F482180

General Info

Members Datasets Scaffolds Average Seq Length
819 569 1638 391

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_39394|Ga0400484_39394_6405_7679
Length 424
Sequence MRIKNKPQRRKERRGLEKNLRVLRASAVKLEEEKMSFAKRVSHLQEEGAYAVLARAQELERNGRTIIHLEIGEPDFETGANVSMAGIRAISEGRTRYNPPRGIAELREVIAADAGQRRGMEIRPSQVVVGPGAKPTLFFPTLALVEPGDEVIYPNPGFPTYEAMIGAAGGVPVPVPLREEKQFSFDLAVFDQLVNEKTRLIVLNSPSNPTGGVMPVADLEHIAALAQKNDCWVLSDEIYSRMVYDDTAVPSIASLPGMAERTVIADGFSKTYAMTGWRLGYGIMPEALADRIQLLLTHTIGCTAHFTQYAGIEALTGPQDWVDKMVASYRRRRDLLVNGLNAIPGINCQIPQGAFYVFPNVKELGISSAELANYILEEAGVALLPGTAFGKYGEGYLRLSYANSLENLERAMILMATALAKKTR

Samples

Sample ID Description Type Environment
1 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
275 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
276 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
277 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
278 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
279 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
280 2512875024
281 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
282 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
283 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
284 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
285 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
286 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
287 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
288 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
289 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
290 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
291 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
292 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
293 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
294 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
295 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
296 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
297 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
298 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
299 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
300 2738543024 Aminobacter sp. AP02 Isolate Unclassified
301 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
302 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
303 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
304 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
305 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
306 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
307 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
308 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
309 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
310 2842694124 Methylopila sp. R-72369 Isolate Unclassified
311 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
312 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
313 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
314 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
315 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
316 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
317 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
318 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
319 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
320 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
321 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
322 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
323 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
324 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
325 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
326 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
327 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
328 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
329 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
330 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
331 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
332 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
333 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
334 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
335 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
336 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
337 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
338 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
339 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
340 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
341 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
342 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
343 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
344 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
345 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
346 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
347 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
348 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
349 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
350 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
351 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
352 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
353 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
354 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
355 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
356 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
357 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
358 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
359 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
360 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
361 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
362 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
363 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
364 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
365 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
366 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
367 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
368 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
369 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
370 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
371 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
372 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
373 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
374 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
375 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
376 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
377 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
378 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
379 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
380 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
381 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
382 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
383 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
384 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
385 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
386 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
387 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
388 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
389 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
390 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
391 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
392 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
393 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
394 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
395 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
396 2902330777 Methylobacterium sp. 2A Isolate Unclassified
397 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
398 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
399 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
400 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
401 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
402 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
403 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
404 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
405 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
406 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
407 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
408 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
409 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
410 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
411 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
412 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
413 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
414 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
415 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
416 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
417 2909042592 Labrys sp. LIt4 Isolate Nodule
418 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
419 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
420 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
421 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
422 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
423 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
424 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
425 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
426 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
427 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
428 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
429 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
430 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
431 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
432 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
433 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
434 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
435 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
436 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
437 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
438 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
439 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
440 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
441 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
442 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
443 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
444 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
445 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
446 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
447 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
448 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
449 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
450 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
451 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
452 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
453 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
454 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
455 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
456 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
457 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
458 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
459 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
460 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
461 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
462 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
463 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
464 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
465 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
466 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
467 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
468 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
469 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
470 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
471 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
472 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
473 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
474 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
475 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
476 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
477 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
478 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
479 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
480 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
481 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
482 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
483 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
484 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
485 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
486 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
487 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
488 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
489 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
490 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
491 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
492 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
493 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
494 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
495 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
496 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
497 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
498 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
499 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
500 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
501 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
502 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
503 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
504 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
505 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
506 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
507 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
508 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
509 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
510 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
511 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
512 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
513 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
514 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
515 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
516 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
517 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
518 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
519 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
520 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
521 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
522 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
523 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
524 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
525 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
526 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
527 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
528 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
529 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
530 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
531 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
532 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
533 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
534 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
535 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
536 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
537 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
538 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
539 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
540 3004167301 Mesorhizobium loti 582 Isolate Unclassified
541 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
542 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
543 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
544 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
545 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
546 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
547 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
548 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
549 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
550 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
551 641522639 Methylobacterium sp. 4-46 Isolate Nodule
552 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
553 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
554 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
555 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
556 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
557 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
558 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
559 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
560 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
561 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
562 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
563 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
564 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
565 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
566 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
567 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
568 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
569 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.61
Metatranscriptomes 0.12
Isolates 36.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.88
Nodule 28.21
Rhizoplane 3.91
Rhizosphere 52.01
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400484_39394 3300038725 Bacteria 11243
2 JGI24735J21928_10031910 3300002067 Bacteria 1561
3 JGI25156J39149_1007095 3300002705 Bacteria 2982
4 JGI25157J39369_1000706 3300002741 Bacteria 18004
5 JGI25159J45721_1004883 3300002987 Bacteria 4322
6 JGI25151J46595_10000436 3300003187 Bacteria 41270
7 JGI25165J46597_1000042 3300003214 Bacteria 271606
8 JGI25153J46596_10003217 3300003215 Bacteria 9178
9 JGI25160J50197_1017137 3300003354 Bacteria 2306
10 Ga0055542_1000761 3300003762 Bacteria 24456
11 Ga0065712_10001938 3300005290 Bacteria 5677
12 Ga0065712_10143452 3300005290 Unclassified 1429
13 Ga0070680_100020062 3300005336 Bacteria 5300
14 Ga0068868_100079930 3300005338 Bacteria 2619
15 Ga0070691_10024536 3300005341 Bacteria 2802
16 Ga0070691_10052663 3300005341 Bacteria 1946
17 Ga0070687_100002321 3300005343 Bacteria 7080
18 Ga0070668_100205235 3300005347 Bacteria 1619
19 Ga0070675_100258997 3300005354 Bacteria 1524
20 Ga0070674_100000478 3300005356 Bacteria 20201
21 Ga0070688_100001954 3300005365 Bacteria 10358
22 Ga0070703_10001434 3300005406 Bacteria 7187
23 Ga0070709_10126477 3300005434 Bacteria 1739
24 Ga0070701_10019338 3300005438 Bacteria 3216
25 Ga0070705_100001394 3300005440 Bacteria 12811
26 Ga0070700_100003215 3300005441 Bacteria 8395
27 Ga0070694_100002550 3300005444 Bacteria 10759
28 Ga0070708_100006906 3300005445 Bacteria 9055
29 Ga0070708_100014663 3300005445 Bacteria 6456
30 Ga0070663_100046982 3300005455 Bacteria 3057
31 Ga0070678_100154570 3300005456 Bacteria 1852
32 Ga0070662_100047111 3300005457 Bacteria 3099
33 Ga0070662_100080774 3300005457 Bacteria 2421
34 Ga0070681_10174780 3300005458 Bacteria 2069
35 Ga0068867_100162151 3300005459 Bacteria 1764
36 Ga0070706_100000232 3300005467 Bacteria 68304
37 Ga0070706_100022752 3300005467 Bacteria 5773
38 Ga0070707_100006355 3300005468 Bacteria 10990
39 Ga0070707_100011702 3300005468 Bacteria 8188
40 Ga0070698_100005421 3300005471 Bacteria 13939
41 Ga0070699_100012031 3300005518 Bacteria 7470
42 Ga0070699_100220178 3300005518 Bacteria 1691
43 Ga0070679_100041157 3300005530 Bacteria 4599
44 Ga0070684_100296732 3300005535 Bacteria 1482
45 Ga0070697_100005908 3300005536 Bacteria 9448
46 Ga0070697_100175677 3300005536 Bacteria 1814
47 Ga0070697_100209410 3300005536 Bacteria 1659
48 Ga0068853_100014287 3300005539 Bacteria 6498
49 Ga0070695_100001172 3300005545 Bacteria 14398
50 Ga0070695_100009322 3300005545 Bacteria 5837
51 Ga0070696_100001543 3300005546 Bacteria 15094
52 Ga0070693_100031015 3300005547 Bacteria 2927
53 Ga0070665_100026701 3300005548 Bacteria 5815
54 Ga0070665_100054407 3300005548 Bacteria 4014
55 Ga0070665_100169391 3300005548 Bacteria 2185
56 Ga0070704_100043512 3300005549 Bacteria 3113
57 Ga0068855_100053133 3300005563 Bacteria 4767
58 Ga0068857_100070483 3300005577 Bacteria 3114
59 Ga0068856_100019963 3300005614 Bacteria 6505
60 Ga0070702_100036778 3300005615 Bacteria 2715
61 Ga0068852_100198937 3300005616 Bacteria 1895
62 Ga0068864_100014202 3300005618 Bacteria 6612
63 Ga0068861_100090712 3300005719 Bacteria 2411
64 Ga0068861_100099490 3300005719 Bacteria 2310
65 Ga0068862_100007019 3300005844 Bacteria 9353
66 Ga0081455_10216358 3300005937 Bacteria 1424
67 Ga0081538_10027435 3300005981 Bacteria 3948
68 Ga0081540_1010027 3300005983 Bacteria 6449
69 Ga0081540_1011749 3300005983 Bacteria 5826
70 Ga0081539_10000609 3300005985 Bacteria 72508
71 Ga0081539_10021387 3300005985 Bacteria 4324
72 Ga0070717_10001033 3300006028 Bacteria 18652
73 Ga0070717_10003023 3300006028 Bacteria 11987
74 Ga0075363_100032940 3300006048 Bacteria 2695
75 Ga0075364_10004279 3300006051 Bacteria 8197
76 Ga0075367_10005385 3300006178 Bacteria 6347
77 Ga0075367_10058724 3300006178 Bacteria 2289
78 Ga0075367_10073349 3300006178 Bacteria 2062
79 Ga0075428_100031858 3300006844 Bacteria 5824
80 Ga0075428_100032615 3300006844 Bacteria 5752
81 Ga0075428_100054425 3300006844 Bacteria 4386
82 Ga0075428_100056314 3300006844 Bacteria 4307
83 Ga0075428_100071008 3300006844 Bacteria 3806
84 Ga0075430_100074413 3300006846 Bacteria 2848
85 Ga0075430_100175236 3300006846 Bacteria 1784
86 Ga0075431_100001046 3300006847 Bacteria 24694
87 Ga0075431_100002212 3300006847 Bacteria 18636
88 Ga0075431_100045647 3300006847 Bacteria 4517
89 Ga0105240_10016012 3300009093 Bacteria 10165
90 Ga0105240_10104652 3300009093 Bacteria 3437
91 Ga0111539_10224306 3300009094 Bacteria 2189
92 Ga0111539_10297056 3300009094 Bacteria 1880
93 Ga0111539_10507537 3300009094 Bacteria 1404
94 Ga0114129_10016469 3300009147 Bacteria 10523
95 Ga0114129_10148020 3300009147 Bacteria 3215
96 Ga0114129_10421602 3300009147 Bacteria 1755
97 Ga0105243_10149681 3300009148 Bacteria 2001
98 Ga0105238_10012662 3300009551 Bacteria 8513
99 Ga0105249_10006261 3300009553 Bacteria 10337
100 Ga0157373_10173325 3300013100 Bacteria 1518
101 Ga0157374_10239902 3300013296 Bacteria 1782
102 Ga0163162_10153750 3300013306 Bacteria 2419
103 Ga0157379_10132939 3300014968 Bacteria 2240
104 Ga0182007_10012507 3300015262 Bacteria 3262
105 Ga0206353_11955115 3300020082 Bacteria 2116
106 Ga0213872_10063372 3300021361 Bacteria 1671
107 Ga0213876_10000915 3300021384 Bacteria 19496
108 Ga0213876_10072220 3300021384 Bacteria 1822
109 Ga0213875_10000391 3300021388 Bacteria 39122
110 Ga0213875_10003194 3300021388 Bacteria 9421
111 Ga0213875_10006561 3300021388 Bacteria 6089
112 Ga0213871_10011082 3300021441 Bacteria 2061
113 Ga0224572_1001846 3300024225 Bacteria 3263
114 Ga0209026_1000029 3300025250 Bacteria 337109
115 Ga0209148_1000080 3300025254 Bacteria 277806
116 Ga0209759_1000040 3300025256 Bacteria 254501
117 Ga0209233_1000028 3300025261 Bacteria 642062
118 Ga0209233_1003389 3300025261 Bacteria 5620
119 Ga0209455_1000171 3300025272 Bacteria 109696
120 Ga0209130_1000167 3300025284 Bacteria 95517
121 Ga0209025_1000077 3300025294 Bacteria 271958
122 Ga0209025_1003608 3300025294 Bacteria 14413
123 Ga0209025_1015789 3300025294 Bacteria 4518
124 Ga0209758_1000036 3300025297 Bacteria 441671
125 Ga0209758_1004420 3300025297 Bacteria 11708
126 Ga0209758_1004860 3300025297 Bacteria 10834
127 Ga0207426_1000239 3300025302 Bacteria 123307
128 Ga0207653_10003312 3300025885 Bacteria 5083
129 Ga0207699_10052251 3300025906 Bacteria 2418
130 Ga0207643_10104917 3300025908 Bacteria 1660
131 Ga0207705_10105819 3300025909 Bacteria 2074
132 Ga0207684_10000489 3300025910 Bacteria 50446
133 Ga0207707_10018671 3300025912 Bacteria 6047
134 Ga0207695_10195990 3300025913 Bacteria 1936
135 Ga0207663_10141100 3300025916 Bacteria 1679
136 Ga0207652_10066221 3300025921 Bacteria 3130
137 Ga0207652_10094416 3300025921 Bacteria 2634
138 Ga0207646_10003498 3300025922 Bacteria 17706
139 Ga0207646_10029731 3300025922 Bacteria 4961
140 Ga0207646_10321722 3300025922 Bacteria 1398
141 Ga0207700_10045456 3300025928 Bacteria 3240
142 Ga0207664_10050419 3300025929 Bacteria 3282
143 Ga0207644_10191508 3300025931 Bacteria 1608
144 Ga0207689_10030419 3300025942 Bacteria 4499
145 Ga0207661_10080104 3300025944 Bacteria 2694
146 Ga0207703_10153903 3300026035 Bacteria 2008
147 Ga0207678_10240532 3300026067 Bacteria 1550
148 Ga0207708_10012179 3300026075 Bacteria 6415
149 Ga0207708_10031759 3300026075 Bacteria 4010
150 Ga0207702_10283613 3300026078 Bacteria 1567
151 Ga0207641_10185394 3300026088 Bacteria 1909
152 Ga0207676_10026932 3300026095 Bacteria 4277
153 Ga0207674_10005484 3300026116 Bacteria 15067
154 Ga0207675_100040029 3300026118 Bacteria 4374
155 Ga0207675_100138927 3300026118 Bacteria 2307
156 Ga0207683_10039963 3300026121 Bacteria 4092
157 Ga0207698_10019455 3300026142 Bacteria 4650
158 Ga0209813_10002328 3300027866 Bacteria 4351
159 Ga0207428_10016982 3300027907 Bacteria 6254
160 Ga0268266_10319078 3300028379 Bacteria 1454
161 Ga0268265_10004578 3300028380 Bacteria 9558
162 Ga0265318_10049959 3300028577 Bacteria 1572
163 Ga0265322_10000068 3300028654 Bacteria 49602
164 Ga0265325_10001708 3300031241 Bacteria 15269
165 Ga0265325_10039960 3300031241 Bacteria 2466
166 Ga0265325_10077814 3300031241 Bacteria 1653
167 Ga0265340_10002223 3300031247 Bacteria 11099
168 Ga0265340_10018326 3300031247 Bacteria 3611
169 Ga0265339_10001551 3300031249 Bacteria 16995
170 Ga0265339_10019507 3300031249 Bacteria 3980
171 Ga0265339_10064232 3300031249 Bacteria 1970
172 Ga0265316_10003139 3300031344 Bacteria 16822
173 Ga0265316_10012132 3300031344 Bacteria 7736
174 Ga0265316_10038081 3300031344 Bacteria 3878
175 Ga0307513_10078364 3300031456 Bacteria 3418
176 Ga0265313_10000448 3300031595 Bacteria 43625
177 Ga0265313_10020220 3300031595 Bacteria 3679
178 Ga0265313_10020466 3300031595 Bacteria 3649
179 Ga0307508_10076676 3300031616 Bacteria 2921
180 Ga0316579_10006580 3300031691 Bacteria 4749
181 Ga0316579_10020859 3300031691 Bacteria 2913
182 Ga0316579_10040775 3300031691 Bacteria 2154
183 Ga0265314_10034245 3300031711 Bacteria 3715
184 Ga0265314_10096143 3300031711 Bacteria 1917
185 Ga0265342_10009206 3300031712 Bacteria 6989
186 Ga0316576_10111976 3300031727 Bacteria 2046
187 Ga0316578_10002543 3300031728 Bacteria 8053
188 Ga0316578_10105925 3300031728 Bacteria 1687
189 Ga0307516_10011659 3300031730 Bacteria 9538
190 Ga0316577_10151465 3300031733 Bacteria 1307
191 Ga0307410_10166749 3300031852 Bacteria 1656
192 Ga0316580_10004219 3300032139 Bacteria 4151
193 Ga0307510_10045718 3300033180 Bacteria 4720
194 Ga0373926_0035757 3300035083 Bacteria 1763
195 Ga0373956_0001924 3300035119 Bacteria 8571
196 Ga0373957_0040217 3300035120 Bacteria 1757
197 Ga0373924_0008451 3300035410 Bacteria 3743
198 Ga0373935_0016237 3300035692 Bacteria 4507
199 Ga0373935_0118736 3300035692 Bacteria 1764
200 Ga0373927_0035758 3300035695 Bacteria 3230
201 Ga0373933_0002515 3300035724 Bacteria 10296
202 Ga0373947_0021014 3300035725 Bacteria 3775
203 Ga0373937_0031797 3300036401 Bacteria 4784
204 Ga0316582_0010511 3300036647 Bacteria 5074
205 Ga0316582_0043042 3300036647 Bacteria 2832
206 Ga0316582_0048188 3300036647 Bacteria 2693
207 Ga0316584_0000872 3300036712 Bacteria 17133
208 Ga0316584_0015819 3300036712 Bacteria 5402
209 Ga0316584_0032464 3300036712 Bacteria 3865
210 Ga0316584_0071843 3300036712 Bacteria 2593
211 Ga0316584_0080005 3300036712 Bacteria 2449
212 Ga0316584_0156634 3300036712 Bacteria 1693
213 Ga0373925_0287994 3300037068 Bacteria 1324
214 Ga0395900_0340203 3300037418 Bacteria 1476
215 Ga0316581_0000782 3300037588 Bacteria 6570
216 Ga0316581_0029635 3300037588 Unclassified 1645
217 Ga0436364_0010042 3300037853 Bacteria 102214
218 Ga0436364_0549528 3300037853 Bacteria 14336
219 Ga0436364_0685371 3300037853 Bacteria 68284
220 Ga0400483_017255 3300039062 Bacteria 9912
221 Ga0400483_165172 3300039062 Bacteria 9498
222 Ga0400483_183052 3300039062 Bacteria 3025
223 Ga0400483_236881 3300039062 Bacteria 5331
224 Ga0400483_265909 3300039062 Bacteria 8765
225 Ga0436365_0167783 3300039437 Bacteria 30845
226 Ga0436365_0536235 3300039437 Bacteria 9986
227 Ga0436365_0693504 3300039437 Bacteria 82758
228 Ga0436365_0831867 3300039437 Bacteria 2044
229 Ga0436360_0064987 3300039438 Bacteria 2565
230 Ga0436361_0301719 3300039447 Bacteria 1847
231 Ga0436361_0340312 3300039447 Bacteria 4192
232 Ga0436361_0349975 3300039447 Bacteria 2462
233 Ga0436361_1209447 3300039447 Bacteria 1691
234 Ga0436363_0573820 3300039450 Bacteria 8262
235 Ga0436363_0715384 3300039450 Bacteria 10341
236 Ga0436363_1484825 3300039450 Bacteria 1339
237 Ga0436363_1547701 3300039450 Bacteria 8513
238 Ga0436362_0969859 3300039453 Bacteria 3323
239 Ga0439440_0023721 3300042993 Unclassified 1401
240 Ga0453683_0054776 3300044673 Bacteria 2496
241 Ga0453684_0001430 3300044712 Bacteria 68343
242 Ga0453684_0040212 3300044712 Bacteria 6356
243 Ga0453684_0056492 3300044712 Bacteria 5091
244 Ga0453684_0059934 3300044712 Bacteria 4901
245 Ga0453684_0340199 3300044712 Bacteria 1694
246 Ga0466968_0002176 3300044735 Bacteria 7148
247 Ga0466968_0005181 3300044735 Bacteria 4876
248 Ga0466960_0037682 3300044901 Bacteria 2269
249 Ga0451576_0000009 3300045051 Bacteria 712666
250 Ga0451576_0002127 3300045051 Bacteria 30771
251 Ga0451576_0558292 3300045051 Bacteria 1203
252 Ga0466967_0188526 3300045976 Bacteria 1948
253 Ga0495629_0012044 3300046459 Bacteria 6268
254 Ga0495638_0003543 3300046460 Bacteria 12235
255 Ga0495638_0054870 3300046460 Bacteria 2476
256 Ga0495651_0003394 3300046462 Bacteria 12218
257 Ga0495653_0004556 3300046463 Bacteria 11199
258 Ga0495580_0072748 3300046472 Bacteria 2400
259 Ga0495582_0047458 3300046473 Bacteria 2366
260 Ga0495608_0002249 3300046511 Bacteria 13939
261 Ga0495610_0013771 3300046512 Bacteria 4785
262 Ga0495618_0001172 3300046514 Bacteria 17756
263 Ga0495628_0034175 3300046516 Bacteria 4092
264 Ga0495643_0092242 3300046522 Bacteria 1561
265 Ga0495652_0004437 3300046529 Bacteria 13417
266 Ga0495640_0005042 3300046533 Bacteria 10490
267 Ga0495587_0021831 3300046536 Bacteria 3949
268 Ga0495667_0044894 3300046559 Bacteria 2926
269 Ga0495634_0007035 3300046642 Bacteria 8485
270 Ga0495625_0038244 3300046660 Bacteria 3514
271 Ga0495635_0005384 3300046663 Bacteria 8903
272 Ga0495657_0025526 3300046675 Bacteria 4195
273 Ga0495623_0011358 3300046679 Bacteria 5761
274 Ga0495646_0006441 3300046680 Bacteria 7444
275 Ga0495613_0091243 3300046689 Bacteria 2206
276 Ga0495670_0022015 3300046691 Bacteria 3147
277 Ga0495600_0001574 3300046809 Bacteria 12692
278 Ga0495604_0000150 3300047317 Bacteria 60582
279 Ga0495674_0040568 3300047319 Bacteria 4163
280 Ga0495676_0016306 3300047321 Bacteria 6598
281 Ga0495680_0000699 3300047322 Bacteria 37651
282 Ga0495675_0007130 3300047444 Bacteria 6878
283 Ga0495686_0069331 3300047472 Bacteria 2174
284 Ga0496100_0249835 3300048903 Bacteria 1312
285 Ga0496102_0039194 3300048905 Bacteria 4280
286 Ga0496102_0199713 3300048905 Bacteria 1885
287 Ga0496104_0001490 3300048907 Bacteria 20205
288 Ga0496104_0003654 3300048907 Bacteria 13281
289 Ga0496104_0006182 3300048907 Bacteria 10515
290 Ga0496105_0002850 3300048908 Bacteria 12652
291 Ga0496105_0003480 3300048908 Bacteria 11651
292 Ga0496105_0051925 3300048908 Bacteria 3385
293 Ga0496106_0011468 3300048909 Bacteria 6554
294 Ga0496106_0206710 3300048909 Bacteria 1563
295 Ga0496108_0003952 3300048911 Bacteria 11907
296 Ga0496108_0005160 3300048911 Bacteria 10558
297 Ga0496109_0003935 3300048912 Bacteria 12413
298 Ga0496109_0004749 3300048912 Bacteria 11355
299 Ga0496110_0000113 3300048913 Bacteria 44443
300 Ga0496110_0017309 3300048913 Bacteria 6029
301 Ga0496110_0035124 3300048913 Bacteria 4347
302 Ga0496111_0000458 3300048914 Bacteria 20697
303 Ga0496111_0000718 3300048914 Bacteria 17646
304 Ga0496111_0020182 3300048914 Bacteria 4637
305 Ga0496112_0019676 3300048915 Bacteria 6378
306 Ga0496112_0098480 3300048915 Bacteria 2894
307 Ga0496112_0301066 3300048915 Bacteria 1549
308 Ga0496113_0002796 3300048916 Bacteria 10267
309 Ga0496113_0014258 3300048916 Bacteria 5418
310 Ga0496114_0016673 3300048917 Bacteria 5925
311 Ga0496115_0014819 3300048918 Bacteria 5912
312 Ga0496115_0042790 3300048918 Bacteria 3610
313 Ga0496118_0055136 3300048921 Bacteria 3003
314 Ga0496118_0111385 3300048921 Bacteria 1815
315 Ga0496119_0001398 3300048922 Bacteria 29250
316 Ga0496120_0001370 3300048923 Bacteria 29844
317 Ga0496121_0070628 3300048924 Bacteria 2812
318 Ga0496121_0115011 3300048924 Bacteria 2044
319 Ga0496122_0001032 3300048925 Bacteria 48968
320 Ga0496123_0000806 3300048926 Bacteria 50579
321 Ga0496123_0051165 3300048926 Bacteria 2753
322 Ga0496125_0104048 3300048928 Bacteria 2081
323 Ga0501031_0005116 3300049568 Bacteria 8542
324 Ga0501032_0000238 3300049569 Bacteria 45642
325 Ga0501032_0017280 3300049569 Bacteria 5065
326 Ga0501032_0073694 3300049569 Bacteria 2274
327 Ga0501032_0081690 3300049569 Bacteria 2150
328 Ga0501032_0086333 3300049569 Bacteria 2085
329 Ga0501032_0142155 3300049569 Bacteria 1580
330 Ga0501033_0016486 3300049570 Bacteria 5595
331 Ga0501033_0023537 3300049570 Bacteria 4644
332 Ga0501033_0120707 3300049570 Bacteria 1902
333 Ga0501033_0185071 3300049570 Bacteria 1492
334 Ga0501034_0002653 3300049571 Bacteria 21171
335 Ga0501034_0004312 3300049571 Bacteria 15860
336 Ga0501034_0014877 3300049571 Bacteria 8003
337 Ga0501034_0020143 3300049571 Bacteria 6810
338 Ga0501034_0030547 3300049571 Bacteria 5477
339 Ga0501034_0032884 3300049571 Bacteria 5266
340 Ga0501034_0049137 3300049571 Bacteria 4257
341 Ga0501034_0083119 3300049571 Bacteria 3203
342 Ga0501034_0097390 3300049571 Bacteria 2937
343 Ga0501034_0391603 3300049571 Bacteria 1313
344 Ga0501036_0001536 3300049572 Bacteria 17831
345 Ga0501036_0003303 3300049572 Bacteria 12872
346 Ga0501036_0058034 3300049572 Bacteria 3279
347 Ga0501036_0107592 3300049572 Bacteria 2357
348 Ga0501036_0129714 3300049572 Bacteria 2129
349 Ga0501036_0143885 3300049572 Bacteria 2011
350 Ga0501037_0039910 3300049573 Bacteria 3454
351 Ga0501037_0043039 3300049573 Bacteria 3319
352 Ga0501037_0160884 3300049573 Bacteria 1600
353 Ga0501037_0188373 3300049573 Bacteria 1461
354 Ga0501038_0009911 3300049574 Bacteria 8723
355 Ga0501038_0019076 3300049574 Bacteria 6184
356 Ga0501038_0035281 3300049574 Bacteria 4391
357 Ga0501038_0076939 3300049574 Bacteria 2818
358 Ga0501038_0079017 3300049574 Bacteria 2775
359 Ga0501038_0095692 3300049574 Bacteria 2480
360 Ga0501039_0024279 3300049575 Bacteria 4655
361 Ga0501039_0039572 3300049575 Bacteria 3641
362 Ga0501039_0143449 3300049575 Bacteria 1876
363 Ga0501039_0162768 3300049575 Bacteria 1754
364 Ga0501039_0163233 3300049575 Bacteria 1751
365 Ga0501040_0013655 3300049576 Bacteria 5341
366 Ga0501040_0027140 3300049576 Bacteria 3854
367 Ga0501040_0041823 3300049576 Bacteria 3122
368 Ga0501040_0209081 3300049576 Bacteria 1387
369 Ga0501041_0031061 3300049577 Bacteria 3225
370 Ga0501041_0078819 3300049577 Bacteria 2027
371 Ga0501041_0103783 3300049577 Bacteria 1761
372 Ga0501042_0007935 3300049578 Bacteria 6982
373 Ga0501042_0010639 3300049578 Bacteria 6180
374 Ga0501042_0199105 3300049578 Bacteria 1444
375 Ga0501043_0000736 3300049579 Bacteria 29004
376 Ga0501043_0010338 3300049579 Bacteria 7316
377 Ga0501043_0105872 3300049579 Bacteria 2209
378 Ga0501043_0180562 3300049579 Bacteria 1644
379 Ga0501043_0196328 3300049579 Bacteria 1567
380 Ga0501046_0007945 3300049580 Bacteria 9282
381 Ga0501046_0030399 3300049580 Bacteria 4383
382 Ga0501046_0074525 3300049580 Bacteria 2633
383 Ga0501046_0116631 3300049580 Bacteria 2035
384 Ga0501047_0000124 3300049581 Bacteria 94721
385 Ga0501047_0012748 3300049581 Bacteria 7964
386 Ga0501047_0029328 3300049581 Bacteria 5307
387 Ga0501047_0043610 3300049581 Bacteria 4333
388 Ga0501047_0096714 3300049581 Bacteria 2831
389 Ga0501047_0141056 3300049581 Bacteria 2288
390 Ga0501047_0180580 3300049581 Bacteria 1977
391 Ga0501047_0199073 3300049581 Bacteria 1864
392 Ga0501047_0202112 3300049581 Bacteria 1848
393 Ga0501047_0223703 3300049581 Bacteria 1737
394 Ga0501048_0008611 3300049582 Bacteria 7703
395 Ga0501048_0115145 3300049582 Bacteria 1899
396 Ga0501067_0001307 3300049583 Bacteria 13493
397 Ga0501067_0004048 3300049583 Bacteria 8083
398 Ga0501067_0045980 3300049583 Bacteria 2423
399 Ga0501067_0062591 3300049583 Bacteria 2060
400 Ga0501068_0008727 3300049584 Bacteria 5652
401 Ga0501068_0020629 3300049584 Bacteria 3841
402 Ga0501068_0036089 3300049584 Bacteria 2954
403 Ga0501068_0063858 3300049584 Bacteria 2240
404 Ga0501068_0071661 3300049584 Bacteria 2115
405 Ga0501069_0075408 3300049585 Bacteria 1894
406 Ga0501069_0115901 3300049585 Bacteria 1528
407 Ga0501070_0000229 3300049586 Bacteria 52795
408 Ga0501070_0005227 3300049586 Bacteria 11067
409 Ga0501070_0010861 3300049586 Bacteria 7692
410 Ga0501070_0041971 3300049586 Bacteria 3809
411 Ga0501070_0050657 3300049586 Bacteria 3446
412 Ga0501070_0078669 3300049586 Bacteria 2729
413 Ga0501070_0155796 3300049586 Bacteria 1884
414 Ga0501071_0011715 3300049587 Bacteria 5918
415 Ga0501071_0012733 3300049587 Bacteria 5719
416 Ga0501071_0220436 3300049587 Bacteria 1427
417 Ga0501071_0250773 3300049587 Bacteria 1336
418 Ga0501072_0002828 3300049588 Bacteria 13022
419 Ga0501072_0009532 3300049588 Bacteria 7385
420 Ga0501072_0085666 3300049588 Bacteria 2500
421 Ga0501073_0009708 3300049589 Bacteria 7090
422 Ga0501073_0010790 3300049589 Bacteria 6689
423 Ga0501073_0017780 3300049589 Bacteria 5146
424 Ga0501073_0021727 3300049589 Bacteria 4623
425 Ga0501073_0041756 3300049589 Bacteria 3240
426 Ga0501073_0069535 3300049589 Bacteria 2453
427 Ga0501073_0077738 3300049589 Bacteria 2309
428 Ga0501073_0129309 3300049589 Bacteria 1750
429 Ga0501074_0023598 3300049590 Bacteria 4471
430 Ga0501074_0028354 3300049590 Bacteria 4058
431 Ga0501074_0119904 3300049590 Bacteria 1881
432 Ga0501074_0160520 3300049590 Bacteria 1605
433 Ga0501075_0005275 3300049591 Bacteria 8833
434 Ga0501075_0114962 3300049591 Bacteria 2046
435 Ga0501076_0006327 3300049592 Bacteria 8581
436 Ga0501076_0025489 3300049592 Bacteria 4575
437 Ga0501076_0093490 3300049592 Bacteria 2420
438 Ga0501077_0098593 3300049593 Bacteria 1852
439 Ga0501079_0016277 3300049741 Bacteria 5682
440 Ga0501079_0035052 3300049741 Bacteria 3861
441 Ga0501079_0042222 3300049741 Bacteria 3522
442 Ga0501079_0065430 3300049741 Bacteria 2804
443 Ga0501080_0000130 3300049742 Bacteria 53465
444 Ga0501080_0007746 3300049742 Bacteria 9710
445 Ga0501080_0016328 3300049742 Bacteria 6855
446 Ga0501080_0024231 3300049742 Bacteria 5626
447 Ga0501080_0027681 3300049742 Bacteria 5270
448 Ga0501080_0043335 3300049742 Bacteria 4190
449 Ga0501080_0089934 3300049742 Bacteria 2852
450 Ga0501080_0103359 3300049742 Bacteria 2642
451 Ga0501080_0110525 3300049742 Bacteria 2547
452 Ga0501080_0149062 3300049742 Bacteria 2163
453 Ga0501080_0367428 3300049742 Bacteria 1297
454 Ga0501081_0003672 3300049743 Bacteria 9825
455 Ga0501081_0103416 3300049743 Bacteria 2015
456 Ga0501083_0000480 3300049744 Bacteria 25565
457 Ga0501083_0011760 3300049744 Bacteria 6135
458 Ga0501083_0011873 3300049744 Bacteria 6103
459 Ga0501083_0013234 3300049744 Bacteria 5766
460 Ga0501083_0077118 3300049744 Bacteria 2212
461 Ga0501083_0083711 3300049744 Bacteria 2113
462 Ga0501083_0087651 3300049744 Bacteria 2058
463 Ga0501035_0000373 3300049822 Bacteria 51518
464 Ga0501035_0004040 3300049822 Bacteria 13976
465 Ga0501035_0164738 3300049822 Bacteria 1917
466 Ga0501035_0180185 3300049822 Bacteria 1820
467 Ga0501035_0210966 3300049822 Bacteria 1661
468 Ga0501044_0023125 3300049823 Bacteria 6616
469 Ga0501044_0039770 3300049823 Bacteria 4904
470 Ga0501044_0060321 3300049823 Bacteria 3884
471 Ga0501044_0075405 3300049823 Bacteria 3424
472 Ga0501044_0135969 3300049823 Bacteria 2449
473 Ga0501044_0185250 3300049823 Bacteria 2047
474 Ga0501044_0228418 3300049823 Bacteria 1809
475 Ga0501045_0011533 3300049824 Bacteria 6207
476 Ga0501045_0104871 3300049824 Bacteria 2094
477 Ga0501045_0178045 3300049824 Bacteria 1584
478 nmdc:mga03n38_33757_c1 3300050490 Bacteria 2180
479 nmdc:mga06z11_35768_c1 3300050494 Bacteria 2447
480 nmdc:mga04h51_971_c1 3300050495 Bacteria 6630
481 nmdc:mga07m45_37653_c1 3300050496 Bacteria 2698
482 nmdc:mga05p37_156440_c1 3300050507 Bacteria 2785
483 nmdc:mga05p37_182147_c1 3300050507 Bacteria 2555
484 nmdc:mga05p37_313720_c1 3300050507 Bacteria 1858
485 nmdc:mga05p37_82638_c1 3300050507 Bacteria 3958
486 nmdc:mga09592_29249_c1 3300050508 Bacteria 4582
487 nmdc:mga0qj67_35336_c1 3300050509 Bacteria 3907
488 nmdc:mga0qj67_7547_c1 3300050509 Bacteria 8036
489 nmdc:mga06r32_1985_c1 3300050510 Bacteria 18277
490 nmdc:mga06r32_52676_c1 3300050510 Bacteria 3898
491 nmdc:mga06r32_55613_c1 3300050510 Bacteria 3796
492 nmdc:mga06r32_86904_c1 3300050510 Bacteria 3050
493 nmdc:mga08y16_20054_c1 3300050511 Bacteria 7053
494 nmdc:mga08x19_167701_c1 3300050514 Bacteria 1494
495 nmdc:mga0a205_88269_c1 3300050515 Bacteria 2997
496 Ga0495612_0010743 3300053078 Bacteria 3697
497 Ga0495595_0000221 3300053084 Bacteria 22745
498 Ga0500651_0118691 3300053093 Bacteria 1608
499 Ga0500651_0144565 3300053093 Bacteria 1431
500 Ga0500555_002895 3300053103 Bacteria 4914
501 Ga0500556_0000068 3300053104 Bacteria 103123
502 Ga0500658_0078164 3300053134 Bacteria 1410
503 Ga0500568_0000177 3300053139 Bacteria 55762
504 Ga0500568_0044613 3300053139 Bacteria 1767
505 Ga0500604_0009366 3300053151 Bacteria 2609
506 Ga0500616_0000001 3300053153 Bacteria 1986011
507 Ga0500620_000267 3300053155 Bacteria 10143
508 Ga0500620_001565 3300053155 Bacteria 4290
509 Ga0500645_000051 3300053730 Bacteria 98521
510 Ga0501084_0009054 3300054114 Bacteria 8236
511 Ga0501084_0010394 3300054114 Bacteria 7695
512 Ga0501084_0012288 3300054114 Bacteria 7091
513 Ga0501084_0019577 3300054114 Bacteria 5640
514 Ga0501084_0024425 3300054114 Bacteria 5042
515 Ga0501084_0072722 3300054114 Bacteria 2880
516 Ga0501084_0130091 3300054114 Bacteria 2119
517 Ga0501082_0000046 3300060353 Bacteria 86307
518 Ga0501082_0006510 3300060353 Bacteria 10128
519 Ga0501082_0015911 3300060353 Bacteria 6470
520 Ga0501082_0055241 3300060353 Bacteria 3421
521 Ga0501082_0096097 3300060353 Bacteria 2561
522 Ga0530510_0073466 3300061734 Bacteria 2482
523 2503199982 2503198000 Bacteria 6884444
524 2509118504 2508501123 Bacteria 6283661
525 2509142568 2508501127 Bacteria 7037543
526 2510319275 2510065059 Bacteria 6847884
527 2511390315 2511231027 Bacteria 5013807
528 2512932550 2512875016 Bacteria 6529530
529 2512960567 2512875024 Bacteria 7195110
530 2513608662 2513237090 Bacteria 7096802
531 2514036343 2513237164 Bacteria 7563725
532 2514416476 2513237305 Bacteria 7293571
533 2514587561 2513237351 Bacteria 6968952
534 2545674357 2545555834 Bacteria 8130841
535 2596377279 2595698237 Bacteria 6712432
536 2599936418 2599185301 Bacteria 6161860
537 2643758839 2643221547 Bacteria 4740017
538 2643774394 2643221550 Bacteria 4619371
539 2643776549 2643221551 Bacteria 3750538
540 2643794996 2643221555 Bacteria 3749717
541 2643839080 2643221564 Bacteria 4193379
542 2643984857 2643221595 Bacteria 6565519
543 2644133233 2643221623 Bacteria 5239945
544 2644153187 2643221627 Bacteria 6761570
545 2688597228 2687453392 Bacteria 6880454
546 2694628708 2693429783 Bacteria 7019804
547 2694637378 2693429784 Bacteria 7241525
548 2723574432 2721755686 Bacteria 7343952
549 2739307505 2738543024 Bacteria 5603683
550 2756671519 2756170246 Bacteria 7451806
551 2765466365 2765235802 Bacteria 5618596
552 2770198996 2767802442 Bacteria 5747986
553 2776285006 2775506904 Bacteria 5954060
554 2792747984 2791355123 Bacteria 8049106
555 2828308625 2828305725 Bacteria 4916900
556 2837654175 2837651117 Bacteria 3772164
557 2839998288 2839993093 Bacteria 5512535
558 2840769124 2840764183 Bacteria 6358399
559 2842696661 2842694124 Bacteria 4063419
560 2842872285 2842871566 Bacteria 4827117
561 2844008570 2844002411 Bacteria 7168230
562 2844012609 2844009547 Bacteria 6728125
563 2847675025 2847670302 Bacteria 6165597
564 2856320743 2856314179 Bacteria 6477897
565 2856323089 2856320880 Bacteria 7263508
566 2856334849 2856328259 Bacteria 6528202
567 2856341600 2856334872 Bacteria 7037011
568 2856347358 2856342000 Bacteria 7176905
569 2856354141 2856349417 Bacteria 6230045
570 2856360380 2856356410 Bacteria 6297484
571 2856368050 2856364286 Bacteria 6939991
572 2857351802 2857349434 Bacteria 7926032
573 2857373939 2857367948 Bacteria 6965560
574 2861696691 2861691609 Bacteria 5628931
575 2869163818 2869162929 Bacteria 6399702
576 2869172420 2869169390 Bacteria 6659796
577 2869237045 2869234852 Bacteria 6654993
578 2869246822 2869242130 Bacteria 6609239
579 2869251577 2869249662 Bacteria 6868783
580 2869260114 2869256925 Bacteria 6981691
581 2869271085 2869264136 Bacteria 6880765
582 2869277757 2869271264 Bacteria 6908218
583 2869282640 2869278585 Bacteria 7077053
584 2869290331 2869285874 Bacteria 6901219
585 2870789699 2870782633 Bacteria 9624083
586 2871432615 2871429161 Bacteria 6547891
587 2871436934 2871435913 Bacteria 6880295
588 2871444624 2871444079 Bacteria 6423508
589 2871453800 2871451962 Bacteria 7336357
590 2871461225 2871459585 Bacteria 6866887
591 2871469073 2871466892 Bacteria 6923287
592 2871483824 2871481445 Bacteria 6700002
593 2871493233 2871488783 Bacteria 6929816
594 2871496790 2871495908 Bacteria 6935695
595 2874109129 2874102143 Bacteria 6342645
596 2874116412 2874109183 Bacteria 6517025
597 2874122773 2874116593 Bacteria 6674494
598 2874124074 2874123672 Bacteria 7238285
599 2874134519 2874131515 Bacteria 6820270
600 2874142297 2874139085 Bacteria 7021506
601 2874152582 2874146452 Bacteria 7533118
602 2874159982 2874155637 Bacteria 6724144
603 2874167973 2874162495 Bacteria 6174670
604 2874174800 2874168670 Bacteria 8062617
605 2876365198 2876363079 Bacteria 6544991
606 2876375753 2876369609 Bacteria 6807521
607 2876385897 2876377896 Bacteria 6565995
608 2876387921 2876386047 Bacteria 6698674
609 2876398010 2876392853 Bacteria 6660880
610 2876402844 2876399893 Bacteria 6927900
611 2876410510 2876406927 Bacteria 6191900
612 2876418498 2876413966 Bacteria 6831344
613 2876422971 2876420981 Bacteria 6687741
614 2878035923 2878035449 Bacteria 6555736
615 2878734848 2878730984 Bacteria 6380721
616 2878744520 2878738818 Bacteria 7136951
617 2878750229 2878745973 Bacteria 6867388
618 2878757278 2878753008 Bacteria 6922523
619 2878761014 2878760144 Bacteria 6823465
620 2878767978 2878767105 Bacteria 6898628
621 2878774962 2878774303 Bacteria 6108671
622 2878784356 2878781027 Bacteria 6834456
623 2881149908 2881147464 Bacteria 7779814
624 2881161054 2881155292 Bacteria 6461656
625 2881166789 2881161766 Bacteria 7127907
626 2881857993 2881853255 Bacteria 6698367
627 2882632549 2882632389 Bacteria 8154593
628 2882916298 2882912400 Bacteria 6801539
629 2885308305 2885305155 Bacteria 7348390
630 2885312902 2885312484 Bacteria 6415165
631 2885320514 2885318864 Bacteria 6729568
632 2885330830 2885326080 Bacteria 7134805
633 2885342487 2885334103 Bacteria 7216818
634 2885345263 2885342637 Bacteria 7011821
635 2885357264 2885350715 Bacteria 6787678
636 2888338309 2888337043 Bacteria 6629336
637 2888345914 2888343758 Bacteria 6611049
638 2888355146 2888350351 Bacteria 7372807
639 2889010125 2889010040 Bacteria 6749192
640 2889018204 2889016732 Bacteria 6700763
641 2889308443 2889306138 Bacteria 6358934
642 2889792912 2889790730 Bacteria 5689708
643 2889919072 2889914905 Bacteria 5702301
644 2894655591 2894652903 Bacteria 4587256
645 2902335163 2902330777 Bacteria 6395352
646 2902410619 2902405164 Bacteria 6784948
647 2903450198 2903448605 Bacteria 7357801
648 2903501005 2903492973 Bacteria 13473544
649 2903504447 2903492973 Bacteria 13473544
650 2903518628 2903513507 Bacteria 6344008
651 2903522067 2903521522 Bacteria 6525694
652 2903528445 2903528002 Bacteria 6586099
653 2903541586 2903540706 Bacteria 7062119
654 2904582248 2904578770 Bacteria 5302906
655 2904664661 2904659560 Bacteria 6685615
656 2906312587 2906308376 Bacteria 6841989
657 2906325296 2906321335 Bacteria 6579571
658 2906330694 2906328253 Bacteria 6585166
659 2906369646 2906363423 Bacteria 6856682
660 2906376953 2906370794 Bacteria 6881062
661 2906383587 2906378014 Bacteria 6911440
662 2906388710 2906386501 Bacteria 5977019
663 2906403226 2906401398 Bacteria 6693206
664 2906411340 2906408224 Bacteria 6162342
665 2906419808 2906414383 Bacteria 6580790
666 2906430842 2906427513 Bacteria 6375796
667 2909046428 2909042592 Bacteria 6499737
668 2919122971 2919119836 Bacteria 5208557
669 2919452288 2919450847 Bacteria 5631160
670 2922134240 2922130491 Bacteria 7173936
671 2922155911 2922151315 Bacteria 6902399
672 2922158895 2922158528 Bacteria 6573167
673 2922177608 2922172374 Bacteria 6167644
674 2922181258 2922178524 Bacteria 6025201
675 2922190392 2922185730 Bacteria 7113964
676 2924711180 2924710171 Bacteria 6752351
677 2924722799 2924718760 Bacteria 6331356
678 2924731691 2924726620 Bacteria 6271473
679 2924737891 2924733363 Bacteria 7574837
680 2924747568 2924741084 Bacteria 6661321
681 2924749714 2924748358 Bacteria 6154725
682 2924768129 2924762789 Bacteria 6561353
683 2924782550 2924776078 Bacteria 7492003
684 2924786583 2924784321 Bacteria 7416538
685 2928130730 2928125067 Bacteria 5937560
686 2928524209 2928521798 Bacteria 4960112
687 2937819268 2937813078 Bacteria 7783518
688 2937842627 2937836603 Bacteria 6811263
689 2937848381 2937843397 Bacteria 5256375
690 2937852014 2937848649 Bacteria 6983481
691 2937862674 2937861824 Bacteria 6660327
692 2937874647 2937868953 Bacteria 6639878
693 2937881192 2937877337 Bacteria 7246526
694 2937977283 2937972304 Bacteria 7532020
695 2937995443 2937994558 Bacteria 7036190
696 2938021119 2938014810 Bacteria 6700592
697 2954013157 2954011201 Bacteria 4762601
698 2958039423 2958034702 Bacteria 6989922
699 2958052948 2958041894 Bacteria 13082850
700 2958064931 2958064165 Bacteria 7158582
701 2958073774 2958071322 Bacteria 6815895
702 2958088251 2958084443 Bacteria 7312792
703 2958096770 2958092219 Bacteria 6861151
704 2958102165 2958100919 Bacteria 6800575
705 2958109805 2958108152 Bacteria 6681128
706 2958115502 2958115193 Bacteria 6923548
707 2958129807 2958122699 Bacteria 7280457
708 2958134719 2958130278 Bacteria 6897202
709 2958138847 2958137437 Bacteria 6050276
710 2958147687 2958144490 Bacteria 6677056
711 2958158856 2958158011 Bacteria 6058449
712 2958165916 2958165035 Bacteria 6906348
713 2958175237 2958172287 Bacteria 6716688
714 2958186526 2958179912 Bacteria 6874908
715 2961085025 2961077736 Bacteria 7079850
716 2961119659 2961114664 Bacteria 6680456
717 2961133876 2961127735 Bacteria 7196641
718 2961139811 2961136820 Bacteria 6775228
719 2961164379 2961163497 Bacteria 6901077
720 2961175393 2961170736 Bacteria 7072258
721 2961184383 2961183825 Bacteria 6688536
722 2963646653 2963644680 Bacteria 6530403
723 2965019365 2965018300 Bacteria 6883036
724 2965027604 2965025482 Bacteria 6532201
725 2965036274 2965032056 Bacteria 6887443
726 2965043313 2965040258 Bacteria 6855979
727 2965051529 2965047637 Bacteria 6623551
728 2965093495 2965089291 Bacteria 6866420
729 2965116048 2965110997 Bacteria 6693150
730 2965126585 2965119406 Bacteria 6956431
731 2967999605 2967996073 Bacteria 6787468
732 2968007963 2968003550 Bacteria 6929263
733 2968020750 2968016561 Bacteria 7022047
734 2968090554 2968083720 Bacteria 7351627
735 2968094760 2968091066 Bacteria 6052692
736 2968099329 2968097103 Bacteria 6107094
737 2968115914 2968110612 Bacteria 6814636
738 2968119299 2968117919 Bacteria 6536078
739 2968133670 2968128360 Bacteria 6270294
740 2968146532 2968138860 Bacteria 6605449
741 2968172780 2968171901 Bacteria 6894245
742 2970474047 2970469710 Bacteria 6969209
743 2970490687 2970489779 Bacteria 6517260
744 2970507981 2970503327 Bacteria 7099517
745 2970515314 2970510686 Bacteria 7006402
746 2970527367 2970524798 Bacteria 6840927
747 2970534292 2970532167 Bacteria 6553173
748 2970552305 2970547951 Bacteria 6931819
749 2970555872 2970554993 Bacteria 6814252
750 2970597249 2970593180 Bacteria 7073582
751 2970622761 2970619444 Bacteria 6986144
752 2970632723 2970627176 Bacteria 6680862
753 2977826437 2977821940 Bacteria 6906439
754 2977832671 2977828996 Bacteria 7007971
755 2977848375 2977843712 Bacteria 6753583
756 2977855579 2977851361 Bacteria 6694324
757 2977860920 2977858184 Bacteria 6215359
758 2977865158 2977864932 Bacteria 7534097
759 2977880121 2977872689 Bacteria 7270173
760 2977899141 2977898635 Bacteria 6675551
761 2977910146 2977907340 Bacteria 6577984
762 2977918109 2977915119 Bacteria 6829656
763 2977922971 2977922695 Bacteria 6956781
764 2977940314 2977935797 Bacteria 6252826
765 2977944747 2977942078 Bacteria 7570577
766 2977953129 2977950692 Bacteria 6893264
767 2977962313 2977957713 Bacteria 6877875
768 2977976051 2977971508 Bacteria 7472917
769 2977990136 2977986579 Bacteria 6581278
770 2979715116 2979710463 Bacteria 6785254
771 2979749048 2979742915 Bacteria 7301278
772 2979766347 2979764755 Bacteria 6610066
773 2979776139 2979772303 Bacteria 6618277
774 2979785309 2979779861 Bacteria 6219781
775 2979813165 2979808191 Bacteria 7179355
776 2987638986 2987636660 Bacteria 8088555
777 2987647979 2987645492 Bacteria 6117018
778 2987653665 2987652177 Bacteria 6969023
779 2987660383 2987659509 Bacteria 6966464
780 2987671449 2987666974 Bacteria 6509233
781 2987675405 2987673487 Bacteria 6884027
782 2996312096 2996310559 Bacteria 6357320
783 2996338721 2996336353 Bacteria 5511628
784 2996344256 2996341866 Bacteria 6643098
785 2996352633 2996348954 Bacteria 7239054
786 2996390013 2996386984 Bacteria 6978667
787 3000139616 3000135777 Bacteria 6891109
788 3002145117 3002141150 Bacteria 5254435
789 3003667394 3003665799 Bacteria 7279786
790 3004167645 3004167301 Bacteria 8330599
791 3004189434 3004188549 Bacteria 6952365
792 3004199810 3004195979 Bacteria 6776956
793 3004204771 3004203850 Bacteria 7307914
794 3004218048 3004211236 Bacteria 7417683
795 3004220905 3004218560 Bacteria 7421728
796 3004235701 3004232784 Bacteria 6662140
797 3004245301 3004239961 Bacteria 6892290
798 3004279315 3004275668 Bacteria 7114440
799 3004335750 3004334049 Bacteria 8449246
800 637075644 637000159 Bacteria 7596297
801 641645039 641522639 Bacteria 7737025
802 643599412 643348564 Bacteria 8839022
803 649871782 649633066 Bacteria 6690028
804 8001845965 8001845381 Bacteria 5804942
805 8002291657 8002285264 Bacteria 6717907
806 8004303897 8004300914 Bacteria 6132239
807 8004321191 8004312739 Bacteria 7444653
808 8004363745 8004361976 Bacteria 6858373
809 8004378853 8004374579 Bacteria 6898112
810 8004392537 8004387939 Bacteria 7049250
811 8004395855 8004395343 Bacteria 6620908
812 8004446516 8004445564 Bacteria 6322258
813 8004635419 8004633249 Bacteria 6723080
814 8004645139 8004640170 Bacteria 6723001
815 8004712066 8004703790 Bacteria 8006957
816 8004718846 8004714634 Bacteria 6776161
817 8004730422 8004727605 Bacteria 6643904
818 8054566246 8054563764 Bacteria 5592885
819 8055619461 8055617313 Bacteria 7548464
820 Ga0400484_39394
821 JGI24735J21928_10031910
822 JGI25156J39149_1007095
823 JGI25157J39369_1000706
824 JGI25159J45721_1004883
825 JGI25151J46595_10000436
826 JGI25165J46597_1000042
827 JGI25153J46596_10003217
828 JGI25160J50197_1017137
829 Ga0055542_1000761
830 Ga0065712_10001938
831 Ga0065712_10143452
832 Ga0070680_100020062
833 Ga0068868_100079930
834 Ga0070691_10024536
835 Ga0070691_10052663
836 Ga0070687_100002321
837 Ga0070668_100205235
838 Ga0070675_100258997
839 Ga0070674_100000478
840 Ga0070688_100001954
841 Ga0070703_10001434
842 Ga0070709_10126477
843 Ga0070701_10019338
844 Ga0070705_100001394
845 Ga0070700_100003215
846 Ga0070694_100002550
847 Ga0070708_100006906
848 Ga0070708_100014663
849 Ga0070663_100046982
850 Ga0070678_100154570
851 Ga0070662_100047111
852 Ga0070662_100080774
853 Ga0070681_10174780
854 Ga0068867_100162151
855 Ga0070706_100000232
856 Ga0070706_100022752
857 Ga0070707_100006355
858 Ga0070707_100011702
859 Ga0070698_100005421
860 Ga0070699_100012031
861 Ga0070699_100220178
862 Ga0070679_100041157
863 Ga0070684_100296732
864 Ga0070697_100005908
865 Ga0070697_100175677
866 Ga0070697_100209410
867 Ga0068853_100014287
868 Ga0070695_100001172
869 Ga0070695_100009322
870 Ga0070696_100001543
871 Ga0070693_100031015
872 Ga0070665_100026701
873 Ga0070665_100054407
874 Ga0070665_100169391
875 Ga0070704_100043512
876 Ga0068855_100053133
877 Ga0068857_100070483
878 Ga0068856_100019963
879 Ga0070702_100036778
880 Ga0068852_100198937
881 Ga0068864_100014202
882 Ga0068861_100090712
883 Ga0068861_100099490
884 Ga0068862_100007019
885 Ga0081455_10216358
886 Ga0081538_10027435
887 Ga0081540_1010027
888 Ga0081540_1011749
889 Ga0081539_10000609
890 Ga0081539_10021387
891 Ga0070717_10001033
892 Ga0070717_10003023
893 Ga0075363_100032940
894 Ga0075364_10004279
895 Ga0075367_10005385
896 Ga0075367_10058724
897 Ga0075367_10073349
898 Ga0075428_100031858
899 Ga0075428_100032615
900 Ga0075428_100054425
901 Ga0075428_100056314
902 Ga0075428_100071008
903 Ga0075430_100074413
904 Ga0075430_100175236
905 Ga0075431_100001046
906 Ga0075431_100002212
907 Ga0075431_100045647
908 Ga0105240_10016012
909 Ga0105240_10104652
910 Ga0111539_10224306
911 Ga0111539_10297056
912 Ga0111539_10507537
913 Ga0114129_10016469
914 Ga0114129_10148020
915 Ga0114129_10421602
916 Ga0105243_10149681
917 Ga0105238_10012662
918 Ga0105249_10006261
919 Ga0157373_10173325
920 Ga0157374_10239902
921 Ga0163162_10153750
922 Ga0157379_10132939
923 Ga0182007_10012507
924 Ga0206353_11955115
925 Ga0213872_10063372
926 Ga0213876_10000915
927 Ga0213876_10072220
928 Ga0213875_10000391
929 Ga0213875_10003194
930 Ga0213875_10006561
931 Ga0213871_10011082
932 Ga0224572_1001846
933 Ga0209026_1000029
934 Ga0209148_1000080
935 Ga0209759_1000040
936 Ga0209233_1000028
937 Ga0209233_1003389
938 Ga0209455_1000171
939 Ga0209130_1000167
940 Ga0209025_1000077
941 Ga0209025_1003608
942 Ga0209025_1015789
943 Ga0209758_1000036
944 Ga0209758_1004420
945 Ga0209758_1004860
946 Ga0207426_1000239
947 Ga0207653_10003312
948 Ga0207699_10052251
949 Ga0207643_10104917
950 Ga0207705_10105819
951 Ga0207684_10000489
952 Ga0207707_10018671
953 Ga0207695_10195990
954 Ga0207663_10141100
955 Ga0207652_10066221
956 Ga0207652_10094416
957 Ga0207646_10003498
958 Ga0207646_10029731
959 Ga0207646_10321722
960 Ga0207700_10045456
961 Ga0207664_10050419
962 Ga0207644_10191508
963 Ga0207689_10030419
964 Ga0207661_10080104
965 Ga0207703_10153903
966 Ga0207678_10240532
967 Ga0207708_10012179
968 Ga0207708_10031759
969 Ga0207702_10283613
970 Ga0207641_10185394
971 Ga0207676_10026932
972 Ga0207674_10005484
973 Ga0207675_100040029
974 Ga0207675_100138927
975 Ga0207683_10039963
976 Ga0207698_10019455
977 Ga0209813_10002328
978 Ga0207428_10016982
979 Ga0268266_10319078
980 Ga0268265_10004578
981 Ga0265318_10049959
982 Ga0265322_10000068
983 Ga0265325_10001708
984 Ga0265325_10039960
985 Ga0265325_10077814
986 Ga0265340_10002223
987 Ga0265340_10018326
988 Ga0265339_10001551
989 Ga0265339_10019507
990 Ga0265339_10064232
991 Ga0265316_10003139
992 Ga0265316_10012132
993 Ga0265316_10038081
994 Ga0307513_10078364
995 Ga0265313_10000448
996 Ga0265313_10020220
997 Ga0265313_10020466
998 Ga0307508_10076676
999 Ga0316579_10006580
1000 Ga0316579_10020859
1001 Ga0316579_10040775
1002 Ga0265314_10034245
1003 Ga0265314_10096143
1004 Ga0265342_10009206
1005 Ga0316576_10111976
1006 Ga0316578_10002543
1007 Ga0316578_10105925
1008 Ga0307516_10011659
1009 Ga0316577_10151465
1010 Ga0307410_10166749
1011 Ga0316580_10004219
1012 Ga0307510_10045718
1013 Ga0373926_0035757
1014 Ga0373956_0001924
1015 Ga0373957_0040217
1016 Ga0373924_0008451
1017 Ga0373935_0016237
1018 Ga0373935_0118736
1019 Ga0373927_0035758
1020 Ga0373933_0002515
1021 Ga0373947_0021014
1022 Ga0373937_0031797
1023 Ga0316582_0010511
1024 Ga0316582_0043042
1025 Ga0316582_0048188
1026 Ga0316584_0000872
1027 Ga0316584_0015819
1028 Ga0316584_0032464
1029 Ga0316584_0071843
1030 Ga0316584_0080005
1031 Ga0316584_0156634
1032 Ga0373925_0287994
1033 Ga0395900_0340203
1034 Ga0316581_0000782
1035 Ga0316581_0029635
1036 Ga0436364_0010042
1037 Ga0436364_0549528
1038 Ga0436364_0685371
1039 Ga0400483_017255
1040 Ga0400483_165172
1041 Ga0400483_183052
1042 Ga0400483_236881
1043 Ga0400483_265909
1044 Ga0436365_0167783
1045 Ga0436365_0536235
1046 Ga0436365_0693504
1047 Ga0436365_0831867
1048 Ga0436360_0064987
1049 Ga0436361_0301719
1050 Ga0436361_0340312
1051 Ga0436361_0349975
1052 Ga0436361_1209447
1053 Ga0436363_0573820
1054 Ga0436363_0715384
1055 Ga0436363_1484825
1056 Ga0436363_1547701
1057 Ga0436362_0969859
1058 Ga0439440_0023721
1059 Ga0453683_0054776
1060 Ga0453684_0001430
1061 Ga0453684_0040212
1062 Ga0453684_0056492
1063 Ga0453684_0059934
1064 Ga0453684_0340199
1065 Ga0466968_0002176
1066 Ga0466968_0005181
1067 Ga0466960_0037682
1068 Ga0451576_0000009
1069 Ga0451576_0002127
1070 Ga0451576_0558292
1071 Ga0466967_0188526
1072 Ga0495629_0012044
1073 Ga0495638_0003543
1074 Ga0495638_0054870
1075 Ga0495651_0003394
1076 Ga0495653_0004556
1077 Ga0495580_0072748
1078 Ga0495582_0047458
1079 Ga0495608_0002249
1080 Ga0495610_0013771
1081 Ga0495618_0001172
1082 Ga0495628_0034175
1083 Ga0495643_0092242
1084 Ga0495652_0004437
1085 Ga0495640_0005042
1086 Ga0495587_0021831
1087 Ga0495667_0044894
1088 Ga0495634_0007035
1089 Ga0495625_0038244
1090 Ga0495635_0005384
1091 Ga0495657_0025526
1092 Ga0495623_0011358
1093 Ga0495646_0006441
1094 Ga0495613_0091243
1095 Ga0495670_0022015
1096 Ga0495600_0001574
1097 Ga0495604_0000150
1098 Ga0495674_0040568
1099 Ga0495676_0016306
1100 Ga0495680_0000699
1101 Ga0495675_0007130
1102 Ga0495686_0069331
1103 Ga0496100_0249835
1104 Ga0496102_0039194
1105 Ga0496102_0199713
1106 Ga0496104_0001490
1107 Ga0496104_0003654
1108 Ga0496104_0006182
1109 Ga0496105_0002850
1110 Ga0496105_0003480
1111 Ga0496105_0051925
1112 Ga0496106_0011468
1113 Ga0496106_0206710
1114 Ga0496108_0003952
1115 Ga0496108_0005160
1116 Ga0496109_0003935
1117 Ga0496109_0004749
1118 Ga0496110_0000113
1119 Ga0496110_0017309
1120 Ga0496110_0035124
1121 Ga0496111_0000458
1122 Ga0496111_0000718
1123 Ga0496111_0020182
1124 Ga0496112_0019676
1125 Ga0496112_0098480
1126 Ga0496112_0301066
1127 Ga0496113_0002796
1128 Ga0496113_0014258
1129 Ga0496114_0016673
1130 Ga0496115_0014819
1131 Ga0496115_0042790
1132 Ga0496118_0055136
1133 Ga0496118_0111385
1134 Ga0496119_0001398
1135 Ga0496120_0001370
1136 Ga0496121_0070628
1137 Ga0496121_0115011
1138 Ga0496122_0001032
1139 Ga0496123_0000806
1140 Ga0496123_0051165
1141 Ga0496125_0104048
1142 Ga0501031_0005116
1143 Ga0501032_0000238
1144 Ga0501032_0017280
1145 Ga0501032_0073694
1146 Ga0501032_0081690
1147 Ga0501032_0086333
1148 Ga0501032_0142155
1149 Ga0501033_0016486
1150 Ga0501033_0023537
1151 Ga0501033_0120707
1152 Ga0501033_0185071
1153 Ga0501034_0002653
1154 Ga0501034_0004312
1155 Ga0501034_0014877
1156 Ga0501034_0020143
1157 Ga0501034_0030547
1158 Ga0501034_0032884
1159 Ga0501034_0049137
1160 Ga0501034_0083119
1161 Ga0501034_0097390
1162 Ga0501034_0391603
1163 Ga0501036_0001536
1164 Ga0501036_0003303
1165 Ga0501036_0058034
1166 Ga0501036_0107592
1167 Ga0501036_0129714
1168 Ga0501036_0143885
1169 Ga0501037_0039910
1170 Ga0501037_0043039
1171 Ga0501037_0160884
1172 Ga0501037_0188373
1173 Ga0501038_0009911
1174 Ga0501038_0019076
1175 Ga0501038_0035281
1176 Ga0501038_0076939
1177 Ga0501038_0079017
1178 Ga0501038_0095692
1179 Ga0501039_0024279
1180 Ga0501039_0039572
1181 Ga0501039_0143449
1182 Ga0501039_0162768
1183 Ga0501039_0163233
1184 Ga0501040_0013655
1185 Ga0501040_0027140
1186 Ga0501040_0041823
1187 Ga0501040_0209081
1188 Ga0501041_0031061
1189 Ga0501041_0078819
1190 Ga0501041_0103783
1191 Ga0501042_0007935
1192 Ga0501042_0010639
1193 Ga0501042_0199105
1194 Ga0501043_0000736
1195 Ga0501043_0010338
1196 Ga0501043_0105872
1197 Ga0501043_0180562
1198 Ga0501043_0196328
1199 Ga0501046_0007945
1200 Ga0501046_0030399
1201 Ga0501046_0074525
1202 Ga0501046_0116631
1203 Ga0501047_0000124
1204 Ga0501047_0012748
1205 Ga0501047_0029328
1206 Ga0501047_0043610
1207 Ga0501047_0096714
1208 Ga0501047_0141056
1209 Ga0501047_0180580
1210 Ga0501047_0199073
1211 Ga0501047_0202112
1212 Ga0501047_0223703
1213 Ga0501048_0008611
1214 Ga0501048_0115145
1215 Ga0501067_0001307
1216 Ga0501067_0004048
1217 Ga0501067_0045980
1218 Ga0501067_0062591
1219 Ga0501068_0008727
1220 Ga0501068_0020629
1221 Ga0501068_0036089
1222 Ga0501068_0063858
1223 Ga0501068_0071661
1224 Ga0501069_0075408
1225 Ga0501069_0115901
1226 Ga0501070_0000229
1227 Ga0501070_0005227
1228 Ga0501070_0010861
1229 Ga0501070_0041971
1230 Ga0501070_0050657
1231 Ga0501070_0078669
1232 Ga0501070_0155796
1233 Ga0501071_0011715
1234 Ga0501071_0012733
1235 Ga0501071_0220436
1236 Ga0501071_0250773
1237 Ga0501072_0002828
1238 Ga0501072_0009532
1239 Ga0501072_0085666
1240 Ga0501073_0009708
1241 Ga0501073_0010790
1242 Ga0501073_0017780
1243 Ga0501073_0021727
1244 Ga0501073_0041756
1245 Ga0501073_0069535
1246 Ga0501073_0077738
1247 Ga0501073_0129309
1248 Ga0501074_0023598
1249 Ga0501074_0028354
1250 Ga0501074_0119904
1251 Ga0501074_0160520
1252 Ga0501075_0005275
1253 Ga0501075_0114962
1254 Ga0501076_0006327
1255 Ga0501076_0025489
1256 Ga0501076_0093490
1257 Ga0501077_0098593
1258 Ga0501079_0016277
1259 Ga0501079_0035052
1260 Ga0501079_0042222
1261 Ga0501079_0065430
1262 Ga0501080_0000130
1263 Ga0501080_0007746
1264 Ga0501080_0016328
1265 Ga0501080_0024231
1266 Ga0501080_0027681
1267 Ga0501080_0043335
1268 Ga0501080_0089934
1269 Ga0501080_0103359
1270 Ga0501080_0110525
1271 Ga0501080_0149062
1272 Ga0501080_0367428
1273 Ga0501081_0003672
1274 Ga0501081_0103416
1275 Ga0501083_0000480
1276 Ga0501083_0011760
1277 Ga0501083_0011873
1278 Ga0501083_0013234
1279 Ga0501083_0077118
1280 Ga0501083_0083711
1281 Ga0501083_0087651
1282 Ga0501035_0000373
1283 Ga0501035_0004040
1284 Ga0501035_0164738
1285 Ga0501035_0180185
1286 Ga0501035_0210966
1287 Ga0501044_0023125
1288 Ga0501044_0039770
1289 Ga0501044_0060321
1290 Ga0501044_0075405
1291 Ga0501044_0135969
1292 Ga0501044_0185250
1293 Ga0501044_0228418
1294 Ga0501045_0011533
1295 Ga0501045_0104871
1296 Ga0501045_0178045
1297 nmdc:mga03n38_33757_c1
1298 nmdc:mga06z11_35768_c1
1299 nmdc:mga04h51_971_c1
1300 nmdc:mga07m45_37653_c1
1301 nmdc:mga05p37_156440_c1
1302 nmdc:mga05p37_182147_c1
1303 nmdc:mga05p37_313720_c1
1304 nmdc:mga05p37_82638_c1
1305 nmdc:mga09592_29249_c1
1306 nmdc:mga0qj67_35336_c1
1307 nmdc:mga0qj67_7547_c1
1308 nmdc:mga06r32_1985_c1
1309 nmdc:mga06r32_52676_c1
1310 nmdc:mga06r32_55613_c1
1311 nmdc:mga06r32_86904_c1
1312 nmdc:mga08y16_20054_c1
1313 nmdc:mga08x19_167701_c1
1314 nmdc:mga0a205_88269_c1
1315 Ga0495612_0010743
1316 Ga0495595_0000221
1317 Ga0500651_0118691
1318 Ga0500651_0144565
1319 Ga0500555_002895
1320 Ga0500556_0000068
1321 Ga0500658_0078164
1322 Ga0500568_0000177
1323 Ga0500568_0044613
1324 Ga0500604_0009366
1325 Ga0500616_0000001
1326 Ga0500620_000267
1327 Ga0500620_001565
1328 Ga0500645_000051
1329 Ga0501084_0009054
1330 Ga0501084_0010394
1331 Ga0501084_0012288
1332 Ga0501084_0019577
1333 Ga0501084_0024425
1334 Ga0501084_0072722
1335 Ga0501084_0130091
1336 Ga0501082_0000046
1337 Ga0501082_0006510
1338 Ga0501082_0015911
1339 Ga0501082_0055241
1340 Ga0501082_0096097
1341 Ga0530510_0073466
1342 2503199982
1343 2509118504
1344 2509142568
1345 2510319275
1346 2511390315
1347 2512932550
1348 2512960567
1349 2513608662
1350 2514036343
1351 2514416476
1352 2514587561
1353 2545674357
1354 2596377279
1355 2599936418
1356 2643758839
1357 2643774394
1358 2643776549
1359 2643794996
1360 2643839080
1361 2643984857
1362 2644133233
1363 2644153187
1364 2688597228
1365 2694628708
1366 2694637378
1367 2723574432
1368 2739307505
1369 2756671519
1370 2765466365
1371 2770198996
1372 2776285006
1373 2792747984
1374 2828308625
1375 2837654175
1376 2839998288
1377 2840769124
1378 2842696661
1379 2842872285
1380 2844008570
1381 2844012609
1382 2847675025
1383 2856320743
1384 2856323089
1385 2856334849
1386 2856341600
1387 2856347358
1388 2856354141
1389 2856360380
1390 2856368050
1391 2857351802
1392 2857373939
1393 2861696691
1394 2869163818
1395 2869172420
1396 2869237045
1397 2869246822
1398 2869251577
1399 2869260114
1400 2869271085
1401 2869277757
1402 2869282640
1403 2869290331
1404 2870789699
1405 2871432615
1406 2871436934
1407 2871444624
1408 2871453800
1409 2871461225
1410 2871469073
1411 2871483824
1412 2871493233
1413 2871496790
1414 2874109129
1415 2874116412
1416 2874122773
1417 2874124074
1418 2874134519
1419 2874142297
1420 2874152582
1421 2874159982
1422 2874167973
1423 2874174800
1424 2876365198
1425 2876375753
1426 2876385897
1427 2876387921
1428 2876398010
1429 2876402844
1430 2876410510
1431 2876418498
1432 2876422971
1433 2878035923
1434 2878734848
1435 2878744520
1436 2878750229
1437 2878757278
1438 2878761014
1439 2878767978
1440 2878774962
1441 2878784356
1442 2881149908
1443 2881161054
1444 2881166789
1445 2881857993
1446 2882632549
1447 2882916298
1448 2885308305
1449 2885312902
1450 2885320514
1451 2885330830
1452 2885342487
1453 2885345263
1454 2885357264
1455 2888338309
1456 2888345914
1457 2888355146
1458 2889010125
1459 2889018204
1460 2889308443
1461 2889792912
1462 2889919072
1463 2894655591
1464 2902335163
1465 2902410619
1466 2903450198
1467 2903501005
1468 2903504447
1469 2903518628
1470 2903522067
1471 2903528445
1472 2903541586
1473 2904582248
1474 2904664661
1475 2906312587
1476 2906325296
1477 2906330694
1478 2906369646
1479 2906376953
1480 2906383587
1481 2906388710
1482 2906403226
1483 2906411340
1484 2906419808
1485 2906430842
1486 2909046428
1487 2919122971
1488 2919452288
1489 2922134240
1490 2922155911
1491 2922158895
1492 2922177608
1493 2922181258
1494 2922190392
1495 2924711180
1496 2924722799
1497 2924731691
1498 2924737891
1499 2924747568
1500 2924749714
1501 2924768129
1502 2924782550
1503 2924786583
1504 2928130730
1505 2928524209
1506 2937819268
1507 2937842627
1508 2937848381
1509 2937852014
1510 2937862674
1511 2937874647
1512 2937881192
1513 2937977283
1514 2937995443
1515 2938021119
1516 2954013157
1517 2958039423
1518 2958052948
1519 2958064931
1520 2958073774
1521 2958088251
1522 2958096770
1523 2958102165
1524 2958109805
1525 2958115502
1526 2958129807
1527 2958134719
1528 2958138847
1529 2958147687
1530 2958158856
1531 2958165916
1532 2958175237
1533 2958186526
1534 2961085025
1535 2961119659
1536 2961133876
1537 2961139811
1538 2961164379
1539 2961175393
1540 2961184383
1541 2963646653
1542 2965019365
1543 2965027604
1544 2965036274
1545 2965043313
1546 2965051529
1547 2965093495
1548 2965116048
1549 2965126585
1550 2967999605
1551 2968007963
1552 2968020750
1553 2968090554
1554 2968094760
1555 2968099329
1556 2968115914
1557 2968119299
1558 2968133670
1559 2968146532
1560 2968172780
1561 2970474047
1562 2970490687
1563 2970507981
1564 2970515314
1565 2970527367
1566 2970534292
1567 2970552305
1568 2970555872
1569 2970597249
1570 2970622761
1571 2970632723
1572 2977826437
1573 2977832671
1574 2977848375
1575 2977855579
1576 2977860920
1577 2977865158
1578 2977880121
1579 2977899141
1580 2977910146
1581 2977918109
1582 2977922971
1583 2977940314
1584 2977944747
1585 2977953129
1586 2977962313
1587 2977976051
1588 2977990136
1589 2979715116
1590 2979749048
1591 2979766347
1592 2979776139
1593 2979785309
1594 2979813165
1595 2987638986
1596 2987647979
1597 2987653665
1598 2987660383
1599 2987671449
1600 2987675405
1601 2996312096
1602 2996338721
1603 2996344256
1604 2996352633
1605 2996390013
1606 3000139616
1607 3002145117
1608 3003667394
1609 3004167645
1610 3004189434
1611 3004199810
1612 3004204771
1613 3004218048
1614 3004220905
1615 3004235701
1616 3004245301
1617 3004279315
1618 3004335750
1619 637075644
1620 641645039
1621 643599412
1622 649871782
1623 8001845965
1624 8002291657
1625 8004303897
1626 8004321191
1627 8004363745
1628 8004378853
1629 8004392537
1630 8004395855
1631 8004446516
1632 8004635419
1633 8004645139
1634 8004712066
1635 8004718846
1636 8004730422
1637 8054566246
1638 8055619461

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

64

413

0.95

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

137

238

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wml-assembly1.cif.gz_B arabidopsis thaliana prephenate aminotransferase mutant- k306a 0.9486 3 386
5wmk-assembly1.cif.gz_A-2 arabidopsis thaliana prephenate aminotransferase double mutant- t84v k169v 0.9472 3 386
8wou-assembly1.cif.gz_B the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila 0.9471 1 384
5wmi-assembly1.cif.gz_A-2 arabidopsis thaliana prephenate aminotransferase mutant- t84v 0.9451 2 386
8wkj-assembly1.cif.gz_A-2 the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila 0.9435 1 385
ID Description Score Start End Superfamily
1xi9D01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9623 286 386 3.90.1150.10
af_Q60317_288_372_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9612 296 381 3.90.1150.10
1j32B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9512 285 384 3.90.1150.10
af_Q58097_268_366_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9458 285 381 3.90.1150.10
af_Q2FZL1_278_379_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9422 286 382 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A833G1Y3-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9926 1 224 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A3S1SBI5-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9895 255 387 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A833G1Y3-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9838 1 224 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A4R3M710-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9823 1 386 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A833L4Z0-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9806 1 386 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Map