F482188

General Info

Members Datasets Scaffolds Average Seq Length
819 279 1570 548

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_003273|Ga0495687_003273_6609_8423
Length 604
Sequence LNFSLFNIIPVFSLASCTSLFNQPSQRQGPDMTSNQPLPDFAGHSSRLHAPTVPANERRMIFALFLAXXXXYLLPLMSHGLWIPDETRYAQISQEMLQGGNWVSPYFMGLRYFEKPIAGYWMIAIGQAVFGDNLFGVRIASALSTGLSVWLTYLIARRFWGDPRKSFACALLYMSFGLIAGQAGYANLDPQFTLWVNLSLVSLWFAIDSRTPRARLGAWAVLGVACGMGFMTKGFLAWLLPAAIALPYMLWQRRIGELLRYGPLAVVVAAAVCLPWALAIHHQEPDFWNFFFWNEHVRRFAADNAQHARPWWFYLPMLVVSALPWAALLPTTFIQAWNNKRQPVSGFLLLWLLLPLAIFSMSSGKLPTYIMPCLLPLALLMGHALTSLLEQARGRTIRFNGWLNVVIATTALIALLYLQLSKEIFENTEMFSLSLAFIVLLGWIIANALQILRPLTLWAMPALGIWLLVALLPAAMPNQIVDSKMPDRFISEHLDSLNQTTSLLSNDLGAASALSWLTRRPEVALYNVVGEMKYGLQDPAAASRKVTLQDVGQWMTEARKKGSVGVVMRVNSVDEFQEVEALPIDGKRYQRGNLQVLIFPQIQP

Samples

Sample ID Description Type Environment
1 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
50 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
87 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
88 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
181 2511231004 Pseudomonas sp. GM102 Isolate Nodule
182 2511231007 Pseudomonas sp. GM18 Isolate Nodule
183 2511231008 Pseudomonas sp. GM21 Isolate Nodule
184 2511231012 Pseudomonas sp. GM33 Isolate Nodule
185 2511231014 Pseudomonas sp. GM48 Isolate Nodule
186 2511231015 Pseudomonas sp. GM49 Isolate Nodule
187 2511231017 Pseudomonas sp. GM55 Isolate Nodule
188 2511231020 Pseudomonas sp. GM74 Isolate Nodule
189 2511231022 Pseudomonas sp. GM79 Isolate Nodule
190 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
191 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
192 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
193 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
194 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
195 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
196 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
197 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
198 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
199 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
200 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
201 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
202 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
203 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
204 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
205 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
206 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
207 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
208 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
209 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
210 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
211 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
212 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
213 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
214 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
215 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
216 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
217 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
218 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
219 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
220 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
221 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
222 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
223 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
224 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
225 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
226 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
227 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
228 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
229 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
230 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
231 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
232 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
233 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
234 2773857670 Pseudomonas sp. 478 Isolate Unclassified
235 2784132072 Pseudomonas sp. 460 Isolate Unclassified
236 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
237 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
238 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
239 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
240 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
241 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
242 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
243 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
244 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
245 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
246 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
247 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
248 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
249 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
250 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
251 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
252 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
253 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
254 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
255 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
256 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
257 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
258 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
259 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
260 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
261 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
262 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
263 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
264 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
265 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
266 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
267 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
268 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
269 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
270 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
271 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
272 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
273 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
274 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
275 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
276 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
277 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
278 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
279 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.46
Metatranscriptomes 0
Isolates 19.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.2
Nodule 2.32
Rhizoplane 5.13
Rhizosphere 71.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495687_003273 3300047443 Bacteria 11928
2 MRS2a_Contig_19 2124908027 Bacteria 54562
3 MRS2a_Contig_7067 2124908027 Bacteria 5082
4 SwRhRL2b_contig_219132 2162886007 Bacteria 1935
5 JGI25162J39368_1000065 3300002737 Bacteria 131083
6 JGI25162J39368_1000190 3300002737 Bacteria 64314
7 JGI25163J39215_1000128 3300002771 Bacteria 31313
8 JGI25163J39215_1000338 3300002771 Bacteria 15458
9 JGI25164J39214_1000038 3300002772 Bacteria 131082
10 JGI25164J39214_1000157 3300002772 Bacteria 64314
11 JGI25165J46597_1000126 3300003214 Bacteria 131083
12 JGI25165J46597_1000284 3300003214 Bacteria 64314
13 Ga0055538_1000007 3300003751 Bacteria 399715
14 Ga0055539_1000011 3300003752 Bacteria 399747
15 Ga0055533_1000014 3300003756 Bacteria 399747
16 Ga0055532_1000009 3300003758 Bacteria 399537
17 Ga0055525_1000016 3300003759 Bacteria 399724
18 Ga0055536_1000025 3300003781 Bacteria 183172
19 Ga0055536_1000053 3300003781 Bacteria 110030
20 Ga0055530_10000007 3300003791 Bacteria 183172
21 Ga0055530_10000219 3300003791 Bacteria 51126
22 Ga0055530_10007271 3300003791 Bacteria 4701
23 Ga0055530_10008051 3300003791 Bacteria 4298
24 Ga0055540_1000006 3300003792 Bacteria 372018
25 Ga0055540_1000125 3300003792 Bacteria 79312
26 Ga0055531_10001653 3300003794 Bacteria 16091
27 Ga0055541_1000008 3300003841 Bacteria 399724
28 Ga0065714_10000048 3300005288 Bacteria 23148
29 Ga0065714_10002770 3300005288 Bacteria 11621
30 Ga0065714_10003988 3300005288 Bacteria 6429
31 Ga0065714_10007581 3300005288 Bacteria 4911
32 Ga0065714_10065674 3300005288 Bacteria 8904
33 Ga0065714_10066434 3300005288 Bacteria 6862
34 Ga0065714_10069400 3300005288 Bacteria 4240
35 Ga0065714_10069849 3300005288 Bacteria 4063
36 Ga0065704_10083380 3300005289 Bacteria 3468
37 Ga0065712_10071467 3300005290 Bacteria 5248
38 Ga0070670_100000079 3300005331 Bacteria 92916
39 Ga0070670_100000242 3300005331 Bacteria 49330
40 Ga0070670_100001182 3300005331 Bacteria 20700
41 Ga0070670_100034655 3300005331 Bacteria 4344
42 Ga0070661_100000024 3300005344 Bacteria 121810
43 Ga0070661_100000151 3300005344 Bacteria 56885
44 Ga0070669_100000630 3300005353 Bacteria 26064
45 Ga0070669_100001022 3300005353 Bacteria 20393
46 Ga0068853_100013996 3300005539 Bacteria 6563
47 Ga0068853_100039228 3300005539 Bacteria 4039
48 Ga0070664_100000024 3300005564 Bacteria 94521
49 Ga0070664_100000095 3300005564 Bacteria 56885
50 Ga0068851_10000119 3300005834 Bacteria 42402
51 Ga0068851_10000552 3300005834 Bacteria 16293
52 Ga0075364_10009199 3300006051 Bacteria 5919
53 Ga0075364_10052995 3300006051 Bacteria 2651
54 Ga0075432_10000898 3300006058 Bacteria 9361
55 Ga0075432_10002446 3300006058 Bacteria 6182
56 Ga0075432_10005364 3300006058 Bacteria 4370
57 Ga0075432_10013825 3300006058 Bacteria 2746
58 Ga0075362_10005910 3300006177 Bacteria 4520
59 Ga0079104_1000143 3300006946 Bacteria 101361
60 Ga0105251_10000056 3300009011 Bacteria 104296
61 Ga0105251_10000088 3300009011 Bacteria 88504
62 Ga0105251_10000571 3300009011 Bacteria 34449
63 Ga0105251_10002980 3300009011 Bacteria 12671
64 Ga0105251_10008065 3300009011 Bacteria 6381
65 Ga0105251_10008927 3300009011 Bacteria 5991
66 Ga0105251_10016806 3300009011 Bacteria 3939
67 Ga0105251_10036872 3300009011 Bacteria 2403
68 Ga0105244_10000277 3300009036 Bacteria 51399
69 Ga0105244_10000325 3300009036 Bacteria 45650
70 Ga0105244_10000907 3300009036 Bacteria 25017
71 Ga0105244_10001433 3300009036 Bacteria 19301
72 Ga0105244_10001472 3300009036 Bacteria 19010
73 Ga0105244_10002913 3300009036 Bacteria 12642
74 Ga0105244_10004021 3300009036 Bacteria 10276
75 Ga0105244_10005595 3300009036 Bacteria 8308
76 Ga0105244_10006752 3300009036 Bacteria 7379
77 Ga0105244_10014311 3300009036 Bacteria 4592
78 Ga0105244_10026854 3300009036 Bacteria 3111
79 Ga0105250_10000015 3300009092 Bacteria 262683
80 Ga0105250_10000038 3300009092 Bacteria 141225
81 Ga0105250_10000304 3300009092 Bacteria 38571
82 Ga0105250_10001563 3300009092 Bacteria 12305
83 Ga0105250_10005002 3300009092 Bacteria 6006
84 Ga0105250_10030287 3300009092 Bacteria 2176
85 Ga0105243_10000020 3300009148 Bacteria 214279
86 Ga0105243_10000321 3300009148 Bacteria 52717
87 Ga0105243_10123106 3300009148 Bacteria 2190
88 Ga0105242_10002506 3300009176 Bacteria 14403
89 Ga0105242_10005013 3300009176 Bacteria 10238
90 Ga0105237_10000009 3300009545 Bacteria 337615
91 Ga0105237_10000042 3300009545 Bacteria 181280
92 Ga0105237_10094990 3300009545 Bacteria 2970
93 Ga0105249_10019228 3300009553 Bacteria 6092
94 Ga0105246_10000010 3300011119 Bacteria 69400
95 Ga0105246_10002448 3300011119 Bacteria 11207
96 Ga0157373_10000084 3300013100 Bacteria 81436
97 Ga0157373_10000144 3300013100 Bacteria 56939
98 Ga0157373_10003092 3300013100 Bacteria 12574
99 Ga0157373_10003868 3300013100 Bacteria 11315
100 Ga0157373_10005100 3300013100 Bacteria 9873
101 Ga0157373_10015658 3300013100 Bacteria 5540
102 Ga0157373_10027029 3300013100 Bacteria 4140
103 Ga0157373_10029199 3300013100 Bacteria 3974
104 Ga0157373_10030727 3300013100 Bacteria 3865
105 Ga0157373_10066447 3300013100 Bacteria 2551
106 Ga0157371_10000635 3300013102 Bacteria 41753
107 Ga0157371_10001258 3300013102 Bacteria 26748
108 Ga0157370_10002554 3300013104 Bacteria 21839
109 Ga0157370_10016221 3300013104 Bacteria 7550
110 Ga0157370_10035914 3300013104 Bacteria 4813
111 Ga0157370_10041014 3300013104 Bacteria 4468
112 Ga0157370_10121599 3300013104 Bacteria 2437
113 Ga0157369_10001116 3300013105 Bacteria 33559
114 Ga0157369_10004854 3300013105 Bacteria 15777
115 Ga0157369_10019056 3300013105 Bacteria 7683
116 Ga0157369_10094355 3300013105 Bacteria 3194
117 Ga0157375_10000930 3300013308 Bacteria 25364
118 Ga0157375_10001060 3300013308 Bacteria 23747
119 Ga0157375_10001137 3300013308 Bacteria 23049
120 Ga0157375_10037492 3300013308 Bacteria 4646
121 Ga0157375_10092698 3300013308 Bacteria 3085
122 Ga0182008_10000153 3300014497 Bacteria 54130
123 Ga0182008_10000483 3300014497 Bacteria 30249
124 Ga0182008_10000907 3300014497 Bacteria 20608
125 Ga0182008_10001506 3300014497 Bacteria 15547
126 Ga0182008_10002733 3300014497 Bacteria 10938
127 Ga0182008_10016275 3300014497 Bacteria 3866
128 Ga0182008_10021821 3300014497 Bacteria 3287
129 Ga0182006_1000165 3300015261 Bacteria 70092
130 Ga0182006_1000196 3300015261 Bacteria 62428
131 Ga0182006_1000387 3300015261 Bacteria 36363
132 Ga0182006_1007913 3300015261 Bacteria 4837
133 Ga0182007_10000089 3300015262 Bacteria 68189
134 Ga0182007_10000108 3300015262 Bacteria 57807
135 Ga0182007_10009387 3300015262 Bacteria 3948
136 Ga0182005_1000470 3300015265 Bacteria 20931
137 Ga0182005_1000917 3300015265 Bacteria 12880
138 Ga0182005_1000969 3300015265 Bacteria 12456
139 Ga0163161_10001603 3300017792 Bacteria 16684
140 Ga0163161_10003345 3300017792 Bacteria 11243
141 Ga0163161_10004392 3300017792 Bacteria 9833
142 Ga0163161_10006781 3300017792 Bacteria 7912
143 Ga0163161_10009162 3300017792 Bacteria 6841
144 Ga0163161_10010601 3300017792 Bacteria 6380
145 Ga0163161_10023843 3300017792 Bacteria 4318
146 Ga0163161_10029906 3300017792 Bacteria 3873
147 Ga0163161_10053825 3300017792 Bacteria 2919
148 Ga0163161_10071678 3300017792 Bacteria 2536
149 Ga0163161_10103718 3300017792 Bacteria 2119
150 Ga0209435_100687 3300025206 Bacteria 5899
151 Ga0209760_100036 3300025207 Bacteria 130845
152 Ga0209760_100095 3300025207 Bacteria 68193
153 Ga0209784_100023 3300025224 Bacteria 399841
154 Ga0209566_100019 3300025225 Bacteria 414836
155 Ga0209674_100034 3300025226 Bacteria 414903
156 Ga0209147_100027 3300025229 Bacteria 414610
157 Ga0209563_100037 3300025230 Bacteria 414903
158 Ga0207427_100004 3300025231 Bacteria 939600
159 Ga0207427_100007 3300025231 Bacteria 746220
160 Ga0209437_100006 3300025233 Bacteria 1042724
161 Ga0209437_100025 3300025233 Bacteria 561333
162 Ga0209258_100166 3300025242 Bacteria 148022
163 Ga0209646_1000318 3300025246 Bacteria 37146
164 Ga0209677_100021 3300025253 Bacteria 414954
165 Ga0209759_1002349 3300025256 Bacteria 8447
166 Ga0209233_1000086 3300025261 Bacteria 331687
167 Ga0209233_1000145 3300025261 Bacteria 188955
168 Ga0209676_1000002 3300025292 Bacteria 1732948
169 Ga0209676_1000003 3300025292 Bacteria 1454178
170 Ga0209676_1003284 3300025292 Bacteria 10140
171 Ga0209050_1000004 3300025298 Bacteria 1600040
172 Ga0209050_1000006 3300025298 Bacteria 1359702
173 Ga0209050_1000763 3300025298 Bacteria 46213
174 Ga0209051_1000001 3300025303 Bacteria 1732974
175 Ga0209051_1000006 3300025303 Bacteria 1015785
176 Ga0209051_1004500 3300025303 Bacteria 8561
177 Ga0209257_1000029 3300025304 Bacteria 695617
178 Ga0207696_1000017 3300025711 Bacteria 491130
179 Ga0207696_1000108 3300025711 Bacteria 157445
180 Ga0207696_1000123 3300025711 Bacteria 141297
181 Ga0207696_1000460 3300025711 Bacteria 35536
182 Ga0207655_1000006 3300025728 Bacteria 861092
183 Ga0207655_1000074 3300025728 Bacteria 232056
184 Ga0207655_1000098 3300025728 Bacteria 190699
185 Ga0207655_1000114 3300025728 Bacteria 164098
186 Ga0207655_1000410 3300025728 Bacteria 59117
187 Ga0207655_1002318 3300025728 Bacteria 15638
188 Ga0207655_1003616 3300025728 Bacteria 11425
189 Ga0207655_1004568 3300025728 Bacteria 9753
190 Ga0207655_1006831 3300025728 Bacteria 7497
191 Ga0207655_1008809 3300025728 Bacteria 6349
192 Ga0207655_1009171 3300025728 Bacteria 6180
193 Ga0207655_1015886 3300025728 Bacteria 4152
194 Ga0207655_1034974 3300025728 Bacteria 2251
195 Ga0207713_1000061 3300025735 Bacteria 209289
196 Ga0207713_1000097 3300025735 Bacteria 144844
197 Ga0207713_1000284 3300025735 Bacteria 58743
198 Ga0207713_1006155 3300025735 Bacteria 7368
199 Ga0207713_1008243 3300025735 Bacteria 6027
200 Ga0207713_1011419 3300025735 Bacteria 4831
201 Ga0207713_1041350 3300025735 Bacteria 1924
202 Ga0207671_10000474 3300025914 Bacteria 54456
203 Ga0207671_10000561 3300025914 Bacteria 49927
204 Ga0207649_10000010 3300025920 Bacteria 284354
205 Ga0207649_10000032 3300025920 Bacteria 143552
206 Ga0207681_10000299 3300025923 Bacteria 36494
207 Ga0207681_10003542 3300025923 Bacteria 9722
208 Ga0207650_10000068 3300025925 Bacteria 139947
209 Ga0207650_10000259 3300025925 Bacteria 56695
210 Ga0207650_10000690 3300025925 Bacteria 26485
211 Ga0207650_10023505 3300025925 Bacteria 4372
212 Ga0207706_10002181 3300025933 Bacteria 19100
213 Ga0207706_10004102 3300025933 Bacteria 13761
214 Ga0207686_10002348 3300025934 Bacteria 10344
215 Ga0207686_10008489 3300025934 Bacteria 5549
216 Ga0207709_10000004 3300025935 Bacteria 825156
217 Ga0207709_10001932 3300025935 Bacteria 13617
218 Ga0207679_10000022 3300025945 Bacteria 219036
219 Ga0207679_10000059 3300025945 Bacteria 101268
220 Ga0207639_10052864 3300026041 Bacteria 3097
221 Ga0209281_1000063 3300027111 Bacteria 288465
222 Ga0207428_10032595 3300027907 Bacteria 4284
223 Ga0207428_10127558 3300027907 Bacteria 1948
224 Ga0307511_10053051 3300030521 Bacteria 3220
225 Ga0307405_10000118 3300031731 Bacteria 31782
226 Ga0307405_10018233 3300031731 Bacteria 3869
227 Ga0439447_001977 3300041407 Bacteria 7525
228 Ga0439466_0001711 3300041411 Bacteria 8565
229 Ga0439466_0015323 3300041411 Bacteria 2785
230 Ga0439432_000084 3300042006 Bacteria 29253
231 Ga0439432_000085 3300042006 Bacteria 29181
232 Ga0439451_005228 3300042009 Bacteria 2641
233 Ga0495617_000148 3300046452 Bacteria 44939
234 Ga0495617_000512 3300046452 Bacteria 20293
235 Ga0495617_001162 3300046452 Bacteria 11883
236 Ga0495617_001573 3300046452 Bacteria 9860
237 Ga0495617_003501 3300046452 Bacteria 5885
238 Ga0495617_007522 3300046452 Bacteria 3777
239 Ga0495627_000779 3300046453 Bacteria 23541
240 Ga0495603_0020988 3300046455 Bacteria 3955
241 Ga0495603_0051857 3300046455 Bacteria 2436
242 Ga0495590_0000177 3300046457 Bacteria 37380
243 Ga0495590_0000641 3300046457 Bacteria 16211
244 Ga0495590_0001583 3300046457 Bacteria 9745
245 Ga0495590_0003703 3300046457 Bacteria 6219
246 Ga0495590_0014179 3300046457 Bacteria 2914
247 Ga0495591_000786 3300046458 Bacteria 22539
248 Ga0495591_001537 3300046458 Bacteria 14147
249 Ga0495591_002201 3300046458 Bacteria 11134
250 Ga0495591_009526 3300046458 Bacteria 3847
251 Ga0495638_0001323 3300046460 Bacteria 22805
252 Ga0495638_0002354 3300046460 Bacteria 15497
253 Ga0495638_0011453 3300046460 Bacteria 6110
254 Ga0495638_0021055 3300046460 Bacteria 4301
255 Ga0495653_0004505 3300046463 Bacteria 11249
256 Ga0495653_0019284 3300046463 Bacteria 5531
257 Ga0495650_0001775 3300046471 Bacteria 19590
258 Ga0495650_0002651 3300046471 Bacteria 13971
259 Ga0495650_0002735 3300046471 Bacteria 13643
260 Ga0495650_0015582 3300046471 Bacteria 3892
261 Ga0495582_0002904 3300046473 Bacteria 9580
262 Ga0495582_0003371 3300046473 Bacteria 8988
263 Ga0495605_0000054 3300046474 Bacteria 157560
264 Ga0495605_0000778 3300046474 Bacteria 22880
265 Ga0495605_0000840 3300046474 Bacteria 21512
266 Ga0495605_0002335 3300046474 Bacteria 11819
267 Ga0495605_0009888 3300046474 Bacteria 5348
268 Ga0495605_0010382 3300046474 Bacteria 5213
269 Ga0495605_0025277 3300046474 Bacteria 3096
270 Ga0495639_0000053 3300046475 Bacteria 50537
271 Ga0495639_0032617 3300046475 Bacteria 2323
272 Ga0495639_0038065 3300046475 Bacteria 2158
273 Ga0495584_0000120 3300046491 Bacteria 54113
274 Ga0495584_0002083 3300046491 Bacteria 11466
275 Ga0495584_0002413 3300046491 Bacteria 10621
276 Ga0495584_0006307 3300046491 Bacteria 6217
277 Ga0495584_0008390 3300046491 Bacteria 5351
278 Ga0495584_0029166 3300046491 Bacteria 2796
279 Ga0495585_0002861 3300046492 Bacteria 12003
280 Ga0495585_0010533 3300046492 Bacteria 5500
281 Ga0495585_0010605 3300046492 Bacteria 5477
282 Ga0495585_0042153 3300046492 Bacteria 2558
283 Ga0495594_0001277 3300046499 Bacteria 13159
284 Ga0495594_0020571 3300046499 Bacteria 3515
285 Ga0495594_0020880 3300046499 Bacteria 3492
286 Ga0495594_0021067 3300046499 Bacteria 3478
287 Ga0495607_0000036 3300046501 Bacteria 140259
288 Ga0495607_0000041 3300046501 Bacteria 132443
289 Ga0495607_0003777 3300046501 Bacteria 11448
290 Ga0495607_0003897 3300046501 Bacteria 11242
291 Ga0495607_0006048 3300046501 Bacteria 8568
292 Ga0495607_0007191 3300046501 Bacteria 7732
293 Ga0495607_0015516 3300046501 Bacteria 4935
294 Ga0495607_0019764 3300046501 Bacteria 4272
295 Ga0495607_0039221 3300046501 Bacteria 2830
296 Ga0495607_0045522 3300046501 Bacteria 2580
297 Ga0495583_0000387 3300046506 Bacteria 67820
298 Ga0495583_0001245 3300046506 Bacteria 26997
299 Ga0495583_0005112 3300046506 Bacteria 9038
300 Ga0495583_0009646 3300046506 Bacteria 5740
301 Ga0495583_0016921 3300046506 Bacteria 3894
302 Ga0495583_0017034 3300046506 Bacteria 3873
303 Ga0495606_0000079 3300046507 Bacteria 164788
304 Ga0495606_0000191 3300046507 Bacteria 107427
305 Ga0495606_0001484 3300046507 Bacteria 31212
306 Ga0495606_0002351 3300046507 Bacteria 22217
307 Ga0495606_0002606 3300046507 Bacteria 20632
308 Ga0495606_0016943 3300046507 Bacteria 5530
309 Ga0495606_0025524 3300046507 Bacteria 4229
310 Ga0495610_0000455 3300046512 Bacteria 42440
311 Ga0495610_0000653 3300046512 Bacteria 33834
312 Ga0495610_0023899 3300046512 Bacteria 3310
313 Ga0495610_0032676 3300046512 Bacteria 2700
314 Ga0495616_0000535 3300046513 Bacteria 28683
315 Ga0495616_0000695 3300046513 Bacteria 24905
316 Ga0495616_0006004 3300046513 Bacteria 7403
317 Ga0495620_0000152 3300046515 Bacteria 56303
318 Ga0495620_0001300 3300046515 Bacteria 15185
319 Ga0495620_0001539 3300046515 Bacteria 13713
320 Ga0495620_0011843 3300046515 Bacteria 4534
321 Ga0495620_0017374 3300046515 Bacteria 3587
322 Ga0495630_0004903 3300046517 Bacteria 9401
323 Ga0495630_0009776 3300046517 Bacteria 6903
324 Ga0495630_0011384 3300046517 Bacteria 6442
325 Ga0495630_0016625 3300046517 Bacteria 5380
326 Ga0495631_0000175 3300046518 Bacteria 43711
327 Ga0495631_0009829 3300046518 Bacteria 4761
328 Ga0495631_0015945 3300046518 Bacteria 3591
329 Ga0495632_0001161 3300046519 Bacteria 22445
330 Ga0495632_0001632 3300046519 Bacteria 18392
331 Ga0495632_0003232 3300046519 Bacteria 11690
332 Ga0495632_0008562 3300046519 Bacteria 6258
333 Ga0495637_0000950 3300046520 Bacteria 18520
334 Ga0495637_0001455 3300046520 Bacteria 13939
335 Ga0495637_0002447 3300046520 Bacteria 10261
336 Ga0495637_0011047 3300046520 Bacteria 4349
337 Ga0495643_0035792 3300046522 Bacteria 2731
338 Ga0495648_0000062 3300046524 Bacteria 150125
339 Ga0495648_0002500 3300046524 Bacteria 16867
340 Ga0495648_0004708 3300046524 Bacteria 11564
341 Ga0495648_0021752 3300046524 Bacteria 4435
342 Ga0495648_0022960 3300046524 Bacteria 4282
343 Ga0495648_0023943 3300046524 Bacteria 4170
344 Ga0495648_0024744 3300046524 Bacteria 4078
345 Ga0495648_0024972 3300046524 Bacteria 4056
346 Ga0495648_0026624 3300046524 Bacteria 3890
347 Ga0495648_0032415 3300046524 Bacteria 3428
348 Ga0495666_0000675 3300046526 Bacteria 15451
349 Ga0495666_0000908 3300046526 Bacteria 13883
350 Ga0495666_0001190 3300046526 Bacteria 12540
351 Ga0495666_0001595 3300046526 Bacteria 11162
352 Ga0495666_0004499 3300046526 Bacteria 7041
353 Ga0495666_0016517 3300046526 Bacteria 3677
354 Ga0495642_0000006 3300046528 Bacteria 172412
355 Ga0495642_0000044 3300046528 Bacteria 74850
356 Ga0495642_0000453 3300046528 Bacteria 21609
357 Ga0495642_0001263 3300046528 Bacteria 11491
358 Ga0495654_0000166 3300046530 Bacteria 64935
359 Ga0495654_0000600 3300046530 Bacteria 28665
360 Ga0495654_0001154 3300046530 Bacteria 18905
361 Ga0495654_0004479 3300046530 Bacteria 8279
362 Ga0495654_0006971 3300046530 Bacteria 6365
363 Ga0495654_0013073 3300046530 Bacteria 4446
364 Ga0495654_0016886 3300046530 Bacteria 3844
365 Ga0495654_0017811 3300046530 Bacteria 3728
366 Ga0495654_0018902 3300046530 Bacteria 3606
367 Ga0495654_0024159 3300046530 Bacteria 3142
368 Ga0495654_0027907 3300046530 Bacteria 2889
369 Ga0495587_0001167 3300046536 Bacteria 17295
370 Ga0495587_0001738 3300046536 Bacteria 14540
371 Ga0495587_0003803 3300046536 Bacteria 10014
372 Ga0495609_0001281 3300046538 Bacteria 17159
373 Ga0495609_0001936 3300046538 Bacteria 13176
374 Ga0495609_0005054 3300046538 Bacteria 7044
375 Ga0495609_0038226 3300046538 Bacteria 2164
376 Ga0495597_0004988 3300046542 Bacteria 7125
377 Ga0495645_0116822 3300046543 Bacteria 1882
378 Ga0495622_0000182 3300046557 Bacteria 50915
379 Ga0495622_0000249 3300046557 Bacteria 41910
380 Ga0495622_0002204 3300046557 Bacteria 9500
381 Ga0495622_0006591 3300046557 Bacteria 5384
382 Ga0495622_0011716 3300046557 Bacteria 4054
383 Ga0495622_0012172 3300046557 Bacteria 3979
384 Ga0495622_0017579 3300046557 Bacteria 3330
385 Ga0495622_0019411 3300046557 Bacteria 3165
386 Ga0495633_0002268 3300046558 Bacteria 13755
387 Ga0495633_0012603 3300046558 Bacteria 4487
388 Ga0495633_0015354 3300046558 Bacteria 3974
389 Ga0495633_0019111 3300046558 Bacteria 3468
390 Ga0495633_0022226 3300046558 Bacteria 3161
391 Ga0495656_0000803 3300046615 Bacteria 10182
392 Ga0495668_0007019 3300046616 Bacteria 7270
393 Ga0495634_0000815 3300046642 Bacteria 30341
394 Ga0495611_0001469 3300046648 Bacteria 11722
395 Ga0495625_0015061 3300046660 Bacteria 6141
396 Ga0495625_0019113 3300046660 Bacteria 5329
397 Ga0495625_0029114 3300046660 Bacteria 4134
398 Ga0495635_0000522 3300046663 Bacteria 24345
399 Ga0495635_0003105 3300046663 Bacteria 11425
400 Ga0495635_0005853 3300046663 Bacteria 8567
401 Ga0495659_0000119 3300046664 Bacteria 34751
402 Ga0495661_0000051 3300046665 Bacteria 140353
403 Ga0495661_0000269 3300046665 Bacteria 59794
404 Ga0495661_0000692 3300046665 Bacteria 33517
405 Ga0495661_0000896 3300046665 Bacteria 27460
406 Ga0495661_0005186 3300046665 Bacteria 9285
407 Ga0495661_0006152 3300046665 Bacteria 8446
408 Ga0495661_0025282 3300046665 Bacteria 3836
409 Ga0495588_0003667 3300046674 Bacteria 6720
410 Ga0495588_0061956 3300046674 Bacteria 1938
411 Ga0495623_0002086 3300046679 Bacteria 13368
412 Ga0495623_0009066 3300046679 Bacteria 6453
413 Ga0495623_0016801 3300046679 Bacteria 4728
414 Ga0495646_0003353 3300046680 Bacteria 9960
415 Ga0495646_0003495 3300046680 Bacteria 9782
416 Ga0495646_0008611 3300046680 Bacteria 6481
417 Ga0495669_0001087 3300046684 Bacteria 11253
418 Ga0495613_0020085 3300046689 Bacteria 4977
419 Ga0495670_0000666 3300046691 Bacteria 16343
420 Ga0495670_0007044 3300046691 Bacteria 5535
421 Ga0495670_0012161 3300046691 Bacteria 4233
422 Ga0495671_0000210 3300046692 Bacteria 51181
423 Ga0495671_0001187 3300046692 Bacteria 17825
424 Ga0495671_0001243 3300046692 Bacteria 17423
425 Ga0495671_0004999 3300046692 Bacteria 7814
426 Ga0495671_0006777 3300046692 Bacteria 6586
427 Ga0495671_0007263 3300046692 Bacteria 6329
428 Ga0495671_0013549 3300046692 Bacteria 4408
429 Ga0495671_0017328 3300046692 Bacteria 3835
430 Ga0495671_0060924 3300046692 Bacteria 1862
431 Ga0495649_0000027 3300046694 Bacteria 164157
432 Ga0495649_0000661 3300046694 Bacteria 28167
433 Ga0495649_0000748 3300046694 Bacteria 26199
434 Ga0495649_0002235 3300046694 Bacteria 13781
435 Ga0495649_0002964 3300046694 Bacteria 11692
436 Ga0495649_0005325 3300046694 Bacteria 8208
437 Ga0495649_0007535 3300046694 Bacteria 6624
438 Ga0495649_0009159 3300046694 Bacteria 5903
439 Ga0495649_0012051 3300046694 Bacteria 5046
440 Ga0495649_0040307 3300046694 Bacteria 2558
441 Ga0495589_0000326 3300046794 Bacteria 37321
442 Ga0495589_0000352 3300046794 Bacteria 35927
443 Ga0495589_0001445 3300046794 Bacteria 13698
444 Ga0495589_0012195 3300046794 Bacteria 4457
445 Ga0495589_0014155 3300046794 Bacteria 4111
446 Ga0495589_0017546 3300046794 Bacteria 3672
447 Ga0495589_0019080 3300046794 Bacteria 3518
448 Ga0495600_0005060 3300046809 Bacteria 7919
449 Ga0495600_0006261 3300046809 Bacteria 7227
450 Ga0495600_0027497 3300046809 Bacteria 3675
451 Ga0495600_0030109 3300046809 Bacteria 3515
452 Ga0495660_0001157 3300046810 Bacteria 18740
453 Ga0495660_0003033 3300046810 Bacteria 10475
454 Ga0495660_0005612 3300046810 Bacteria 7502
455 Ga0495660_0017436 3300046810 Bacteria 4134
456 Ga0495660_0039345 3300046810 Bacteria 2626
457 Ga0495660_0049689 3300046810 Bacteria 2288
458 Ga0495581_0000629 3300047315 Bacteria 18436
459 Ga0495581_0025132 3300047315 Bacteria 3453
460 Ga0495581_0035195 3300047315 Bacteria 2897
461 Ga0495604_0000719 3300047317 Bacteria 28046
462 Ga0495604_0003585 3300047317 Bacteria 12371
463 Ga0495604_0023955 3300047317 Bacteria 4872
464 Ga0495604_0045394 3300047317 Bacteria 3429
465 Ga0495636_0005847 3300047318 Bacteria 4824
466 Ga0495674_0009374 3300047319 Bacteria 9306
467 Ga0495674_0022058 3300047319 Bacteria 5876
468 Ga0495672_0000817 3300047320 Bacteria 33454
469 Ga0495672_0001555 3300047320 Bacteria 22465
470 Ga0495672_0001972 3300047320 Bacteria 19408
471 Ga0495672_0002413 3300047320 Bacteria 17233
472 Ga0495672_0003184 3300047320 Bacteria 14266
473 Ga0495672_0003332 3300047320 Bacteria 13842
474 Ga0495672_0025473 3300047320 Bacteria 3785
475 Ga0495676_0091561 3300047321 Bacteria 2272
476 Ga0495680_0002029 3300047322 Bacteria 21206
477 Ga0495680_0008709 3300047322 Bacteria 9194
478 Ga0495680_0027810 3300047322 Bacteria 4640
479 Ga0495680_0034253 3300047322 Bacteria 4104
480 Ga0495680_0077415 3300047322 Bacteria 2519
481 Ga0495680_0163023 3300047322 Bacteria 1617
482 Ga0495683_0000318 3300047323 Bacteria 40455
483 Ga0495683_0000356 3300047323 Bacteria 37720
484 Ga0495683_0000412 3300047323 Bacteria 34264
485 Ga0495683_0013044 3300047323 Bacteria 4351
486 Ga0495683_0020041 3300047323 Bacteria 3451
487 Ga0495687_000977 3300047443 Bacteria 28996
488 Ga0495687_001427 3300047443 Bacteria 22013
489 Ga0495687_002230 3300047443 Bacteria 15999
490 Ga0495687_006152 3300047443 Bacteria 7435
491 Ga0495687_007971 3300047443 Bacteria 6145
492 Ga0495687_014259 3300047443 Bacteria 4098
493 Ga0495675_0005089 3300047444 Bacteria 8007
494 Ga0495675_0006802 3300047444 Bacteria 7014
495 Ga0495675_0009385 3300047444 Bacteria 6086
496 Ga0495675_0023304 3300047444 Bacteria 3944
497 Ga0495677_0000848 3300047445 Bacteria 12364
498 Ga0495679_000571 3300047446 Bacteria 25561
499 Ga0495679_000688 3300047446 Bacteria 22049
500 Ga0495679_001183 3300047446 Bacteria 15508
501 Ga0495679_008771 3300047446 Bacteria 4088
502 Ga0495679_010574 3300047446 Bacteria 3615
503 Ga0495679_010914 3300047446 Bacteria 3538
504 Ga0495679_015261 3300047446 Bacteria 2815
505 Ga0495673_0000118 3300047469 Bacteria 147670
506 Ga0495673_0000465 3300047469 Bacteria 43951
507 Ga0495673_0001380 3300047469 Bacteria 19572
508 Ga0495673_0001451 3300047469 Bacteria 18852
509 Ga0495673_0002619 3300047469 Bacteria 12469
510 Ga0495673_0003971 3300047469 Bacteria 9458
511 Ga0495673_0004085 3300047469 Bacteria 9270
512 Ga0495673_0011327 3300047469 Bacteria 4804
513 Ga0495673_0012355 3300047469 Bacteria 4537
514 Ga0495673_0014936 3300047469 Bacteria 4021
515 Ga0495673_0029955 3300047469 Bacteria 2563
516 Ga0495681_0000353 3300047470 Bacteria 35846
517 Ga0495681_0001105 3300047470 Bacteria 20484
518 Ga0495681_0001797 3300047470 Bacteria 15790
519 Ga0495681_0002137 3300047470 Bacteria 14330
520 Ga0495681_0003644 3300047470 Bacteria 10695
521 Ga0495681_0004853 3300047470 Bacteria 9094
522 Ga0495681_0005548 3300047470 Bacteria 8428
523 Ga0495681_0019515 3300047470 Bacteria 3699
524 Ga0495684_0009792 3300047471 Bacteria 7396
525 Ga0495684_0010777 3300047471 Bacteria 7065
526 Ga0495593_0001031 3300047673 Bacteria 16359
527 Ga0495593_0001066 3300047673 Bacteria 16000
528 Ga0495593_0001207 3300047673 Bacteria 15111
529 Ga0495593_0014141 3300047673 Bacteria 4540
530 Ga0495593_0017983 3300047673 Bacteria 3976
531 Ga0495626_0000064 3300048091 Bacteria 142060
532 Ga0495626_0000616 3300048091 Bacteria 34739
533 Ga0495626_0000958 3300048091 Bacteria 25047
534 Ga0495626_0010980 3300048091 Bacteria 4806
535 Ga0495626_0018101 3300048091 Bacteria 3545
536 Ga0496102_0000774 3300048905 Bacteria 31153
537 Ga0496103_0001166 3300048906 Bacteria 18072
538 Ga0496103_0020077 3300048906 Bacteria 4012
539 Ga0496105_0104696 3300048908 Bacteria 2336
540 Ga0496110_0029657 3300048913 Bacteria 4711
541 Ga0496111_0041086 3300048914 Bacteria 3318
542 Ga0496112_0008665 3300048915 Bacteria 9119
543 Ga0496116_0000825 3300048919 Bacteria 39115
544 Ga0496116_0001933 3300048919 Bacteria 22333
545 Ga0496116_0003233 3300048919 Bacteria 16227
546 Ga0496116_0029546 3300048919 Bacteria 3950
547 Ga0496117_0001387 3300048920 Bacteria 35141
548 Ga0496117_0001466 3300048920 Bacteria 33965
549 Ga0496117_0004097 3300048920 Bacteria 16333
550 Ga0496117_0004579 3300048920 Bacteria 15125
551 Ga0496117_0006305 3300048920 Bacteria 12067
552 Ga0496117_0007085 3300048920 Bacteria 11081
553 Ga0496117_0012383 3300048920 Bacteria 7526
554 Ga0496117_0020112 3300048920 Bacteria 5455
555 Ga0496117_0037708 3300048920 Bacteria 3596
556 Ga0496117_0057678 3300048920 Bacteria 2695
557 Ga0496118_0006407 3300048921 Bacteria 12951
558 Ga0496118_0006676 3300048921 Bacteria 12585
559 Ga0496118_0007833 3300048921 Bacteria 11201
560 Ga0496118_0008698 3300048921 Bacteria 10434
561 Ga0496118_0013212 3300048921 Bacteria 7829
562 Ga0496118_0021455 3300048921 Bacteria 5682
563 Ga0496118_0032834 3300048921 Bacteria 4267
564 Ga0496118_0034082 3300048921 Bacteria 4163
565 Ga0496118_0042318 3300048921 Bacteria 3595
566 Ga0496119_0005391 3300048922 Bacteria 12283
567 Ga0496119_0012038 3300048922 Bacteria 7073
568 Ga0496120_0002592 3300048923 Bacteria 17976
569 Ga0496120_0003163 3300048923 Bacteria 15352
570 Ga0496120_0025586 3300048923 Bacteria 3661
571 Ga0496121_0001708 3300048924 Bacteria 35986
572 Ga0496121_0001836 3300048924 Bacteria 34258
573 Ga0496121_0004020 3300048924 Bacteria 20222
574 Ga0496121_0059820 3300048924 Bacteria 3139
575 Ga0496122_0003219 3300048925 Bacteria 21715
576 Ga0496122_0004867 3300048925 Bacteria 16328
577 Ga0496122_0005852 3300048925 Bacteria 14422
578 Ga0496122_0025179 3300048925 Bacteria 5178
579 Ga0496122_0054287 3300048925 Bacteria 3011
580 Ga0496123_0001969 3300048926 Bacteria 26631
581 Ga0496123_0004383 3300048926 Bacteria 14891
582 Ga0496123_0004572 3300048926 Bacteria 14424
583 Ga0496123_0018021 3300048926 Bacteria 5649
584 Ga0496123_0024051 3300048926 Bacteria 4643
585 Ga0496123_0045752 3300048926 Bacteria 2977
586 Ga0496124_0001124 3300048927 Bacteria 42065
587 Ga0496124_0001537 3300048927 Bacteria 33519
588 Ga0496124_0004348 3300048927 Bacteria 16595
589 Ga0496124_0016348 3300048927 Bacteria 7059
590 Ga0496124_0018426 3300048927 Bacteria 6538
591 Ga0496124_0045697 3300048927 Bacteria 3753
592 Ga0496124_0099058 3300048927 Bacteria 2364
593 Ga0496124_0203069 3300048927 Bacteria 1505
594 Ga0496125_0000842 3300048928 Bacteria 49253
595 Ga0496125_0002577 3300048928 Bacteria 23320
596 Ga0496125_0004187 3300048928 Bacteria 16817
597 Ga0496125_0004204 3300048928 Bacteria 16778
598 Ga0496125_0039387 3300048928 Bacteria 4071
599 Ga0496125_0048564 3300048928 Bacteria 3537
600 Ga0496125_0060557 3300048928 Bacteria 3041
601 Ga0496125_0072714 3300048928 Bacteria 2677
602 Ga0496126_0001228 3300048929 Bacteria 41648
603 Ga0496126_0002401 3300048929 Bacteria 25433
604 Ga0496126_0044914 3300048929 Bacteria 4065
605 Ga0495678_000578 3300049459 Bacteria 34746
606 Ga0495678_000634 3300049459 Bacteria 32563
607 Ga0495678_004245 3300049459 Bacteria 8392
608 Ga0495678_013459 3300049459 Bacteria 3839
609 Ga0495678_017574 3300049459 Bacteria 3236
610 Ga0495678_020293 3300049459 Bacteria 2946
611 Ga0495678_024207 3300049459 Bacteria 2625
612 Ga0495682_0000025 3300049460 Bacteria 147931
613 Ga0495682_0000099 3300049460 Bacteria 76287
614 Ga0495682_0001201 3300049460 Bacteria 14720
615 Ga0495682_0001269 3300049460 Bacteria 14164
616 Ga0495682_0001679 3300049460 Bacteria 11289
617 Ga0495682_0003138 3300049460 Bacteria 7470
618 Ga0495682_0006579 3300049460 Bacteria 4697
619 nmdc:mga03683_12119_c1 3300050489 Bacteria 3140
620 nmdc:mga03683_7051_c1 3300050489 Bacteria 3498
621 nmdc:mga00v17_48890_c1 3300050491 Bacteria 2564
622 Ga0500618_005847 3300053125 Bacteria 3683
623 Ga0500573_0029972 3300053140 Bacteria 3137
624 Ga0500634_0000141 3300053161 Bacteria 26079
625 Ga0500634_0031016 3300053161 Bacteria 2913
626 2511255183 2511231004 Bacteria 6669789
627 2511271811 2511231007 Bacteria 6306603
628 2511271823 2511231007 Bacteria 6306603
629 2511277938 2511231008 Bacteria 6624100
630 2511301533 2511231012 Bacteria 6738011
631 2511301542 2511231012 Bacteria 6738011
632 2511312487 2511231014 Bacteria 6462302
633 2511312496 2511231014 Bacteria 6462302
634 2511318147 2511231015 Bacteria 6598026
635 2511318249 2511231015 Bacteria 6598026
636 2511334555 2511231017 Bacteria 6503007
637 2511334571 2511231017 Bacteria 6503007
638 2511351798 2511231020 Bacteria 6115223
639 2511351807 2511231020 Bacteria 6115223
640 2511363438 2511231022 Bacteria 6719296
641 2554813761 2554235132 Bacteria 6772433
642 2555671476 2554235341 Bacteria 6867980
643 2597863932 2597489888 Bacteria 6179543
644 2597864743 2597489888 Bacteria 6179543
645 2597869835 2597489889 Bacteria 6297495
646 2597870596 2597489889 Bacteria 6297495
647 2599354365 2599185160 Bacteria 6844013
648 2599359921 2599185161 Bacteria 6960462
649 2599366243 2599185162 Bacteria 6957254
650 2599373033 2599185163 Bacteria 6995158
651 2599379473 2599185164 Bacteria 6841688
652 2599385549 2599185165 Bacteria 6843250
653 2599391892 2599185166 Bacteria 6959206
654 2599397925 2599185167 Bacteria 6353609
655 2599398329 2599185167 Bacteria 6353609
656 2599403658 2599185168 Bacteria 6997636
657 2599450351 2599185179 Bacteria 6611171
658 2599452371 2599185179 Bacteria 6611171
659 2599461199 2599185181 Bacteria 6844519
660 2599469741 2599185182 Bacteria 6883168
661 2599490219 2599185186 Bacteria 6831633
662 2599506935 2599185189 Bacteria 5862825
663 2599507375 2599185189 Bacteria 5862825
664 2599512833 2599185190 Bacteria 6285678
665 2599513250 2599185190 Bacteria 6285678
666 2599518250 2599185191 Bacteria 6297582
667 2599522139 2599185191 Bacteria 6297582
668 2599878044 2599185288 Bacteria 6666191
669 2599881331 2599185288 Bacteria 6666191
670 2599891510 2599185290 Bacteria 6289611
671 2599891926 2599185290 Bacteria 6289611
672 2599946649 2599185303 Bacteria 6512725
673 2599947256 2599185303 Bacteria 6512725
674 2600213814 2599185356 Bacteria 6843884
675 2601689973 2600255296 Bacteria 5784754
676 2601691873 2600255296 Bacteria 5784754
677 2601773982 2600255313 Bacteria 6842543
678 2608381083 2606217733 Bacteria 6360972
679 2621298734 2619619299 Bacteria 6649820
680 2621299892 2619619299 Bacteria 6649820
681 2624492219 2623620446 Bacteria 6500345
682 2624492231 2623620446 Bacteria 6500345
683 2643871441 2643221571 Bacteria 6228673
684 2643874216 2643221571 Bacteria 6228673
685 2643956783 2643221589 Bacteria 6250934
686 2644024706 2643221602 Bacteria 6249926
687 2644189894 2643221633 Bacteria 6733554
688 2644189906 2643221633 Bacteria 6733554
689 2644620202 2643221713 Bacteria 6554480
690 2644622432 2643221713 Bacteria 6554480
691 2671096946 2667528171 Bacteria 6900659
692 2677896551 2675903420 Bacteria 6247433
693 2677900777 2675903420 Bacteria 6247433
694 2723248720 2721755607 Bacteria 5841722
695 2723249518 2721755607 Bacteria 5841722
696 2738669889 2738541265 Bacteria 6594665
697 2738671983 2738541265 Bacteria 6594665
698 2738748282 2738541282 Bacteria 6593925
699 2738750377 2738541282 Bacteria 6593925
700 2738806848 2738541294 Bacteria 6925949
701 2738809973 2738541294 Bacteria 6925949
702 2738857324 2738541303 Bacteria 6591772
703 2738859417 2738541303 Bacteria 6591772
704 2738894208 2738541309 Bacteria 6926455
705 2738897333 2738541309 Bacteria 6926455
706 2739197511 2738543004 Bacteria 6381073
707 2739197520 2738543004 Bacteria 6381073
708 2739258763 2738543015 Bacteria 6750701
709 2739258772 2738543015 Bacteria 6750701
710 2774122517 2773857670 Bacteria 6407454
711 2784314650 2784132072 Bacteria 6596533
712 2808929135 2808606377 Bacteria 6646337
713 2808951256 2808606381 Bacteria 6646461
714 2808977061 2808606385 Bacteria 6711065
715 2808979105 2808606385 Bacteria 6711065
716 2808992216 2808606388 Bacteria 6706662
717 2808995012 2808606388 Bacteria 6706662
718 2817491185 2816332298 Bacteria 6852809
719 2817492109 2816332298 Bacteria 6852809
720 2819702039 2818991464 Bacteria 6907494
721 2834032927 2834028612 Bacteria 6354979
722 2834034024 2834028612 Bacteria 6354979
723 2842826941 2842826826 Bacteria 5974129
724 2842828132 2842826826 Bacteria 5974129
725 2842839288 2842837860 Bacteria 6066181
726 2842842798 2842837860 Bacteria 6066181
727 2844672001 2844665904 Bacteria 6817974
728 2852613605 2852612431 Bacteria 6885235
729 2852614451 2852612431 Bacteria 6885235
730 2852667811 2852667396 Bacteria 6885555
731 2852668659 2852667396 Bacteria 6885555
732 2860342749 2860339153 Bacteria 6846989
733 2860342759 2860339153 Bacteria 6846989
734 2860870616 2860867994 Bacteria 5645326
735 2860871225 2860867994 Bacteria 5645326
736 2904552456 2904550169 Bacteria 6221258
737 2904552465 2904550169 Bacteria 6221258
738 2908449745 2908446538 Bacteria 6829095
739 2908450579 2908446538 Bacteria 6829095
740 2917075346 2917070673 Bacteria 6868303
741 2919460668 2919456309 Bacteria 6586567
742 2919460678 2919456309 Bacteria 6586567
743 2919698405 2919697872 Bacteria 6553725
744 2919698417 2919697872 Bacteria 6553725
745 2929192611 2929189879 Bacteria 5930554
746 2929193285 2929189879 Bacteria 5930554
747 2931394003 2931390751 Bacteria 6273349
748 2931394601 2931390751 Bacteria 6273349
749 2931401702 2931396565 Bacteria 7251677
750 2931401712 2931396565 Bacteria 7251677
751 2935356333 2935353572 Unclassified 6955622
752 2945932721 2945928738 Bacteria 6053221
753 2945933465 2945928738 Bacteria 6053221
754 2945962708 2945961074 Bacteria 7342064
755 2945963427 2945961074 Bacteria 7342064
756 2946009780 2946006987 Bacteria 6705746
757 2946030935 2946027586 Bacteria 6049274
758 2946031581 2946027586 Bacteria 6049274
759 2947237748 2947233263 Bacteria 6439278
760 2947238553 2947233263 Bacteria 6439278
761 2984289450 2984286254 Bacteria 6702062
762 3007396013 3007395558 Bacteria 6755444
763 3007422050 3007419365 Bacteria 7026924
764 3007422904 3007419365 Bacteria 7026924
765 3007514403 3007511990 Bacteria 6481491
766 3007620804 3007619802 Bacteria 6411688
767 637321798 637000220 Bacteria 7074893
768 8019772944 8019769354 Bacteria 6924660
769 8019779154 8019775933 Bacteria 6858656
770 8019779166 8019775933 Bacteria 6858656
771 8054285360 8054285046 Bacteria 6919322
772 8054286657 8054285046 Bacteria 6919322
773 8054348573 8054347763 Bacteria 5901107
774 8054352278 8054347763 Bacteria 5901107
775 8054506365 8054503363 Bacteria 6101651
776 8054507104 8054503363 Bacteria 6101651
777 8055821114 8055817908 Bacteria 6609162
778 8055822054 8055817908 Bacteria 6609162
779 8056134797 8056131705 Bacteria 6107031
780 8056135546 8056131705 Bacteria 6107031
781 8056151991 8056148874 Bacteria 6479865
782 8056154770 8056148874 Bacteria 6479865
783 8056161710 8056161164 Bacteria 6106669
784 8056166069 8056161164 Bacteria 6106669
785 8057804296 8057798959 Bacteria 6713499
786 Ga0495687_003273
787 MRS2a_Contig_19
788 MRS2a_Contig_7067
789 SwRhRL2b_contig_219132
790 JGI25162J39368_1000065
791 JGI25162J39368_1000190
792 JGI25163J39215_1000128
793 JGI25163J39215_1000338
794 JGI25164J39214_1000038
795 JGI25164J39214_1000157
796 JGI25165J46597_1000126
797 JGI25165J46597_1000284
798 Ga0055538_1000007
799 Ga0055539_1000011
800 Ga0055533_1000014
801 Ga0055532_1000009
802 Ga0055525_1000016
803 Ga0055536_1000025
804 Ga0055536_1000053
805 Ga0055530_10000007
806 Ga0055530_10000219
807 Ga0055530_10007271
808 Ga0055530_10008051
809 Ga0055540_1000006
810 Ga0055540_1000125
811 Ga0055531_10001653
812 Ga0055541_1000008
813 Ga0065714_10000048
814 Ga0065714_10002770
815 Ga0065714_10003988
816 Ga0065714_10007581
817 Ga0065714_10065674
818 Ga0065714_10066434
819 Ga0065714_10069400
820 Ga0065714_10069849
821 Ga0065704_10083380
822 Ga0065712_10071467
823 Ga0070670_100000079
824 Ga0070670_100000242
825 Ga0070670_100001182
826 Ga0070670_100034655
827 Ga0070661_100000024
828 Ga0070661_100000151
829 Ga0070669_100000630
830 Ga0070669_100001022
831 Ga0068853_100013996
832 Ga0068853_100039228
833 Ga0070664_100000024
834 Ga0070664_100000095
835 Ga0068851_10000119
836 Ga0068851_10000552
837 Ga0075364_10009199
838 Ga0075364_10052995
839 Ga0075432_10000898
840 Ga0075432_10002446
841 Ga0075432_10005364
842 Ga0075432_10013825
843 Ga0075362_10005910
844 Ga0079104_1000143
845 Ga0105251_10000056
846 Ga0105251_10000088
847 Ga0105251_10000571
848 Ga0105251_10002980
849 Ga0105251_10008065
850 Ga0105251_10008927
851 Ga0105251_10016806
852 Ga0105251_10036872
853 Ga0105244_10000277
854 Ga0105244_10000325
855 Ga0105244_10000907
856 Ga0105244_10001433
857 Ga0105244_10001472
858 Ga0105244_10002913
859 Ga0105244_10004021
860 Ga0105244_10005595
861 Ga0105244_10006752
862 Ga0105244_10014311
863 Ga0105244_10026854
864 Ga0105250_10000015
865 Ga0105250_10000038
866 Ga0105250_10000304
867 Ga0105250_10001563
868 Ga0105250_10005002
869 Ga0105250_10030287
870 Ga0105243_10000020
871 Ga0105243_10000321
872 Ga0105243_10123106
873 Ga0105242_10002506
874 Ga0105242_10005013
875 Ga0105237_10000009
876 Ga0105237_10000042
877 Ga0105237_10094990
878 Ga0105249_10019228
879 Ga0105246_10000010
880 Ga0105246_10002448
881 Ga0157373_10000084
882 Ga0157373_10000144
883 Ga0157373_10003092
884 Ga0157373_10003868
885 Ga0157373_10005100
886 Ga0157373_10015658
887 Ga0157373_10027029
888 Ga0157373_10029199
889 Ga0157373_10030727
890 Ga0157373_10066447
891 Ga0157371_10000635
892 Ga0157371_10001258
893 Ga0157370_10002554
894 Ga0157370_10016221
895 Ga0157370_10035914
896 Ga0157370_10041014
897 Ga0157370_10121599
898 Ga0157369_10001116
899 Ga0157369_10004854
900 Ga0157369_10019056
901 Ga0157369_10094355
902 Ga0157375_10000930
903 Ga0157375_10001060
904 Ga0157375_10001137
905 Ga0157375_10037492
906 Ga0157375_10092698
907 Ga0182008_10000153
908 Ga0182008_10000483
909 Ga0182008_10000907
910 Ga0182008_10001506
911 Ga0182008_10002733
912 Ga0182008_10016275
913 Ga0182008_10021821
914 Ga0182006_1000165
915 Ga0182006_1000196
916 Ga0182006_1000387
917 Ga0182006_1007913
918 Ga0182007_10000089
919 Ga0182007_10000108
920 Ga0182007_10009387
921 Ga0182005_1000470
922 Ga0182005_1000917
923 Ga0182005_1000969
924 Ga0163161_10001603
925 Ga0163161_10003345
926 Ga0163161_10004392
927 Ga0163161_10006781
928 Ga0163161_10009162
929 Ga0163161_10010601
930 Ga0163161_10023843
931 Ga0163161_10029906
932 Ga0163161_10053825
933 Ga0163161_10071678
934 Ga0163161_10103718
935 Ga0209435_100687
936 Ga0209760_100036
937 Ga0209760_100095
938 Ga0209784_100023
939 Ga0209566_100019
940 Ga0209674_100034
941 Ga0209147_100027
942 Ga0209563_100037
943 Ga0207427_100004
944 Ga0207427_100007
945 Ga0209437_100006
946 Ga0209437_100025
947 Ga0209258_100166
948 Ga0209646_1000318
949 Ga0209677_100021
950 Ga0209759_1002349
951 Ga0209233_1000086
952 Ga0209233_1000145
953 Ga0209676_1000002
954 Ga0209676_1000003
955 Ga0209676_1003284
956 Ga0209050_1000004
957 Ga0209050_1000006
958 Ga0209050_1000763
959 Ga0209051_1000001
960 Ga0209051_1000006
961 Ga0209051_1004500
962 Ga0209257_1000029
963 Ga0207696_1000017
964 Ga0207696_1000108
965 Ga0207696_1000123
966 Ga0207696_1000460
967 Ga0207655_1000006
968 Ga0207655_1000074
969 Ga0207655_1000098
970 Ga0207655_1000114
971 Ga0207655_1000410
972 Ga0207655_1002318
973 Ga0207655_1003616
974 Ga0207655_1004568
975 Ga0207655_1006831
976 Ga0207655_1008809
977 Ga0207655_1009171
978 Ga0207655_1015886
979 Ga0207655_1034974
980 Ga0207713_1000061
981 Ga0207713_1000097
982 Ga0207713_1000284
983 Ga0207713_1006155
984 Ga0207713_1008243
985 Ga0207713_1011419
986 Ga0207713_1041350
987 Ga0207671_10000474
988 Ga0207671_10000561
989 Ga0207649_10000010
990 Ga0207649_10000032
991 Ga0207681_10000299
992 Ga0207681_10003542
993 Ga0207650_10000068
994 Ga0207650_10000259
995 Ga0207650_10000690
996 Ga0207650_10023505
997 Ga0207706_10002181
998 Ga0207706_10004102
999 Ga0207686_10002348
1000 Ga0207686_10008489
1001 Ga0207709_10000004
1002 Ga0207709_10001932
1003 Ga0207679_10000022
1004 Ga0207679_10000059
1005 Ga0207639_10052864
1006 Ga0209281_1000063
1007 Ga0207428_10032595
1008 Ga0207428_10127558
1009 Ga0307511_10053051
1010 Ga0307405_10000118
1011 Ga0307405_10018233
1012 Ga0439447_001977
1013 Ga0439466_0001711
1014 Ga0439466_0015323
1015 Ga0439432_000084
1016 Ga0439432_000085
1017 Ga0439451_005228
1018 Ga0495617_000148
1019 Ga0495617_000512
1020 Ga0495617_001162
1021 Ga0495617_001573
1022 Ga0495617_003501
1023 Ga0495617_007522
1024 Ga0495627_000779
1025 Ga0495603_0020988
1026 Ga0495603_0051857
1027 Ga0495590_0000177
1028 Ga0495590_0000641
1029 Ga0495590_0001583
1030 Ga0495590_0003703
1031 Ga0495590_0014179
1032 Ga0495591_000786
1033 Ga0495591_001537
1034 Ga0495591_002201
1035 Ga0495591_009526
1036 Ga0495638_0001323
1037 Ga0495638_0002354
1038 Ga0495638_0011453
1039 Ga0495638_0021055
1040 Ga0495653_0004505
1041 Ga0495653_0019284
1042 Ga0495650_0001775
1043 Ga0495650_0002651
1044 Ga0495650_0002735
1045 Ga0495650_0015582
1046 Ga0495582_0002904
1047 Ga0495582_0003371
1048 Ga0495605_0000054
1049 Ga0495605_0000778
1050 Ga0495605_0000840
1051 Ga0495605_0002335
1052 Ga0495605_0009888
1053 Ga0495605_0010382
1054 Ga0495605_0025277
1055 Ga0495639_0000053
1056 Ga0495639_0032617
1057 Ga0495639_0038065
1058 Ga0495584_0000120
1059 Ga0495584_0002083
1060 Ga0495584_0002413
1061 Ga0495584_0006307
1062 Ga0495584_0008390
1063 Ga0495584_0029166
1064 Ga0495585_0002861
1065 Ga0495585_0010533
1066 Ga0495585_0010605
1067 Ga0495585_0042153
1068 Ga0495594_0001277
1069 Ga0495594_0020571
1070 Ga0495594_0020880
1071 Ga0495594_0021067
1072 Ga0495607_0000036
1073 Ga0495607_0000041
1074 Ga0495607_0003777
1075 Ga0495607_0003897
1076 Ga0495607_0006048
1077 Ga0495607_0007191
1078 Ga0495607_0015516
1079 Ga0495607_0019764
1080 Ga0495607_0039221
1081 Ga0495607_0045522
1082 Ga0495583_0000387
1083 Ga0495583_0001245
1084 Ga0495583_0005112
1085 Ga0495583_0009646
1086 Ga0495583_0016921
1087 Ga0495583_0017034
1088 Ga0495606_0000079
1089 Ga0495606_0000191
1090 Ga0495606_0001484
1091 Ga0495606_0002351
1092 Ga0495606_0002606
1093 Ga0495606_0016943
1094 Ga0495606_0025524
1095 Ga0495610_0000455
1096 Ga0495610_0000653
1097 Ga0495610_0023899
1098 Ga0495610_0032676
1099 Ga0495616_0000535
1100 Ga0495616_0000695
1101 Ga0495616_0006004
1102 Ga0495620_0000152
1103 Ga0495620_0001300
1104 Ga0495620_0001539
1105 Ga0495620_0011843
1106 Ga0495620_0017374
1107 Ga0495630_0004903
1108 Ga0495630_0009776
1109 Ga0495630_0011384
1110 Ga0495630_0016625
1111 Ga0495631_0000175
1112 Ga0495631_0009829
1113 Ga0495631_0015945
1114 Ga0495632_0001161
1115 Ga0495632_0001632
1116 Ga0495632_0003232
1117 Ga0495632_0008562
1118 Ga0495637_0000950
1119 Ga0495637_0001455
1120 Ga0495637_0002447
1121 Ga0495637_0011047
1122 Ga0495643_0035792
1123 Ga0495648_0000062
1124 Ga0495648_0002500
1125 Ga0495648_0004708
1126 Ga0495648_0021752
1127 Ga0495648_0022960
1128 Ga0495648_0023943
1129 Ga0495648_0024744
1130 Ga0495648_0024972
1131 Ga0495648_0026624
1132 Ga0495648_0032415
1133 Ga0495666_0000675
1134 Ga0495666_0000908
1135 Ga0495666_0001190
1136 Ga0495666_0001595
1137 Ga0495666_0004499
1138 Ga0495666_0016517
1139 Ga0495642_0000006
1140 Ga0495642_0000044
1141 Ga0495642_0000453
1142 Ga0495642_0001263
1143 Ga0495654_0000166
1144 Ga0495654_0000600
1145 Ga0495654_0001154
1146 Ga0495654_0004479
1147 Ga0495654_0006971
1148 Ga0495654_0013073
1149 Ga0495654_0016886
1150 Ga0495654_0017811
1151 Ga0495654_0018902
1152 Ga0495654_0024159
1153 Ga0495654_0027907
1154 Ga0495587_0001167
1155 Ga0495587_0001738
1156 Ga0495587_0003803
1157 Ga0495609_0001281
1158 Ga0495609_0001936
1159 Ga0495609_0005054
1160 Ga0495609_0038226
1161 Ga0495597_0004988
1162 Ga0495645_0116822
1163 Ga0495622_0000182
1164 Ga0495622_0000249
1165 Ga0495622_0002204
1166 Ga0495622_0006591
1167 Ga0495622_0011716
1168 Ga0495622_0012172
1169 Ga0495622_0017579
1170 Ga0495622_0019411
1171 Ga0495633_0002268
1172 Ga0495633_0012603
1173 Ga0495633_0015354
1174 Ga0495633_0019111
1175 Ga0495633_0022226
1176 Ga0495656_0000803
1177 Ga0495668_0007019
1178 Ga0495634_0000815
1179 Ga0495611_0001469
1180 Ga0495625_0015061
1181 Ga0495625_0019113
1182 Ga0495625_0029114
1183 Ga0495635_0000522
1184 Ga0495635_0003105
1185 Ga0495635_0005853
1186 Ga0495659_0000119
1187 Ga0495661_0000051
1188 Ga0495661_0000269
1189 Ga0495661_0000692
1190 Ga0495661_0000896
1191 Ga0495661_0005186
1192 Ga0495661_0006152
1193 Ga0495661_0025282
1194 Ga0495588_0003667
1195 Ga0495588_0061956
1196 Ga0495623_0002086
1197 Ga0495623_0009066
1198 Ga0495623_0016801
1199 Ga0495646_0003353
1200 Ga0495646_0003495
1201 Ga0495646_0008611
1202 Ga0495669_0001087
1203 Ga0495613_0020085
1204 Ga0495670_0000666
1205 Ga0495670_0007044
1206 Ga0495670_0012161
1207 Ga0495671_0000210
1208 Ga0495671_0001187
1209 Ga0495671_0001243
1210 Ga0495671_0004999
1211 Ga0495671_0006777
1212 Ga0495671_0007263
1213 Ga0495671_0013549
1214 Ga0495671_0017328
1215 Ga0495671_0060924
1216 Ga0495649_0000027
1217 Ga0495649_0000661
1218 Ga0495649_0000748
1219 Ga0495649_0002235
1220 Ga0495649_0002964
1221 Ga0495649_0005325
1222 Ga0495649_0007535
1223 Ga0495649_0009159
1224 Ga0495649_0012051
1225 Ga0495649_0040307
1226 Ga0495589_0000326
1227 Ga0495589_0000352
1228 Ga0495589_0001445
1229 Ga0495589_0012195
1230 Ga0495589_0014155
1231 Ga0495589_0017546
1232 Ga0495589_0019080
1233 Ga0495600_0005060
1234 Ga0495600_0006261
1235 Ga0495600_0027497
1236 Ga0495600_0030109
1237 Ga0495660_0001157
1238 Ga0495660_0003033
1239 Ga0495660_0005612
1240 Ga0495660_0017436
1241 Ga0495660_0039345
1242 Ga0495660_0049689
1243 Ga0495581_0000629
1244 Ga0495581_0025132
1245 Ga0495581_0035195
1246 Ga0495604_0000719
1247 Ga0495604_0003585
1248 Ga0495604_0023955
1249 Ga0495604_0045394
1250 Ga0495636_0005847
1251 Ga0495674_0009374
1252 Ga0495674_0022058
1253 Ga0495672_0000817
1254 Ga0495672_0001555
1255 Ga0495672_0001972
1256 Ga0495672_0002413
1257 Ga0495672_0003184
1258 Ga0495672_0003332
1259 Ga0495672_0025473
1260 Ga0495676_0091561
1261 Ga0495680_0002029
1262 Ga0495680_0008709
1263 Ga0495680_0027810
1264 Ga0495680_0034253
1265 Ga0495680_0077415
1266 Ga0495680_0163023
1267 Ga0495683_0000318
1268 Ga0495683_0000356
1269 Ga0495683_0000412
1270 Ga0495683_0013044
1271 Ga0495683_0020041
1272 Ga0495687_000977
1273 Ga0495687_001427
1274 Ga0495687_002230
1275 Ga0495687_006152
1276 Ga0495687_007971
1277 Ga0495687_014259
1278 Ga0495675_0005089
1279 Ga0495675_0006802
1280 Ga0495675_0009385
1281 Ga0495675_0023304
1282 Ga0495677_0000848
1283 Ga0495679_000571
1284 Ga0495679_000688
1285 Ga0495679_001183
1286 Ga0495679_008771
1287 Ga0495679_010574
1288 Ga0495679_010914
1289 Ga0495679_015261
1290 Ga0495673_0000118
1291 Ga0495673_0000465
1292 Ga0495673_0001380
1293 Ga0495673_0001451
1294 Ga0495673_0002619
1295 Ga0495673_0003971
1296 Ga0495673_0004085
1297 Ga0495673_0011327
1298 Ga0495673_0012355
1299 Ga0495673_0014936
1300 Ga0495673_0029955
1301 Ga0495681_0000353
1302 Ga0495681_0001105
1303 Ga0495681_0001797
1304 Ga0495681_0002137
1305 Ga0495681_0003644
1306 Ga0495681_0004853
1307 Ga0495681_0005548
1308 Ga0495681_0019515
1309 Ga0495684_0009792
1310 Ga0495684_0010777
1311 Ga0495593_0001031
1312 Ga0495593_0001066
1313 Ga0495593_0001207
1314 Ga0495593_0014141
1315 Ga0495593_0017983
1316 Ga0495626_0000064
1317 Ga0495626_0000616
1318 Ga0495626_0000958
1319 Ga0495626_0010980
1320 Ga0495626_0018101
1321 Ga0496102_0000774
1322 Ga0496103_0001166
1323 Ga0496103_0020077
1324 Ga0496105_0104696
1325 Ga0496110_0029657
1326 Ga0496111_0041086
1327 Ga0496112_0008665
1328 Ga0496116_0000825
1329 Ga0496116_0001933
1330 Ga0496116_0003233
1331 Ga0496116_0029546
1332 Ga0496117_0001387
1333 Ga0496117_0001466
1334 Ga0496117_0004097
1335 Ga0496117_0004579
1336 Ga0496117_0006305
1337 Ga0496117_0007085
1338 Ga0496117_0012383
1339 Ga0496117_0020112
1340 Ga0496117_0037708
1341 Ga0496117_0057678
1342 Ga0496118_0006407
1343 Ga0496118_0006676
1344 Ga0496118_0007833
1345 Ga0496118_0008698
1346 Ga0496118_0013212
1347 Ga0496118_0021455
1348 Ga0496118_0032834
1349 Ga0496118_0034082
1350 Ga0496118_0042318
1351 Ga0496119_0005391
1352 Ga0496119_0012038
1353 Ga0496120_0002592
1354 Ga0496120_0003163
1355 Ga0496120_0025586
1356 Ga0496121_0001708
1357 Ga0496121_0001836
1358 Ga0496121_0004020
1359 Ga0496121_0059820
1360 Ga0496122_0003219
1361 Ga0496122_0004867
1362 Ga0496122_0005852
1363 Ga0496122_0025179
1364 Ga0496122_0054287
1365 Ga0496123_0001969
1366 Ga0496123_0004383
1367 Ga0496123_0004572
1368 Ga0496123_0018021
1369 Ga0496123_0024051
1370 Ga0496123_0045752
1371 Ga0496124_0001124
1372 Ga0496124_0001537
1373 Ga0496124_0004348
1374 Ga0496124_0016348
1375 Ga0496124_0018426
1376 Ga0496124_0045697
1377 Ga0496124_0099058
1378 Ga0496124_0203069
1379 Ga0496125_0000842
1380 Ga0496125_0002577
1381 Ga0496125_0004187
1382 Ga0496125_0004204
1383 Ga0496125_0039387
1384 Ga0496125_0048564
1385 Ga0496125_0060557
1386 Ga0496125_0072714
1387 Ga0496126_0001228
1388 Ga0496126_0002401
1389 Ga0496126_0044914
1390 Ga0495678_000578
1391 Ga0495678_000634
1392 Ga0495678_004245
1393 Ga0495678_013459
1394 Ga0495678_017574
1395 Ga0495678_020293
1396 Ga0495678_024207
1397 Ga0495682_0000025
1398 Ga0495682_0000099
1399 Ga0495682_0001201
1400 Ga0495682_0001269
1401 Ga0495682_0001679
1402 Ga0495682_0003138
1403 Ga0495682_0006579
1404 nmdc:mga03683_12119_c1
1405 nmdc:mga03683_7051_c1
1406 nmdc:mga00v17_48890_c1
1407 Ga0500618_005847
1408 Ga0500573_0029972
1409 Ga0500634_0000141
1410 Ga0500634_0031016
1411 2511255183
1412 2511271811
1413 2511271823
1414 2511277938
1415 2511301533
1416 2511301542
1417 2511312487
1418 2511312496
1419 2511318147
1420 2511318249
1421 2511334555
1422 2511334571
1423 2511351798
1424 2511351807
1425 2511363438
1426 2554813761
1427 2555671476
1428 2597863932
1429 2597864743
1430 2597869835
1431 2597870596
1432 2599354365
1433 2599359921
1434 2599366243
1435 2599373033
1436 2599379473
1437 2599385549
1438 2599391892
1439 2599397925
1440 2599398329
1441 2599403658
1442 2599450351
1443 2599452371
1444 2599461199
1445 2599469741
1446 2599490219
1447 2599506935
1448 2599507375
1449 2599512833
1450 2599513250
1451 2599518250
1452 2599522139
1453 2599878044
1454 2599881331
1455 2599891510
1456 2599891926
1457 2599946649
1458 2599947256
1459 2600213814
1460 2601689973
1461 2601691873
1462 2601773982
1463 2608381083
1464 2621298734
1465 2621299892
1466 2624492219
1467 2624492231
1468 2643871441
1469 2643874216
1470 2643956783
1471 2644024706
1472 2644189894
1473 2644189906
1474 2644620202
1475 2644622432
1476 2671096946
1477 2677896551
1478 2677900777
1479 2723248720
1480 2723249518
1481 2738669889
1482 2738671983
1483 2738748282
1484 2738750377
1485 2738806848
1486 2738809973
1487 2738857324
1488 2738859417
1489 2738894208
1490 2738897333
1491 2739197511
1492 2739197520
1493 2739258763
1494 2739258772
1495 2774122517
1496 2784314650
1497 2808929135
1498 2808951256
1499 2808977061
1500 2808979105
1501 2808992216
1502 2808995012
1503 2817491185
1504 2817492109
1505 2819702039
1506 2834032927
1507 2834034024
1508 2842826941
1509 2842828132
1510 2842839288
1511 2842842798
1512 2844672001
1513 2852613605
1514 2852614451
1515 2852667811
1516 2852668659
1517 2860342749
1518 2860342759
1519 2860870616
1520 2860871225
1521 2904552456
1522 2904552465
1523 2908449745
1524 2908450579
1525 2917075346
1526 2919460668
1527 2919460678
1528 2919698405
1529 2919698417
1530 2929192611
1531 2929193285
1532 2931394003
1533 2931394601
1534 2931401702
1535 2931401712
1536 2935356333
1537 2945932721
1538 2945933465
1539 2945962708
1540 2945963427
1541 2946009780
1542 2946030935
1543 2946031581
1544 2947237748
1545 2947238553
1546 2984289450
1547 3007396013
1548 3007422050
1549 3007422904
1550 3007514403
1551 3007620804
1552 637321798
1553 8019772944
1554 8019779154
1555 8019779166
1556 8054285360
1557 8054286657
1558 8054348573
1559 8054352278
1560 8054506365
1561 8054507104
1562 8055821114
1563 8055822054
1564 8056134797
1565 8056135546
1566 8056151991
1567 8056154770
1568 8056161710
1569 8056166069
1570 8057804296

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02366

PMT

Dolichyl-phosphate-mannose-protein mannosyltransferase

58

291

0.92

PF13231

PMT_2

Dolichyl-phosphate-mannose-protein mannosyltransferase

114

278

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.8144 1 523
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.8046 1 523
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.7902 1 523
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.7806 1 523
6p2r-assembly1.cif.gz_B structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor 0.7174 9 222
ID Description Score Start End Superfamily
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6698 66 220 1.20.1250.20
af_B0R1B6_262_375_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.6657 140 179 1.25.40.20
af_Q9VEA9_238_314_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6092 108 175 1.20.58.80
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6025 66 220 1.20.1250.20
4a5xB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5765 108 175 1.20.58.80
ID Description Score Start End GO Terms
AF-Q4ZSZ0-F1-model_v4 Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (EC 2.4.2.43) (4-amino-4-deoxy-L-arabinose lipid A transferase) (Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) 0.9524 3 529 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0009245
GO:0010041
GO:0103015
AF-Q4ZSZ0-F1-model_v4 Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (EC 2.4.2.43) (4-amino-4-deoxy-L-arabinose lipid A transferase) (Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) 0.9472 3 529 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0009245
GO:0010041
GO:0103015
AF-A0A656YUT7-F1-model_v4 deleted 0.9454 126 527
AF-A0A5M8F875-F1-model_v4 Phospholipid carrier-dependent glycosyltransferase 0.9286 1 302 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0010041
GO:0016763
AF-A0A379FIQ2-F1-model_v4 4-amino-4-deoxy-L-arabinose transferase (EC 2.4.2.43) 0.9219 42 193 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0010041
GO:0103015

Map