
| 1159 | Ga0501034_0049137 | |||
| 1160 | Ga0501034_0083119 | |||
| 1161 | Ga0501034_0097390 | |||
| 1162 | Ga0501034_0391603 | |||
| 1163 | Ga0501036_0001536 | |||
| 1164 | Ga0501036_0003303 | |||
| 1165 | Ga0501036_0058034 | |||
| 1166 | Ga0501036_0107592 | |||
| 1167 | Ga0501036_0129714 | |||
| 1168 | Ga0501036_0143885 | |||
| 1169 | Ga0501037_0039910 | |||
| 1170 | Ga0501037_0043039 | |||
| 1171 | Ga0501037_0160884 | |||
| 1172 | Ga0501037_0188373 | |||
| 1173 | Ga0501038_0009911 | |||
| 1174 | Ga0501038_0019076 | |||
| 1175 | Ga0501038_0035281 | |||
| 1176 | Ga0501038_0076939 | |||
| 1177 | Ga0501038_0079017 | |||
| 1178 | Ga0501038_0095692 | |||
| 1179 | Ga0501039_0024279 | |||
| 1180 | Ga0501039_0039572 | |||
| 1181 | Ga0501039_0143449 | |||
| 1182 | Ga0501039_0162768 | |||
| 1183 | Ga0501039_0163233 | |||
| 1184 | Ga0501040_0013655 | |||
| 1185 | Ga0501040_0027140 | |||
| 1186 | Ga0501040_0041823 | |||
| 1187 | Ga0501040_0209081 | |||
| 1188 | Ga0501041_0031061 | |||
| 1189 | Ga0501041_0078819 | |||
| 1190 | Ga0501041_0103783 | |||
| 1191 | Ga0501042_0007935 | |||
| 1192 | Ga0501042_0010639 | |||
| 1193 | Ga0501042_0199105 | |||
| 1194 | Ga0501043_0000736 | |||
| 1195 | Ga0501043_0010338 | |||
| 1196 | Ga0501043_0105872 | |||
| 1197 | Ga0501043_0180562 | |||
| 1198 | Ga0501043_0196328 | |||
| 1199 | Ga0501046_0007945 | |||
| 1200 | Ga0501046_0030399 | |||
| 1201 | Ga0501046_0074525 | |||
| 1202 | Ga0501046_0116631 | |||
| 1203 | Ga0501047_0000124 | |||
| 1204 | Ga0501047_0012748 | |||
| 1205 | Ga0501047_0029328 | |||
| 1206 | Ga0501047_0043610 | |||
| 1207 | Ga0501047_0096714 | |||
| 1208 | Ga0501047_0141056 | |||
| 1209 | Ga0501047_0180580 | |||
| 1210 | Ga0501047_0199073 | |||
| 1211 | Ga0501047_0202112 | |||
| 1212 | Ga0501047_0223703 | |||
| 1213 | Ga0501048_0008611 | |||
| 1214 | Ga0501048_0115145 | |||
| 1215 | Ga0501067_0001307 | |||
| 1216 | Ga0501067_0004048 | |||
| 1217 | Ga0501067_0045980 | |||
| 1218 | Ga0501067_0062591 | |||
| 1219 | Ga0501068_0008727 | |||
| 1220 | Ga0501068_0020629 | |||
| 1221 | Ga0501068_0036089 | |||
| 1222 | Ga0501068_0063858 | |||
| 1223 | Ga0501068_0071661 | |||
| 1224 | Ga0501069_0075408 | |||
| 1225 | Ga0501069_0115901 | |||
| 1226 | Ga0501070_0000229 | |||
| 1227 | Ga0501070_0005227 | |||
| 1228 | Ga0501070_0010861 | |||
| 1229 | Ga0501070_0041971 | |||
| 1230 | Ga0501070_0050657 | |||
| 1231 | Ga0501070_0078669 | |||
| 1232 | Ga0501070_0155796 | |||
| 1233 | Ga0501071_0011715 | |||
| 1234 | Ga0501071_0012733 | |||
| 1235 | Ga0501071_0220436 | |||
| 1236 | Ga0501071_0250773 | |||
| 1237 | Ga0501072_0002828 | |||
| 1238 | Ga0501072_0009532 | |||
| 1239 | Ga0501072_0085666 | |||
| 1240 | Ga0501073_0009708 | |||
| 1241 | Ga0501073_0010790 | |||
| 1242 | Ga0501073_0017780 | |||
| 1243 | Ga0501073_0021727 | |||
| 1244 | Ga0501073_0041756 | |||
| 1245 | Ga0501073_0069535 | |||
| 1246 | Ga0501073_0077738 | |||
| 1247 | Ga0501073_0129309 | |||
| 1248 | Ga0501074_0023598 | |||
| 1249 | Ga0501074_0028354 | |||
| 1250 | Ga0501074_0119904 | |||
| 1251 | Ga0501074_0160520 | |||
| 1252 | Ga0501075_0005275 | |||
| 1253 | Ga0501075_0114962 | |||
| 1254 | Ga0501076_0006327 | |||
| 1255 | Ga0501076_0025489 | |||
| 1256 | Ga0501076_0093490 | |||
| 1257 | Ga0501077_0098593 | |||
| 1258 | Ga0501079_0016277 | |||
| 1259 | Ga0501079_0035052 | |||
| 1260 | Ga0501079_0042222 | |||
| 1261 | Ga0501079_0065430 | |||
| 1262 | Ga0501080_0000130 | |||
| 1263 | Ga0501080_0007746 | |||
| 1264 | Ga0501080_0016328 | |||
| 1265 | Ga0501080_0024231 | |||
| 1266 | Ga0501080_0027681 | |||
| 1267 | Ga0501080_0043335 | |||
| 1268 | Ga0501080_0089934 | |||
| 1269 | Ga0501080_0103359 | |||
| 1270 | Ga0501080_0110525 | |||
| 1271 | Ga0501080_0149062 | |||
| 1272 | Ga0501080_0367428 | |||
| 1273 | Ga0501081_0003672 | |||
| 1274 | Ga0501081_0103416 | |||
| 1275 | Ga0501083_0000480 | |||
| 1276 | Ga0501083_0011760 | |||
| 1277 | Ga0501083_0011873 | |||
| 1278 | Ga0501083_0013234 | |||
| 1279 | Ga0501083_0077118 | |||
| 1280 | Ga0501083_0083711 | |||
| 1281 | Ga0501083_0087651 | |||
| 1282 | Ga0501035_0000373 | |||
| 1283 | Ga0501035_0004040 | |||
| 1284 | Ga0501035_0164738 | |||
| 1285 | Ga0501035_0180185 | |||
| 1286 | Ga0501035_0210966 | |||
| 1287 | Ga0501044_0023125 | |||
| 1288 | Ga0501044_0039770 | |||
| 1289 | Ga0501044_0060321 | |||
| 1290 | Ga0501044_0075405 | |||
| 1291 | Ga0501044_0135969 | |||
| 1292 | Ga0501044_0185250 | |||
| 1293 | Ga0501044_0228418 | |||
| 1294 | Ga0501045_0011533 | |||
| 1295 | Ga0501045_0104871 | |||
| 1296 | Ga0501045_0178045 | |||
| 1297 | nmdc:mga03n38_33757_c1 | |||
| 1298 | nmdc:mga06z11_35768_c1 | |||
| 1299 | nmdc:mga04h51_971_c1 | |||
| 1300 | nmdc:mga07m45_37653_c1 | |||
| 1301 | nmdc:mga05p37_156440_c1 | |||
| 1302 | nmdc:mga05p37_182147_c1 | |||
| 1303 | nmdc:mga05p37_313720_c1 | |||
| 1304 | nmdc:mga05p37_82638_c1 | |||
| 1305 | nmdc:mga09592_29249_c1 | |||
| 1306 | nmdc:mga0qj67_35336_c1 | |||
| 1307 | nmdc:mga0qj67_7547_c1 | |||
| 1308 | nmdc:mga06r32_1985_c1 | |||
| 1309 | nmdc:mga06r32_52676_c1 | |||
| 1310 | nmdc:mga06r32_55613_c1 | |||
| 1311 | nmdc:mga06r32_86904_c1 | |||
| 1312 | nmdc:mga08y16_20054_c1 | |||
| 1313 | nmdc:mga08x19_167701_c1 | |||
| 1314 | nmdc:mga0a205_88269_c1 | |||
| 1315 | Ga0495612_0010743 | |||
| 1316 | Ga0495595_0000221 | |||
| 1317 | Ga0500651_0118691 | |||
| 1318 | Ga0500651_0144565 | |||
| 1319 | Ga0500555_002895 | |||
| 1320 | Ga0500556_0000068 | |||
| 1321 | Ga0500658_0078164 | |||
| 1322 | Ga0500568_0000177 | |||
| 1323 | Ga0500568_0044613 | |||
| 1324 | Ga0500604_0009366 | |||
| 1325 | Ga0500616_0000001 | |||
| 1326 | Ga0500620_000267 | |||
| 1327 | Ga0500620_001565 | |||
| 1328 | Ga0500645_000051 | |||
| 1329 | Ga0501084_0009054 | |||
| 1330 | Ga0501084_0010394 | |||
| 1331 | Ga0501084_0012288 | |||
| 1332 | Ga0501084_0019577 | |||
| 1333 | Ga0501084_0024425 | |||
| 1334 | Ga0501084_0072722 | |||
| 1335 | Ga0501084_0130091 | |||
| 1336 | Ga0501082_0000046 | |||
| 1337 | Ga0501082_0006510 | |||
| 1338 | Ga0501082_0015911 | |||
| 1339 | Ga0501082_0055241 | |||
| 1340 | Ga0501082_0096097 | |||
| 1341 | Ga0530510_0073466 | |||
| 1342 | 2503199982 | |||
| 1343 | 2509118504 | |||
| 1344 | 2509142568 | |||
| 1345 | 2510319275 | |||
| 1346 | 2511390315 | |||
| 1347 | 2512932550 | |||
| 1348 | 2512960567 | |||
| 1349 | 2513608662 | |||
| 1350 | 2514036343 | |||
| 1351 | 2514416476 | |||
| 1352 | 2514587561 | |||
| 1353 | 2545674357 | |||
| 1354 | 2596377279 | |||
| 1355 | 2599936418 | |||
| 1356 | 2643758839 | |||
| 1357 | 2643774394 | |||
| 1358 | 2643776549 | |||
| 1359 | 2643794996 | |||
| 1360 | 2643839080 | |||
| 1361 | 2643984857 | |||
| 1362 | 2644133233 | |||
| 1363 | 2644153187 | |||
| 1364 | 2688597228 | |||
| 1365 | 2694628708 | |||
| 1366 | 2694637378 | |||
| 1367 | 2723574432 | |||
| 1368 | 2739307505 | |||
| 1369 | 2756671519 | |||
| 1370 | 2765466365 | |||
| 1371 | 2770198996 | |||
| 1372 | 2776285006 | |||
| 1373 | 2792747984 | |||
| 1374 | 2828308625 | |||
| 1375 | 2837654175 | |||
| 1376 | 2839998288 | |||
| 1377 | 2840769124 | |||
| 1378 | 2842696661 | |||
| 1379 | 2842872285 | |||
| 1380 | 2844008570 | |||
| 1381 | 2844012609 | |||
| 1382 | 2847675025 | |||
| 1383 | 2856320743 | |||
| 1384 | 2856323089 | |||
| 1385 | 2856334849 | |||
| 1386 | 2856341600 | |||
| 1387 | 2856347358 | |||
| 1388 | 2856354141 | |||
| 1389 | 2856360380 | |||
| 1390 | 2856368050 | |||
| 1391 | 2857351802 | |||
| 1392 | 2857373939 | |||
| 1393 | 2861696691 | |||
| 1394 | 2869163818 | |||
| 1395 | 2869172420 | |||
| 1396 | 2869237045 | |||
| 1397 | 2869246822 | |||
| 1398 | 2869251577 | |||
| 1399 | 2869260114 | |||
| 1400 | 2869271085 | |||
| 1401 | 2869277757 | |||
| 1402 | 2869282640 | |||
| 1403 | 2869290331 | |||
| 1404 | 2870789699 | |||
| 1405 | 2871432615 | |||
| 1406 | 2871436934 | |||
| 1407 | 2871444624 | |||
| 1408 | 2871453800 | |||
| 1409 | 2871461225 | |||
| 1410 | 2871469073 | |||
| 1411 | 2871483824 | |||
| 1412 | 2871493233 | |||
| 1413 | 2871496790 | |||
| 1414 | 2874109129 | |||
| 1415 | 2874116412 | |||
| 1416 | 2874122773 | |||
| 1417 | 2874124074 | |||
| 1418 | 2874134519 | |||
| 1419 | 2874142297 | |||
| 1420 | 2874152582 | |||
| 1421 | 2874159982 | |||
| 1422 | 2874167973 | |||
| 1423 | 2874174800 | |||
| 1424 | 2876365198 | |||
| 1425 | 2876375753 | |||
| 1426 | 2876385897 | |||
| 1427 | 2876387921 | |||
| 1428 | 2876398010 | |||
| 1429 | 2876402844 | |||
| 1430 | 2876410510 | |||
| 1431 | 2876418498 | |||
| 1432 | 2876422971 | |||
| 1433 | 2878035923 | |||
| 1434 | 2878734848 | |||
| 1435 | 2878744520 | |||
| 1436 | 2878750229 | |||
| 1437 | 2878757278 | |||
| 1438 | 2878761014 | |||
| 1439 | 2878767978 | |||
| 1440 | 2878774962 | |||
| 1441 | 2878784356 | |||
| 1442 | 2881149908 | |||
| 1443 | 2881161054 | |||
| 1444 | 2881166789 | |||
| 1445 | 2881857993 | |||
| 1446 | 2882632549 | |||
| 1447 | 2882916298 | |||
| 1448 | 2885308305 | |||
| 1449 | 2885312902 | |||
| 1450 | 2885320514 | |||
| 1451 | 2885330830 | |||
| 1452 | 2885342487 | |||
| 1453 | 2885345263 | |||
| 1454 | 2885357264 | |||
| 1455 | 2888338309 | |||
| 1456 | 2888345914 | |||
| 1457 | 2888355146 | |||
| 1458 | 2889010125 | |||
| 1459 | 2889018204 | |||
| 1460 | 2889308443 | |||
| 1461 | 2889792912 | |||
| 1462 | 2889919072 | |||
| 1463 | 2894655591 | |||
| 1464 | 2902335163 | |||
| 1465 | 2902410619 | |||
| 1466 | 2903450198 | |||
| 1467 | 2903501005 | |||
| 1468 | 2903504447 | |||
| 1469 | 2903518628 | |||
| 1470 | 2903522067 | |||
| 1471 | 2903528445 | |||
| 1472 | 2903541586 | |||
| 1473 | 2904582248 | |||
| 1474 | 2904664661 | |||
| 1475 | 2906312587 | |||
| 1476 | 2906325296 | |||
| 1477 | 2906330694 | |||
| 1478 | 2906369646 | |||
| 1479 | 2906376953 | |||
| 1480 | 2906383587 | |||
| 1481 | 2906388710 | |||
| 1482 | 2906403226 | |||
| 1483 | 2906411340 | |||
| 1484 | 2906419808 | |||
| 1485 | 2906430842 | |||
| 1486 | 2909046428 | |||
| 1487 | 2919122971 | |||
| 1488 | 2919452288 | |||
| 1489 | 2922134240 | |||
| 1490 | 2922155911 | |||
| 1491 | 2922158895 | |||
| 1492 | 2922177608 | |||
| 1493 | 2922181258 | |||
| 1494 | 2922190392 | |||
| 1495 | 2924711180 | |||
| 1496 | 2924722799 | |||
| 1497 | 2924731691 | |||
| 1498 | 2924737891 | |||
| 1499 | 2924747568 | |||
| 1500 | 2924749714 | |||
| 1501 | 2924768129 | |||
| 1502 | 2924782550 | |||
| 1503 | 2924786583 | |||
| 1504 | 2928130730 | |||
| 1505 | 2928524209 | |||
| 1506 | 2937819268 | |||
| 1507 | 2937842627 | |||
| 1508 | 2937848381 | |||
| 1509 | 2937852014 | |||
| 1510 | 2937862674 | |||
| 1511 | 2937874647 | |||
| 1512 | 2937881192 | |||
| 1513 | 2937977283 | |||
| 1514 | 2937995443 | |||
| 1515 | 2938021119 | |||
| 1516 | 2954013157 | |||
| 1517 | 2958039423 | |||
| 1518 | 2958052948 | |||
| 1519 | 2958064931 | |||
| 1520 | 2958073774 | |||
| 1521 | 2958088251 | |||
| 1522 | 2958096770 | |||
| 1523 | 2958102165 | |||
| 1524 | 2958109805 | |||
| 1525 | 2958115502 | |||
| 1526 | 2958129807 | |||
| 1527 | 2958134719 | |||
| 1528 | 2958138847 | |||
| 1529 | 2958147687 | |||
| 1530 | 2958158856 | |||
| 1531 | 2958165916 | |||
| 1532 | 2958175237 | |||
| 1533 | 2958186526 | |||
| 1534 | 2961085025 | |||
| 1535 | 2961119659 | |||
| 1536 | 2961133876 | |||
| 1537 | 2961139811 | |||
| 1538 | 2961164379 | |||
| 1539 | 2961175393 | |||
| 1540 | 2961184383 | |||
| 1541 | 2963646653 | |||
| 1542 | 2965019365 | |||
| 1543 | 2965027604 | |||
| 1544 | 2965036274 | |||
| 1545 | 2965043313 | |||
| 1546 | 2965051529 | |||
| 1547 | 2965093495 | |||
| 1548 | 2965116048 | |||
| 1549 | 2965126585 | |||
| 1550 | 2967999605 | |||
| 1551 | 2968007963 | |||
| 1552 | 2968020750 | |||
| 1553 | 2968090554 | |||
| 1554 | 2968094760 | |||
| 1555 | 2968099329 | |||
| 1556 | 2968115914 | |||
| 1557 | 2968119299 | |||
| 1558 | 2968133670 | |||
| 1559 | 2968146532 | |||
| 1560 | 2968172780 | |||
| 1561 | 2970474047 | |||
| 1562 | 2970490687 | |||
| 1563 | 2970507981 | |||
| 1564 | 2970515314 | |||
| 1565 | 2970527367 | |||
| 1566 | 2970534292 | |||
| 1567 | 2970552305 | |||
| 1568 | 2970555872 | |||
| 1569 | 2970597249 | |||
| 1570 | 2970622761 | |||
| 1571 | 2970632723 | |||
| 1572 | 2977826437 | |||
| 1573 | 2977832671 | |||
| 1574 | 2977848375 | |||
| 1575 | 2977855579 | |||
| 1576 | 2977860920 | |||
| 1577 | 2977865158 | |||
| 1578 | 2977880121 | |||
| 1579 | 2977899141 | |||
| 1580 | 2977910146 | |||
| 1581 | 2977918109 | |||
| 1582 | 2977922971 | |||
| 1583 | 2977940314 | |||
| 1584 | 2977944747 | |||
| 1585 | 2977953129 | |||
| 1586 | 2977962313 | |||
| 1587 | 2977976051 | |||
| 1588 | 2977990136 | |||
| 1589 | 2979715116 | |||
| 1590 | 2979749048 | |||
| 1591 | 2979766347 | |||
| 1592 | 2979776139 | |||
| 1593 | 2979785309 | |||
| 1594 | 2979813165 | |||
| 1595 | 2987638986 | |||
| 1596 | 2987647979 | |||
| 1597 | 2987653665 | |||
| 1598 | 2987660383 | |||
| 1599 | 2987671449 | |||
| 1600 | 2987675405 | |||
| 1601 | 2996312096 | |||
| 1602 | 2996338721 | |||
| 1603 | 2996344256 | |||
| 1604 | 2996352633 | |||
| 1605 | 2996390013 | |||
| 1606 | 3000139616 | |||
| 1607 | 3002145117 | |||
| 1608 | 3003667394 | |||
| 1609 | 3004167645 | |||
| 1610 | 3004189434 | |||
| 1611 | 3004199810 | |||
| 1612 | 3004204771 | |||
| 1613 | 3004218048 | |||
| 1614 | 3004220905 | |||
| 1615 | 3004235701 | |||
| 1616 | 3004245301 | |||
| 1617 | 3004279315 | |||
| 1618 | 3004335750 | |||
| 1619 | 637075644 | |||
| 1620 | 641645039 | |||
| 1621 | 643599412 | |||
| 1622 | 649871782 | |||
| 1623 | 8001845965 | |||
| 1624 | 8002291657 | |||
| 1625 | 8004303897 | |||
| 1626 | 8004321191 | |||
| 1627 | 8004363745 | |||
| 1628 | 8004378853 | |||
| 1629 | 8004392537 | |||
| 1630 | 8004395855 | |||
| 1631 | 8004446516 | |||
| 1632 | 8004635419 | |||
| 1633 | 8004645139 | |||
| 1634 | 8004712066 | |||
| 1635 | 8004718846 | |||
| 1636 | 8004730422 | |||
| 1637 | 8054566246 | |||
| 1638 | 8055619461 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wml-assembly1.cif.gz_B | arabidopsis thaliana prephenate aminotransferase mutant- k306a | 0.9486 | 3 | 386 |
| 5wmk-assembly1.cif.gz_A-2 | arabidopsis thaliana prephenate aminotransferase double mutant- t84v k169v | 0.9472 | 3 | 386 |
| 8wou-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila | 0.9471 | 1 | 384 |
| 5wmi-assembly1.cif.gz_A-2 | arabidopsis thaliana prephenate aminotransferase mutant- t84v | 0.9451 | 2 | 386 |
| 8wkj-assembly1.cif.gz_A-2 | the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila | 0.9435 | 1 | 385 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xi9D01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9623 | 286 | 386 | 3.90.1150.10 |
| af_Q60317_288_372_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9612 | 296 | 381 | 3.90.1150.10 |
| 1j32B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9512 | 285 | 384 | 3.90.1150.10 |
| af_Q58097_268_366_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9458 | 285 | 381 | 3.90.1150.10 |
| af_Q2FZL1_278_379_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9422 | 286 | 382 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833G1Y3-F1-model_v4 | aspartate transaminase (EC 2.6.1.1) | 0.9926 | 1 | 224 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A3S1SBI5-F1-model_v4 | aspartate transaminase (EC 2.6.1.1) | 0.9895 | 255 | 387 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A833G1Y3-F1-model_v4 | aspartate transaminase (EC 2.6.1.1) | 0.9838 | 1 | 224 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A4R3M710-F1-model_v4 | aspartate transaminase (EC 2.6.1.1) | 0.9823 | 1 | 386 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A833L4Z0-F1-model_v4 | aspartate transaminase (EC 2.6.1.1) | 0.9806 | 1 | 386 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |