F482188
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 279 | 1570 | 548 |
Family's Representative Sequence
| Representative Sequence | 3300047443|Ga0495687_003273|Ga0495687_003273_6609_8423 |
| Length | 604 |
| Sequence | LNFSLFNIIPVFSLASCTSLFNQPSQRQGPDMTSNQPLPDFAGHSSRLHAPTVPANERRMIFALFLAXXXXYLLPLMSHGLWIPDETRYAQISQEMLQGGNWVSPYFMGLRYFEKPIAGYWMIAIGQAVFGDNLFGVRIASALSTGLSVWLTYLIARRFWGDPRKSFACALLYMSFGLIAGQAGYANLDPQFTLWVNLSLVSLWFAIDSRTPRARLGAWAVLGVACGMGFMTKGFLAWLLPAAIALPYMLWQRRIGELLRYGPLAVVVAAAVCLPWALAIHHQEPDFWNFFFWNEHVRRFAADNAQHARPWWFYLPMLVVSALPWAALLPTTFIQAWNNKRQPVSGFLLLWLLLPLAIFSMSSGKLPTYIMPCLLPLALLMGHALTSLLEQARGRTIRFNGWLNVVIATTALIALLYLQLSKEIFENTEMFSLSLAFIVLLGWIIANALQILRPLTLWAMPALGIWLLVALLPAAMPNQIVDSKMPDRFISEHLDSLNQTTSLLSNDLGAASALSWLTRRPEVALYNVVGEMKYGLQDPAAASRKVTLQDVGQWMTEARKKGSVGVVMRVNSVDEFQEVEALPIDGKRYQRGNLQVLIFPQIQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 28 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 31 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 45 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 50 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 60 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 80 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 81 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 82 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 83 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 84 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 85 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 86 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 87 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 168 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 169 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 170 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 171 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 172 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 173 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 174 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 177 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 178 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 179 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 180 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 181 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 182 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 183 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 184 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 185 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 186 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 187 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 188 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 189 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 190 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 191 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 192 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 193 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 194 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 195 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 196 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 197 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 198 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 199 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 200 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 201 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 202 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 203 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 204 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 205 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 206 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 207 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 208 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 209 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 210 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 211 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 212 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 213 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 214 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 215 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 216 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 217 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 218 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 219 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 220 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 221 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 222 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 223 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 224 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 225 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 226 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 227 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 228 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 229 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 230 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 231 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 232 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 233 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 234 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 235 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 236 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 237 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 238 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 239 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 240 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 241 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 242 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 243 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 244 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 245 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 246 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 247 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 248 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 249 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 250 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 251 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 252 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 253 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 254 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 255 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 256 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 257 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 258 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 259 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 260 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 261 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 262 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 263 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 264 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 265 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 266 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 267 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 268 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 269 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 270 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 271 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 272 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 273 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 274 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 275 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 276 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 277 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 278 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 279 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.46 |
| Metatranscriptomes | 0 |
| Isolates | 19.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.2 |
| Nodule | 2.32 |
| Rhizoplane | 5.13 |
| Rhizosphere | 71.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495687_003273 | 3300047443 | Bacteria | 11928 |
| 2 | MRS2a_Contig_19 | 2124908027 | Bacteria | 54562 |
| 3 | MRS2a_Contig_7067 | 2124908027 | Bacteria | 5082 |
| 4 | SwRhRL2b_contig_219132 | 2162886007 | Bacteria | 1935 |
| 5 | JGI25162J39368_1000065 | 3300002737 | Bacteria | 131083 |
| 6 | JGI25162J39368_1000190 | 3300002737 | Bacteria | 64314 |
| 7 | JGI25163J39215_1000128 | 3300002771 | Bacteria | 31313 |
| 8 | JGI25163J39215_1000338 | 3300002771 | Bacteria | 15458 |
| 9 | JGI25164J39214_1000038 | 3300002772 | Bacteria | 131082 |
| 10 | JGI25164J39214_1000157 | 3300002772 | Bacteria | 64314 |
| 11 | JGI25165J46597_1000126 | 3300003214 | Bacteria | 131083 |
| 12 | JGI25165J46597_1000284 | 3300003214 | Bacteria | 64314 |
| 13 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 14 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 15 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 16 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 17 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 18 | Ga0055536_1000025 | 3300003781 | Bacteria | 183172 |
| 19 | Ga0055536_1000053 | 3300003781 | Bacteria | 110030 |
| 20 | Ga0055530_10000007 | 3300003791 | Bacteria | 183172 |
| 21 | Ga0055530_10000219 | 3300003791 | Bacteria | 51126 |
| 22 | Ga0055530_10007271 | 3300003791 | Bacteria | 4701 |
| 23 | Ga0055530_10008051 | 3300003791 | Bacteria | 4298 |
| 24 | Ga0055540_1000006 | 3300003792 | Bacteria | 372018 |
| 25 | Ga0055540_1000125 | 3300003792 | Bacteria | 79312 |
| 26 | Ga0055531_10001653 | 3300003794 | Bacteria | 16091 |
| 27 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 28 | Ga0065714_10000048 | 3300005288 | Bacteria | 23148 |
| 29 | Ga0065714_10002770 | 3300005288 | Bacteria | 11621 |
| 30 | Ga0065714_10003988 | 3300005288 | Bacteria | 6429 |
| 31 | Ga0065714_10007581 | 3300005288 | Bacteria | 4911 |
| 32 | Ga0065714_10065674 | 3300005288 | Bacteria | 8904 |
| 33 | Ga0065714_10066434 | 3300005288 | Bacteria | 6862 |
| 34 | Ga0065714_10069400 | 3300005288 | Bacteria | 4240 |
| 35 | Ga0065714_10069849 | 3300005288 | Bacteria | 4063 |
| 36 | Ga0065704_10083380 | 3300005289 | Bacteria | 3468 |
| 37 | Ga0065712_10071467 | 3300005290 | Bacteria | 5248 |
| 38 | Ga0070670_100000079 | 3300005331 | Bacteria | 92916 |
| 39 | Ga0070670_100000242 | 3300005331 | Bacteria | 49330 |
| 40 | Ga0070670_100001182 | 3300005331 | Bacteria | 20700 |
| 41 | Ga0070670_100034655 | 3300005331 | Bacteria | 4344 |
| 42 | Ga0070661_100000024 | 3300005344 | Bacteria | 121810 |
| 43 | Ga0070661_100000151 | 3300005344 | Bacteria | 56885 |
| 44 | Ga0070669_100000630 | 3300005353 | Bacteria | 26064 |
| 45 | Ga0070669_100001022 | 3300005353 | Bacteria | 20393 |
| 46 | Ga0068853_100013996 | 3300005539 | Bacteria | 6563 |
| 47 | Ga0068853_100039228 | 3300005539 | Bacteria | 4039 |
| 48 | Ga0070664_100000024 | 3300005564 | Bacteria | 94521 |
| 49 | Ga0070664_100000095 | 3300005564 | Bacteria | 56885 |
| 50 | Ga0068851_10000119 | 3300005834 | Bacteria | 42402 |
| 51 | Ga0068851_10000552 | 3300005834 | Bacteria | 16293 |
| 52 | Ga0075364_10009199 | 3300006051 | Bacteria | 5919 |
| 53 | Ga0075364_10052995 | 3300006051 | Bacteria | 2651 |
| 54 | Ga0075432_10000898 | 3300006058 | Bacteria | 9361 |
| 55 | Ga0075432_10002446 | 3300006058 | Bacteria | 6182 |
| 56 | Ga0075432_10005364 | 3300006058 | Bacteria | 4370 |
| 57 | Ga0075432_10013825 | 3300006058 | Bacteria | 2746 |
| 58 | Ga0075362_10005910 | 3300006177 | Bacteria | 4520 |
| 59 | Ga0079104_1000143 | 3300006946 | Bacteria | 101361 |
| 60 | Ga0105251_10000056 | 3300009011 | Bacteria | 104296 |
| 61 | Ga0105251_10000088 | 3300009011 | Bacteria | 88504 |
| 62 | Ga0105251_10000571 | 3300009011 | Bacteria | 34449 |
| 63 | Ga0105251_10002980 | 3300009011 | Bacteria | 12671 |
| 64 | Ga0105251_10008065 | 3300009011 | Bacteria | 6381 |
| 65 | Ga0105251_10008927 | 3300009011 | Bacteria | 5991 |
| 66 | Ga0105251_10016806 | 3300009011 | Bacteria | 3939 |
| 67 | Ga0105251_10036872 | 3300009011 | Bacteria | 2403 |
| 68 | Ga0105244_10000277 | 3300009036 | Bacteria | 51399 |
| 69 | Ga0105244_10000325 | 3300009036 | Bacteria | 45650 |
| 70 | Ga0105244_10000907 | 3300009036 | Bacteria | 25017 |
| 71 | Ga0105244_10001433 | 3300009036 | Bacteria | 19301 |
| 72 | Ga0105244_10001472 | 3300009036 | Bacteria | 19010 |
| 73 | Ga0105244_10002913 | 3300009036 | Bacteria | 12642 |
| 74 | Ga0105244_10004021 | 3300009036 | Bacteria | 10276 |
| 75 | Ga0105244_10005595 | 3300009036 | Bacteria | 8308 |
| 76 | Ga0105244_10006752 | 3300009036 | Bacteria | 7379 |
| 77 | Ga0105244_10014311 | 3300009036 | Bacteria | 4592 |
| 78 | Ga0105244_10026854 | 3300009036 | Bacteria | 3111 |
| 79 | Ga0105250_10000015 | 3300009092 | Bacteria | 262683 |
| 80 | Ga0105250_10000038 | 3300009092 | Bacteria | 141225 |
| 81 | Ga0105250_10000304 | 3300009092 | Bacteria | 38571 |
| 82 | Ga0105250_10001563 | 3300009092 | Bacteria | 12305 |
| 83 | Ga0105250_10005002 | 3300009092 | Bacteria | 6006 |
| 84 | Ga0105250_10030287 | 3300009092 | Bacteria | 2176 |
| 85 | Ga0105243_10000020 | 3300009148 | Bacteria | 214279 |
| 86 | Ga0105243_10000321 | 3300009148 | Bacteria | 52717 |
| 87 | Ga0105243_10123106 | 3300009148 | Bacteria | 2190 |
| 88 | Ga0105242_10002506 | 3300009176 | Bacteria | 14403 |
| 89 | Ga0105242_10005013 | 3300009176 | Bacteria | 10238 |
| 90 | Ga0105237_10000009 | 3300009545 | Bacteria | 337615 |
| 91 | Ga0105237_10000042 | 3300009545 | Bacteria | 181280 |
| 92 | Ga0105237_10094990 | 3300009545 | Bacteria | 2970 |
| 93 | Ga0105249_10019228 | 3300009553 | Bacteria | 6092 |
| 94 | Ga0105246_10000010 | 3300011119 | Bacteria | 69400 |
| 95 | Ga0105246_10002448 | 3300011119 | Bacteria | 11207 |
| 96 | Ga0157373_10000084 | 3300013100 | Bacteria | 81436 |
| 97 | Ga0157373_10000144 | 3300013100 | Bacteria | 56939 |
| 98 | Ga0157373_10003092 | 3300013100 | Bacteria | 12574 |
| 99 | Ga0157373_10003868 | 3300013100 | Bacteria | 11315 |
| 100 | Ga0157373_10005100 | 3300013100 | Bacteria | 9873 |
| 101 | Ga0157373_10015658 | 3300013100 | Bacteria | 5540 |
| 102 | Ga0157373_10027029 | 3300013100 | Bacteria | 4140 |
| 103 | Ga0157373_10029199 | 3300013100 | Bacteria | 3974 |
| 104 | Ga0157373_10030727 | 3300013100 | Bacteria | 3865 |
| 105 | Ga0157373_10066447 | 3300013100 | Bacteria | 2551 |
| 106 | Ga0157371_10000635 | 3300013102 | Bacteria | 41753 |
| 107 | Ga0157371_10001258 | 3300013102 | Bacteria | 26748 |
| 108 | Ga0157370_10002554 | 3300013104 | Bacteria | 21839 |
| 109 | Ga0157370_10016221 | 3300013104 | Bacteria | 7550 |
| 110 | Ga0157370_10035914 | 3300013104 | Bacteria | 4813 |
| 111 | Ga0157370_10041014 | 3300013104 | Bacteria | 4468 |
| 112 | Ga0157370_10121599 | 3300013104 | Bacteria | 2437 |
| 113 | Ga0157369_10001116 | 3300013105 | Bacteria | 33559 |
| 114 | Ga0157369_10004854 | 3300013105 | Bacteria | 15777 |
| 115 | Ga0157369_10019056 | 3300013105 | Bacteria | 7683 |
| 116 | Ga0157369_10094355 | 3300013105 | Bacteria | 3194 |
| 117 | Ga0157375_10000930 | 3300013308 | Bacteria | 25364 |
| 118 | Ga0157375_10001060 | 3300013308 | Bacteria | 23747 |
| 119 | Ga0157375_10001137 | 3300013308 | Bacteria | 23049 |
| 120 | Ga0157375_10037492 | 3300013308 | Bacteria | 4646 |
| 121 | Ga0157375_10092698 | 3300013308 | Bacteria | 3085 |
| 122 | Ga0182008_10000153 | 3300014497 | Bacteria | 54130 |
| 123 | Ga0182008_10000483 | 3300014497 | Bacteria | 30249 |
| 124 | Ga0182008_10000907 | 3300014497 | Bacteria | 20608 |
| 125 | Ga0182008_10001506 | 3300014497 | Bacteria | 15547 |
| 126 | Ga0182008_10002733 | 3300014497 | Bacteria | 10938 |
| 127 | Ga0182008_10016275 | 3300014497 | Bacteria | 3866 |
| 128 | Ga0182008_10021821 | 3300014497 | Bacteria | 3287 |
| 129 | Ga0182006_1000165 | 3300015261 | Bacteria | 70092 |
| 130 | Ga0182006_1000196 | 3300015261 | Bacteria | 62428 |
| 131 | Ga0182006_1000387 | 3300015261 | Bacteria | 36363 |
| 132 | Ga0182006_1007913 | 3300015261 | Bacteria | 4837 |
| 133 | Ga0182007_10000089 | 3300015262 | Bacteria | 68189 |
| 134 | Ga0182007_10000108 | 3300015262 | Bacteria | 57807 |
| 135 | Ga0182007_10009387 | 3300015262 | Bacteria | 3948 |
| 136 | Ga0182005_1000470 | 3300015265 | Bacteria | 20931 |
| 137 | Ga0182005_1000917 | 3300015265 | Bacteria | 12880 |
| 138 | Ga0182005_1000969 | 3300015265 | Bacteria | 12456 |
| 139 | Ga0163161_10001603 | 3300017792 | Bacteria | 16684 |
| 140 | Ga0163161_10003345 | 3300017792 | Bacteria | 11243 |
| 141 | Ga0163161_10004392 | 3300017792 | Bacteria | 9833 |
| 142 | Ga0163161_10006781 | 3300017792 | Bacteria | 7912 |
| 143 | Ga0163161_10009162 | 3300017792 | Bacteria | 6841 |
| 144 | Ga0163161_10010601 | 3300017792 | Bacteria | 6380 |
| 145 | Ga0163161_10023843 | 3300017792 | Bacteria | 4318 |
| 146 | Ga0163161_10029906 | 3300017792 | Bacteria | 3873 |
| 147 | Ga0163161_10053825 | 3300017792 | Bacteria | 2919 |
| 148 | Ga0163161_10071678 | 3300017792 | Bacteria | 2536 |
| 149 | Ga0163161_10103718 | 3300017792 | Bacteria | 2119 |
| 150 | Ga0209435_100687 | 3300025206 | Bacteria | 5899 |
| 151 | Ga0209760_100036 | 3300025207 | Bacteria | 130845 |
| 152 | Ga0209760_100095 | 3300025207 | Bacteria | 68193 |
| 153 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 154 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 155 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 156 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 157 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 158 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 159 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 160 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 161 | Ga0209437_100025 | 3300025233 | Bacteria | 561333 |
| 162 | Ga0209258_100166 | 3300025242 | Bacteria | 148022 |
| 163 | Ga0209646_1000318 | 3300025246 | Bacteria | 37146 |
| 164 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 165 | Ga0209759_1002349 | 3300025256 | Bacteria | 8447 |
| 166 | Ga0209233_1000086 | 3300025261 | Bacteria | 331687 |
| 167 | Ga0209233_1000145 | 3300025261 | Bacteria | 188955 |
| 168 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 169 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 170 | Ga0209676_1003284 | 3300025292 | Bacteria | 10140 |
| 171 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 172 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 173 | Ga0209050_1000763 | 3300025298 | Bacteria | 46213 |
| 174 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 175 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 176 | Ga0209051_1004500 | 3300025303 | Bacteria | 8561 |
| 177 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 178 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 179 | Ga0207696_1000108 | 3300025711 | Bacteria | 157445 |
| 180 | Ga0207696_1000123 | 3300025711 | Bacteria | 141297 |
| 181 | Ga0207696_1000460 | 3300025711 | Bacteria | 35536 |
| 182 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 183 | Ga0207655_1000074 | 3300025728 | Bacteria | 232056 |
| 184 | Ga0207655_1000098 | 3300025728 | Bacteria | 190699 |
| 185 | Ga0207655_1000114 | 3300025728 | Bacteria | 164098 |
| 186 | Ga0207655_1000410 | 3300025728 | Bacteria | 59117 |
| 187 | Ga0207655_1002318 | 3300025728 | Bacteria | 15638 |
| 188 | Ga0207655_1003616 | 3300025728 | Bacteria | 11425 |
| 189 | Ga0207655_1004568 | 3300025728 | Bacteria | 9753 |
| 190 | Ga0207655_1006831 | 3300025728 | Bacteria | 7497 |
| 191 | Ga0207655_1008809 | 3300025728 | Bacteria | 6349 |
| 192 | Ga0207655_1009171 | 3300025728 | Bacteria | 6180 |
| 193 | Ga0207655_1015886 | 3300025728 | Bacteria | 4152 |
| 194 | Ga0207655_1034974 | 3300025728 | Bacteria | 2251 |
| 195 | Ga0207713_1000061 | 3300025735 | Bacteria | 209289 |
| 196 | Ga0207713_1000097 | 3300025735 | Bacteria | 144844 |
| 197 | Ga0207713_1000284 | 3300025735 | Bacteria | 58743 |
| 198 | Ga0207713_1006155 | 3300025735 | Bacteria | 7368 |
| 199 | Ga0207713_1008243 | 3300025735 | Bacteria | 6027 |
| 200 | Ga0207713_1011419 | 3300025735 | Bacteria | 4831 |
| 201 | Ga0207713_1041350 | 3300025735 | Bacteria | 1924 |
| 202 | Ga0207671_10000474 | 3300025914 | Bacteria | 54456 |
| 203 | Ga0207671_10000561 | 3300025914 | Bacteria | 49927 |
| 204 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 205 | Ga0207649_10000032 | 3300025920 | Bacteria | 143552 |
| 206 | Ga0207681_10000299 | 3300025923 | Bacteria | 36494 |
| 207 | Ga0207681_10003542 | 3300025923 | Bacteria | 9722 |
| 208 | Ga0207650_10000068 | 3300025925 | Bacteria | 139947 |
| 209 | Ga0207650_10000259 | 3300025925 | Bacteria | 56695 |
| 210 | Ga0207650_10000690 | 3300025925 | Bacteria | 26485 |
| 211 | Ga0207650_10023505 | 3300025925 | Bacteria | 4372 |
| 212 | Ga0207706_10002181 | 3300025933 | Bacteria | 19100 |
| 213 | Ga0207706_10004102 | 3300025933 | Bacteria | 13761 |
| 214 | Ga0207686_10002348 | 3300025934 | Bacteria | 10344 |
| 215 | Ga0207686_10008489 | 3300025934 | Bacteria | 5549 |
| 216 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 217 | Ga0207709_10001932 | 3300025935 | Bacteria | 13617 |
| 218 | Ga0207679_10000022 | 3300025945 | Bacteria | 219036 |
| 219 | Ga0207679_10000059 | 3300025945 | Bacteria | 101268 |
| 220 | Ga0207639_10052864 | 3300026041 | Bacteria | 3097 |
| 221 | Ga0209281_1000063 | 3300027111 | Bacteria | 288465 |
| 222 | Ga0207428_10032595 | 3300027907 | Bacteria | 4284 |
| 223 | Ga0207428_10127558 | 3300027907 | Bacteria | 1948 |
| 224 | Ga0307511_10053051 | 3300030521 | Bacteria | 3220 |
| 225 | Ga0307405_10000118 | 3300031731 | Bacteria | 31782 |
| 226 | Ga0307405_10018233 | 3300031731 | Bacteria | 3869 |
| 227 | Ga0439447_001977 | 3300041407 | Bacteria | 7525 |
| 228 | Ga0439466_0001711 | 3300041411 | Bacteria | 8565 |
| 229 | Ga0439466_0015323 | 3300041411 | Bacteria | 2785 |
| 230 | Ga0439432_000084 | 3300042006 | Bacteria | 29253 |
| 231 | Ga0439432_000085 | 3300042006 | Bacteria | 29181 |
| 232 | Ga0439451_005228 | 3300042009 | Bacteria | 2641 |
| 233 | Ga0495617_000148 | 3300046452 | Bacteria | 44939 |
| 234 | Ga0495617_000512 | 3300046452 | Bacteria | 20293 |
| 235 | Ga0495617_001162 | 3300046452 | Bacteria | 11883 |
| 236 | Ga0495617_001573 | 3300046452 | Bacteria | 9860 |
| 237 | Ga0495617_003501 | 3300046452 | Bacteria | 5885 |
| 238 | Ga0495617_007522 | 3300046452 | Bacteria | 3777 |
| 239 | Ga0495627_000779 | 3300046453 | Bacteria | 23541 |
| 240 | Ga0495603_0020988 | 3300046455 | Bacteria | 3955 |
| 241 | Ga0495603_0051857 | 3300046455 | Bacteria | 2436 |
| 242 | Ga0495590_0000177 | 3300046457 | Bacteria | 37380 |
| 243 | Ga0495590_0000641 | 3300046457 | Bacteria | 16211 |
| 244 | Ga0495590_0001583 | 3300046457 | Bacteria | 9745 |
| 245 | Ga0495590_0003703 | 3300046457 | Bacteria | 6219 |
| 246 | Ga0495590_0014179 | 3300046457 | Bacteria | 2914 |
| 247 | Ga0495591_000786 | 3300046458 | Bacteria | 22539 |
| 248 | Ga0495591_001537 | 3300046458 | Bacteria | 14147 |
| 249 | Ga0495591_002201 | 3300046458 | Bacteria | 11134 |
| 250 | Ga0495591_009526 | 3300046458 | Bacteria | 3847 |
| 251 | Ga0495638_0001323 | 3300046460 | Bacteria | 22805 |
| 252 | Ga0495638_0002354 | 3300046460 | Bacteria | 15497 |
| 253 | Ga0495638_0011453 | 3300046460 | Bacteria | 6110 |
| 254 | Ga0495638_0021055 | 3300046460 | Bacteria | 4301 |
| 255 | Ga0495653_0004505 | 3300046463 | Bacteria | 11249 |
| 256 | Ga0495653_0019284 | 3300046463 | Bacteria | 5531 |
| 257 | Ga0495650_0001775 | 3300046471 | Bacteria | 19590 |
| 258 | Ga0495650_0002651 | 3300046471 | Bacteria | 13971 |
| 259 | Ga0495650_0002735 | 3300046471 | Bacteria | 13643 |
| 260 | Ga0495650_0015582 | 3300046471 | Bacteria | 3892 |
| 261 | Ga0495582_0002904 | 3300046473 | Bacteria | 9580 |
| 262 | Ga0495582_0003371 | 3300046473 | Bacteria | 8988 |
| 263 | Ga0495605_0000054 | 3300046474 | Bacteria | 157560 |
| 264 | Ga0495605_0000778 | 3300046474 | Bacteria | 22880 |
| 265 | Ga0495605_0000840 | 3300046474 | Bacteria | 21512 |
| 266 | Ga0495605_0002335 | 3300046474 | Bacteria | 11819 |
| 267 | Ga0495605_0009888 | 3300046474 | Bacteria | 5348 |
| 268 | Ga0495605_0010382 | 3300046474 | Bacteria | 5213 |
| 269 | Ga0495605_0025277 | 3300046474 | Bacteria | 3096 |
| 270 | Ga0495639_0000053 | 3300046475 | Bacteria | 50537 |
| 271 | Ga0495639_0032617 | 3300046475 | Bacteria | 2323 |
| 272 | Ga0495639_0038065 | 3300046475 | Bacteria | 2158 |
| 273 | Ga0495584_0000120 | 3300046491 | Bacteria | 54113 |
| 274 | Ga0495584_0002083 | 3300046491 | Bacteria | 11466 |
| 275 | Ga0495584_0002413 | 3300046491 | Bacteria | 10621 |
| 276 | Ga0495584_0006307 | 3300046491 | Bacteria | 6217 |
| 277 | Ga0495584_0008390 | 3300046491 | Bacteria | 5351 |
| 278 | Ga0495584_0029166 | 3300046491 | Bacteria | 2796 |
| 279 | Ga0495585_0002861 | 3300046492 | Bacteria | 12003 |
| 280 | Ga0495585_0010533 | 3300046492 | Bacteria | 5500 |
| 281 | Ga0495585_0010605 | 3300046492 | Bacteria | 5477 |
| 282 | Ga0495585_0042153 | 3300046492 | Bacteria | 2558 |
| 283 | Ga0495594_0001277 | 3300046499 | Bacteria | 13159 |
| 284 | Ga0495594_0020571 | 3300046499 | Bacteria | 3515 |
| 285 | Ga0495594_0020880 | 3300046499 | Bacteria | 3492 |
| 286 | Ga0495594_0021067 | 3300046499 | Bacteria | 3478 |
| 287 | Ga0495607_0000036 | 3300046501 | Bacteria | 140259 |
| 288 | Ga0495607_0000041 | 3300046501 | Bacteria | 132443 |
| 289 | Ga0495607_0003777 | 3300046501 | Bacteria | 11448 |
| 290 | Ga0495607_0003897 | 3300046501 | Bacteria | 11242 |
| 291 | Ga0495607_0006048 | 3300046501 | Bacteria | 8568 |
| 292 | Ga0495607_0007191 | 3300046501 | Bacteria | 7732 |
| 293 | Ga0495607_0015516 | 3300046501 | Bacteria | 4935 |
| 294 | Ga0495607_0019764 | 3300046501 | Bacteria | 4272 |
| 295 | Ga0495607_0039221 | 3300046501 | Bacteria | 2830 |
| 296 | Ga0495607_0045522 | 3300046501 | Bacteria | 2580 |
| 297 | Ga0495583_0000387 | 3300046506 | Bacteria | 67820 |
| 298 | Ga0495583_0001245 | 3300046506 | Bacteria | 26997 |
| 299 | Ga0495583_0005112 | 3300046506 | Bacteria | 9038 |
| 300 | Ga0495583_0009646 | 3300046506 | Bacteria | 5740 |
| 301 | Ga0495583_0016921 | 3300046506 | Bacteria | 3894 |
| 302 | Ga0495583_0017034 | 3300046506 | Bacteria | 3873 |
| 303 | Ga0495606_0000079 | 3300046507 | Bacteria | 164788 |
| 304 | Ga0495606_0000191 | 3300046507 | Bacteria | 107427 |
| 305 | Ga0495606_0001484 | 3300046507 | Bacteria | 31212 |
| 306 | Ga0495606_0002351 | 3300046507 | Bacteria | 22217 |
| 307 | Ga0495606_0002606 | 3300046507 | Bacteria | 20632 |
| 308 | Ga0495606_0016943 | 3300046507 | Bacteria | 5530 |
| 309 | Ga0495606_0025524 | 3300046507 | Bacteria | 4229 |
| 310 | Ga0495610_0000455 | 3300046512 | Bacteria | 42440 |
| 311 | Ga0495610_0000653 | 3300046512 | Bacteria | 33834 |
| 312 | Ga0495610_0023899 | 3300046512 | Bacteria | 3310 |
| 313 | Ga0495610_0032676 | 3300046512 | Bacteria | 2700 |
| 314 | Ga0495616_0000535 | 3300046513 | Bacteria | 28683 |
| 315 | Ga0495616_0000695 | 3300046513 | Bacteria | 24905 |
| 316 | Ga0495616_0006004 | 3300046513 | Bacteria | 7403 |
| 317 | Ga0495620_0000152 | 3300046515 | Bacteria | 56303 |
| 318 | Ga0495620_0001300 | 3300046515 | Bacteria | 15185 |
| 319 | Ga0495620_0001539 | 3300046515 | Bacteria | 13713 |
| 320 | Ga0495620_0011843 | 3300046515 | Bacteria | 4534 |
| 321 | Ga0495620_0017374 | 3300046515 | Bacteria | 3587 |
| 322 | Ga0495630_0004903 | 3300046517 | Bacteria | 9401 |
| 323 | Ga0495630_0009776 | 3300046517 | Bacteria | 6903 |
| 324 | Ga0495630_0011384 | 3300046517 | Bacteria | 6442 |
| 325 | Ga0495630_0016625 | 3300046517 | Bacteria | 5380 |
| 326 | Ga0495631_0000175 | 3300046518 | Bacteria | 43711 |
| 327 | Ga0495631_0009829 | 3300046518 | Bacteria | 4761 |
| 328 | Ga0495631_0015945 | 3300046518 | Bacteria | 3591 |
| 329 | Ga0495632_0001161 | 3300046519 | Bacteria | 22445 |
| 330 | Ga0495632_0001632 | 3300046519 | Bacteria | 18392 |
| 331 | Ga0495632_0003232 | 3300046519 | Bacteria | 11690 |
| 332 | Ga0495632_0008562 | 3300046519 | Bacteria | 6258 |
| 333 | Ga0495637_0000950 | 3300046520 | Bacteria | 18520 |
| 334 | Ga0495637_0001455 | 3300046520 | Bacteria | 13939 |
| 335 | Ga0495637_0002447 | 3300046520 | Bacteria | 10261 |
| 336 | Ga0495637_0011047 | 3300046520 | Bacteria | 4349 |
| 337 | Ga0495643_0035792 | 3300046522 | Bacteria | 2731 |
| 338 | Ga0495648_0000062 | 3300046524 | Bacteria | 150125 |
| 339 | Ga0495648_0002500 | 3300046524 | Bacteria | 16867 |
| 340 | Ga0495648_0004708 | 3300046524 | Bacteria | 11564 |
| 341 | Ga0495648_0021752 | 3300046524 | Bacteria | 4435 |
| 342 | Ga0495648_0022960 | 3300046524 | Bacteria | 4282 |
| 343 | Ga0495648_0023943 | 3300046524 | Bacteria | 4170 |
| 344 | Ga0495648_0024744 | 3300046524 | Bacteria | 4078 |
| 345 | Ga0495648_0024972 | 3300046524 | Bacteria | 4056 |
| 346 | Ga0495648_0026624 | 3300046524 | Bacteria | 3890 |
| 347 | Ga0495648_0032415 | 3300046524 | Bacteria | 3428 |
| 348 | Ga0495666_0000675 | 3300046526 | Bacteria | 15451 |
| 349 | Ga0495666_0000908 | 3300046526 | Bacteria | 13883 |
| 350 | Ga0495666_0001190 | 3300046526 | Bacteria | 12540 |
| 351 | Ga0495666_0001595 | 3300046526 | Bacteria | 11162 |
| 352 | Ga0495666_0004499 | 3300046526 | Bacteria | 7041 |
| 353 | Ga0495666_0016517 | 3300046526 | Bacteria | 3677 |
| 354 | Ga0495642_0000006 | 3300046528 | Bacteria | 172412 |
| 355 | Ga0495642_0000044 | 3300046528 | Bacteria | 74850 |
| 356 | Ga0495642_0000453 | 3300046528 | Bacteria | 21609 |
| 357 | Ga0495642_0001263 | 3300046528 | Bacteria | 11491 |
| 358 | Ga0495654_0000166 | 3300046530 | Bacteria | 64935 |
| 359 | Ga0495654_0000600 | 3300046530 | Bacteria | 28665 |
| 360 | Ga0495654_0001154 | 3300046530 | Bacteria | 18905 |
| 361 | Ga0495654_0004479 | 3300046530 | Bacteria | 8279 |
| 362 | Ga0495654_0006971 | 3300046530 | Bacteria | 6365 |
| 363 | Ga0495654_0013073 | 3300046530 | Bacteria | 4446 |
| 364 | Ga0495654_0016886 | 3300046530 | Bacteria | 3844 |
| 365 | Ga0495654_0017811 | 3300046530 | Bacteria | 3728 |
| 366 | Ga0495654_0018902 | 3300046530 | Bacteria | 3606 |
| 367 | Ga0495654_0024159 | 3300046530 | Bacteria | 3142 |
| 368 | Ga0495654_0027907 | 3300046530 | Bacteria | 2889 |
| 369 | Ga0495587_0001167 | 3300046536 | Bacteria | 17295 |
| 370 | Ga0495587_0001738 | 3300046536 | Bacteria | 14540 |
| 371 | Ga0495587_0003803 | 3300046536 | Bacteria | 10014 |
| 372 | Ga0495609_0001281 | 3300046538 | Bacteria | 17159 |
| 373 | Ga0495609_0001936 | 3300046538 | Bacteria | 13176 |
| 374 | Ga0495609_0005054 | 3300046538 | Bacteria | 7044 |
| 375 | Ga0495609_0038226 | 3300046538 | Bacteria | 2164 |
| 376 | Ga0495597_0004988 | 3300046542 | Bacteria | 7125 |
| 377 | Ga0495645_0116822 | 3300046543 | Bacteria | 1882 |
| 378 | Ga0495622_0000182 | 3300046557 | Bacteria | 50915 |
| 379 | Ga0495622_0000249 | 3300046557 | Bacteria | 41910 |
| 380 | Ga0495622_0002204 | 3300046557 | Bacteria | 9500 |
| 381 | Ga0495622_0006591 | 3300046557 | Bacteria | 5384 |
| 382 | Ga0495622_0011716 | 3300046557 | Bacteria | 4054 |
| 383 | Ga0495622_0012172 | 3300046557 | Bacteria | 3979 |
| 384 | Ga0495622_0017579 | 3300046557 | Bacteria | 3330 |
| 385 | Ga0495622_0019411 | 3300046557 | Bacteria | 3165 |
| 386 | Ga0495633_0002268 | 3300046558 | Bacteria | 13755 |
| 387 | Ga0495633_0012603 | 3300046558 | Bacteria | 4487 |
| 388 | Ga0495633_0015354 | 3300046558 | Bacteria | 3974 |
| 389 | Ga0495633_0019111 | 3300046558 | Bacteria | 3468 |
| 390 | Ga0495633_0022226 | 3300046558 | Bacteria | 3161 |
| 391 | Ga0495656_0000803 | 3300046615 | Bacteria | 10182 |
| 392 | Ga0495668_0007019 | 3300046616 | Bacteria | 7270 |
| 393 | Ga0495634_0000815 | 3300046642 | Bacteria | 30341 |
| 394 | Ga0495611_0001469 | 3300046648 | Bacteria | 11722 |
| 395 | Ga0495625_0015061 | 3300046660 | Bacteria | 6141 |
| 396 | Ga0495625_0019113 | 3300046660 | Bacteria | 5329 |
| 397 | Ga0495625_0029114 | 3300046660 | Bacteria | 4134 |
| 398 | Ga0495635_0000522 | 3300046663 | Bacteria | 24345 |
| 399 | Ga0495635_0003105 | 3300046663 | Bacteria | 11425 |
| 400 | Ga0495635_0005853 | 3300046663 | Bacteria | 8567 |
| 401 | Ga0495659_0000119 | 3300046664 | Bacteria | 34751 |
| 402 | Ga0495661_0000051 | 3300046665 | Bacteria | 140353 |
| 403 | Ga0495661_0000269 | 3300046665 | Bacteria | 59794 |
| 404 | Ga0495661_0000692 | 3300046665 | Bacteria | 33517 |
| 405 | Ga0495661_0000896 | 3300046665 | Bacteria | 27460 |
| 406 | Ga0495661_0005186 | 3300046665 | Bacteria | 9285 |
| 407 | Ga0495661_0006152 | 3300046665 | Bacteria | 8446 |
| 408 | Ga0495661_0025282 | 3300046665 | Bacteria | 3836 |
| 409 | Ga0495588_0003667 | 3300046674 | Bacteria | 6720 |
| 410 | Ga0495588_0061956 | 3300046674 | Bacteria | 1938 |
| 411 | Ga0495623_0002086 | 3300046679 | Bacteria | 13368 |
| 412 | Ga0495623_0009066 | 3300046679 | Bacteria | 6453 |
| 413 | Ga0495623_0016801 | 3300046679 | Bacteria | 4728 |
| 414 | Ga0495646_0003353 | 3300046680 | Bacteria | 9960 |
| 415 | Ga0495646_0003495 | 3300046680 | Bacteria | 9782 |
| 416 | Ga0495646_0008611 | 3300046680 | Bacteria | 6481 |
| 417 | Ga0495669_0001087 | 3300046684 | Bacteria | 11253 |
| 418 | Ga0495613_0020085 | 3300046689 | Bacteria | 4977 |
| 419 | Ga0495670_0000666 | 3300046691 | Bacteria | 16343 |
| 420 | Ga0495670_0007044 | 3300046691 | Bacteria | 5535 |
| 421 | Ga0495670_0012161 | 3300046691 | Bacteria | 4233 |
| 422 | Ga0495671_0000210 | 3300046692 | Bacteria | 51181 |
| 423 | Ga0495671_0001187 | 3300046692 | Bacteria | 17825 |
| 424 | Ga0495671_0001243 | 3300046692 | Bacteria | 17423 |
| 425 | Ga0495671_0004999 | 3300046692 | Bacteria | 7814 |
| 426 | Ga0495671_0006777 | 3300046692 | Bacteria | 6586 |
| 427 | Ga0495671_0007263 | 3300046692 | Bacteria | 6329 |
| 428 | Ga0495671_0013549 | 3300046692 | Bacteria | 4408 |
| 429 | Ga0495671_0017328 | 3300046692 | Bacteria | 3835 |
| 430 | Ga0495671_0060924 | 3300046692 | Bacteria | 1862 |
| 431 | Ga0495649_0000027 | 3300046694 | Bacteria | 164157 |
| 432 | Ga0495649_0000661 | 3300046694 | Bacteria | 28167 |
| 433 | Ga0495649_0000748 | 3300046694 | Bacteria | 26199 |
| 434 | Ga0495649_0002235 | 3300046694 | Bacteria | 13781 |
| 435 | Ga0495649_0002964 | 3300046694 | Bacteria | 11692 |
| 436 | Ga0495649_0005325 | 3300046694 | Bacteria | 8208 |
| 437 | Ga0495649_0007535 | 3300046694 | Bacteria | 6624 |
| 438 | Ga0495649_0009159 | 3300046694 | Bacteria | 5903 |
| 439 | Ga0495649_0012051 | 3300046694 | Bacteria | 5046 |
| 440 | Ga0495649_0040307 | 3300046694 | Bacteria | 2558 |
| 441 | Ga0495589_0000326 | 3300046794 | Bacteria | 37321 |
| 442 | Ga0495589_0000352 | 3300046794 | Bacteria | 35927 |
| 443 | Ga0495589_0001445 | 3300046794 | Bacteria | 13698 |
| 444 | Ga0495589_0012195 | 3300046794 | Bacteria | 4457 |
| 445 | Ga0495589_0014155 | 3300046794 | Bacteria | 4111 |
| 446 | Ga0495589_0017546 | 3300046794 | Bacteria | 3672 |
| 447 | Ga0495589_0019080 | 3300046794 | Bacteria | 3518 |
| 448 | Ga0495600_0005060 | 3300046809 | Bacteria | 7919 |
| 449 | Ga0495600_0006261 | 3300046809 | Bacteria | 7227 |
| 450 | Ga0495600_0027497 | 3300046809 | Bacteria | 3675 |
| 451 | Ga0495600_0030109 | 3300046809 | Bacteria | 3515 |
| 452 | Ga0495660_0001157 | 3300046810 | Bacteria | 18740 |
| 453 | Ga0495660_0003033 | 3300046810 | Bacteria | 10475 |
| 454 | Ga0495660_0005612 | 3300046810 | Bacteria | 7502 |
| 455 | Ga0495660_0017436 | 3300046810 | Bacteria | 4134 |
| 456 | Ga0495660_0039345 | 3300046810 | Bacteria | 2626 |
| 457 | Ga0495660_0049689 | 3300046810 | Bacteria | 2288 |
| 458 | Ga0495581_0000629 | 3300047315 | Bacteria | 18436 |
| 459 | Ga0495581_0025132 | 3300047315 | Bacteria | 3453 |
| 460 | Ga0495581_0035195 | 3300047315 | Bacteria | 2897 |
| 461 | Ga0495604_0000719 | 3300047317 | Bacteria | 28046 |
| 462 | Ga0495604_0003585 | 3300047317 | Bacteria | 12371 |
| 463 | Ga0495604_0023955 | 3300047317 | Bacteria | 4872 |
| 464 | Ga0495604_0045394 | 3300047317 | Bacteria | 3429 |
| 465 | Ga0495636_0005847 | 3300047318 | Bacteria | 4824 |
| 466 | Ga0495674_0009374 | 3300047319 | Bacteria | 9306 |
| 467 | Ga0495674_0022058 | 3300047319 | Bacteria | 5876 |
| 468 | Ga0495672_0000817 | 3300047320 | Bacteria | 33454 |
| 469 | Ga0495672_0001555 | 3300047320 | Bacteria | 22465 |
| 470 | Ga0495672_0001972 | 3300047320 | Bacteria | 19408 |
| 471 | Ga0495672_0002413 | 3300047320 | Bacteria | 17233 |
| 472 | Ga0495672_0003184 | 3300047320 | Bacteria | 14266 |
| 473 | Ga0495672_0003332 | 3300047320 | Bacteria | 13842 |
| 474 | Ga0495672_0025473 | 3300047320 | Bacteria | 3785 |
| 475 | Ga0495676_0091561 | 3300047321 | Bacteria | 2272 |
| 476 | Ga0495680_0002029 | 3300047322 | Bacteria | 21206 |
| 477 | Ga0495680_0008709 | 3300047322 | Bacteria | 9194 |
| 478 | Ga0495680_0027810 | 3300047322 | Bacteria | 4640 |
| 479 | Ga0495680_0034253 | 3300047322 | Bacteria | 4104 |
| 480 | Ga0495680_0077415 | 3300047322 | Bacteria | 2519 |
| 481 | Ga0495680_0163023 | 3300047322 | Bacteria | 1617 |
| 482 | Ga0495683_0000318 | 3300047323 | Bacteria | 40455 |
| 483 | Ga0495683_0000356 | 3300047323 | Bacteria | 37720 |
| 484 | Ga0495683_0000412 | 3300047323 | Bacteria | 34264 |
| 485 | Ga0495683_0013044 | 3300047323 | Bacteria | 4351 |
| 486 | Ga0495683_0020041 | 3300047323 | Bacteria | 3451 |
| 487 | Ga0495687_000977 | 3300047443 | Bacteria | 28996 |
| 488 | Ga0495687_001427 | 3300047443 | Bacteria | 22013 |
| 489 | Ga0495687_002230 | 3300047443 | Bacteria | 15999 |
| 490 | Ga0495687_006152 | 3300047443 | Bacteria | 7435 |
| 491 | Ga0495687_007971 | 3300047443 | Bacteria | 6145 |
| 492 | Ga0495687_014259 | 3300047443 | Bacteria | 4098 |
| 493 | Ga0495675_0005089 | 3300047444 | Bacteria | 8007 |
| 494 | Ga0495675_0006802 | 3300047444 | Bacteria | 7014 |
| 495 | Ga0495675_0009385 | 3300047444 | Bacteria | 6086 |
| 496 | Ga0495675_0023304 | 3300047444 | Bacteria | 3944 |
| 497 | Ga0495677_0000848 | 3300047445 | Bacteria | 12364 |
| 498 | Ga0495679_000571 | 3300047446 | Bacteria | 25561 |
| 499 | Ga0495679_000688 | 3300047446 | Bacteria | 22049 |
| 500 | Ga0495679_001183 | 3300047446 | Bacteria | 15508 |
| 501 | Ga0495679_008771 | 3300047446 | Bacteria | 4088 |
| 502 | Ga0495679_010574 | 3300047446 | Bacteria | 3615 |
| 503 | Ga0495679_010914 | 3300047446 | Bacteria | 3538 |
| 504 | Ga0495679_015261 | 3300047446 | Bacteria | 2815 |
| 505 | Ga0495673_0000118 | 3300047469 | Bacteria | 147670 |
| 506 | Ga0495673_0000465 | 3300047469 | Bacteria | 43951 |
| 507 | Ga0495673_0001380 | 3300047469 | Bacteria | 19572 |
| 508 | Ga0495673_0001451 | 3300047469 | Bacteria | 18852 |
| 509 | Ga0495673_0002619 | 3300047469 | Bacteria | 12469 |
| 510 | Ga0495673_0003971 | 3300047469 | Bacteria | 9458 |
| 511 | Ga0495673_0004085 | 3300047469 | Bacteria | 9270 |
| 512 | Ga0495673_0011327 | 3300047469 | Bacteria | 4804 |
| 513 | Ga0495673_0012355 | 3300047469 | Bacteria | 4537 |
| 514 | Ga0495673_0014936 | 3300047469 | Bacteria | 4021 |
| 515 | Ga0495673_0029955 | 3300047469 | Bacteria | 2563 |
| 516 | Ga0495681_0000353 | 3300047470 | Bacteria | 35846 |
| 517 | Ga0495681_0001105 | 3300047470 | Bacteria | 20484 |
| 518 | Ga0495681_0001797 | 3300047470 | Bacteria | 15790 |
| 519 | Ga0495681_0002137 | 3300047470 | Bacteria | 14330 |
| 520 | Ga0495681_0003644 | 3300047470 | Bacteria | 10695 |
| 521 | Ga0495681_0004853 | 3300047470 | Bacteria | 9094 |
| 522 | Ga0495681_0005548 | 3300047470 | Bacteria | 8428 |
| 523 | Ga0495681_0019515 | 3300047470 | Bacteria | 3699 |
| 524 | Ga0495684_0009792 | 3300047471 | Bacteria | 7396 |
| 525 | Ga0495684_0010777 | 3300047471 | Bacteria | 7065 |
| 526 | Ga0495593_0001031 | 3300047673 | Bacteria | 16359 |
| 527 | Ga0495593_0001066 | 3300047673 | Bacteria | 16000 |
| 528 | Ga0495593_0001207 | 3300047673 | Bacteria | 15111 |
| 529 | Ga0495593_0014141 | 3300047673 | Bacteria | 4540 |
| 530 | Ga0495593_0017983 | 3300047673 | Bacteria | 3976 |
| 531 | Ga0495626_0000064 | 3300048091 | Bacteria | 142060 |
| 532 | Ga0495626_0000616 | 3300048091 | Bacteria | 34739 |
| 533 | Ga0495626_0000958 | 3300048091 | Bacteria | 25047 |
| 534 | Ga0495626_0010980 | 3300048091 | Bacteria | 4806 |
| 535 | Ga0495626_0018101 | 3300048091 | Bacteria | 3545 |
| 536 | Ga0496102_0000774 | 3300048905 | Bacteria | 31153 |
| 537 | Ga0496103_0001166 | 3300048906 | Bacteria | 18072 |
| 538 | Ga0496103_0020077 | 3300048906 | Bacteria | 4012 |
| 539 | Ga0496105_0104696 | 3300048908 | Bacteria | 2336 |
| 540 | Ga0496110_0029657 | 3300048913 | Bacteria | 4711 |
| 541 | Ga0496111_0041086 | 3300048914 | Bacteria | 3318 |
| 542 | Ga0496112_0008665 | 3300048915 | Bacteria | 9119 |
| 543 | Ga0496116_0000825 | 3300048919 | Bacteria | 39115 |
| 544 | Ga0496116_0001933 | 3300048919 | Bacteria | 22333 |
| 545 | Ga0496116_0003233 | 3300048919 | Bacteria | 16227 |
| 546 | Ga0496116_0029546 | 3300048919 | Bacteria | 3950 |
| 547 | Ga0496117_0001387 | 3300048920 | Bacteria | 35141 |
| 548 | Ga0496117_0001466 | 3300048920 | Bacteria | 33965 |
| 549 | Ga0496117_0004097 | 3300048920 | Bacteria | 16333 |
| 550 | Ga0496117_0004579 | 3300048920 | Bacteria | 15125 |
| 551 | Ga0496117_0006305 | 3300048920 | Bacteria | 12067 |
| 552 | Ga0496117_0007085 | 3300048920 | Bacteria | 11081 |
| 553 | Ga0496117_0012383 | 3300048920 | Bacteria | 7526 |
| 554 | Ga0496117_0020112 | 3300048920 | Bacteria | 5455 |
| 555 | Ga0496117_0037708 | 3300048920 | Bacteria | 3596 |
| 556 | Ga0496117_0057678 | 3300048920 | Bacteria | 2695 |
| 557 | Ga0496118_0006407 | 3300048921 | Bacteria | 12951 |
| 558 | Ga0496118_0006676 | 3300048921 | Bacteria | 12585 |
| 559 | Ga0496118_0007833 | 3300048921 | Bacteria | 11201 |
| 560 | Ga0496118_0008698 | 3300048921 | Bacteria | 10434 |
| 561 | Ga0496118_0013212 | 3300048921 | Bacteria | 7829 |
| 562 | Ga0496118_0021455 | 3300048921 | Bacteria | 5682 |
| 563 | Ga0496118_0032834 | 3300048921 | Bacteria | 4267 |
| 564 | Ga0496118_0034082 | 3300048921 | Bacteria | 4163 |
| 565 | Ga0496118_0042318 | 3300048921 | Bacteria | 3595 |
| 566 | Ga0496119_0005391 | 3300048922 | Bacteria | 12283 |
| 567 | Ga0496119_0012038 | 3300048922 | Bacteria | 7073 |
| 568 | Ga0496120_0002592 | 3300048923 | Bacteria | 17976 |
| 569 | Ga0496120_0003163 | 3300048923 | Bacteria | 15352 |
| 570 | Ga0496120_0025586 | 3300048923 | Bacteria | 3661 |
| 571 | Ga0496121_0001708 | 3300048924 | Bacteria | 35986 |
| 572 | Ga0496121_0001836 | 3300048924 | Bacteria | 34258 |
| 573 | Ga0496121_0004020 | 3300048924 | Bacteria | 20222 |
| 574 | Ga0496121_0059820 | 3300048924 | Bacteria | 3139 |
| 575 | Ga0496122_0003219 | 3300048925 | Bacteria | 21715 |
| 576 | Ga0496122_0004867 | 3300048925 | Bacteria | 16328 |
| 577 | Ga0496122_0005852 | 3300048925 | Bacteria | 14422 |
| 578 | Ga0496122_0025179 | 3300048925 | Bacteria | 5178 |
| 579 | Ga0496122_0054287 | 3300048925 | Bacteria | 3011 |
| 580 | Ga0496123_0001969 | 3300048926 | Bacteria | 26631 |
| 581 | Ga0496123_0004383 | 3300048926 | Bacteria | 14891 |
| 582 | Ga0496123_0004572 | 3300048926 | Bacteria | 14424 |
| 583 | Ga0496123_0018021 | 3300048926 | Bacteria | 5649 |
| 584 | Ga0496123_0024051 | 3300048926 | Bacteria | 4643 |
| 585 | Ga0496123_0045752 | 3300048926 | Bacteria | 2977 |
| 586 | Ga0496124_0001124 | 3300048927 | Bacteria | 42065 |
| 587 | Ga0496124_0001537 | 3300048927 | Bacteria | 33519 |
| 588 | Ga0496124_0004348 | 3300048927 | Bacteria | 16595 |
| 589 | Ga0496124_0016348 | 3300048927 | Bacteria | 7059 |
| 590 | Ga0496124_0018426 | 3300048927 | Bacteria | 6538 |
| 591 | Ga0496124_0045697 | 3300048927 | Bacteria | 3753 |
| 592 | Ga0496124_0099058 | 3300048927 | Bacteria | 2364 |
| 593 | Ga0496124_0203069 | 3300048927 | Bacteria | 1505 |
| 594 | Ga0496125_0000842 | 3300048928 | Bacteria | 49253 |
| 595 | Ga0496125_0002577 | 3300048928 | Bacteria | 23320 |
| 596 | Ga0496125_0004187 | 3300048928 | Bacteria | 16817 |
| 597 | Ga0496125_0004204 | 3300048928 | Bacteria | 16778 |
| 598 | Ga0496125_0039387 | 3300048928 | Bacteria | 4071 |
| 599 | Ga0496125_0048564 | 3300048928 | Bacteria | 3537 |
| 600 | Ga0496125_0060557 | 3300048928 | Bacteria | 3041 |
| 601 | Ga0496125_0072714 | 3300048928 | Bacteria | 2677 |
| 602 | Ga0496126_0001228 | 3300048929 | Bacteria | 41648 |
| 603 | Ga0496126_0002401 | 3300048929 | Bacteria | 25433 |
| 604 | Ga0496126_0044914 | 3300048929 | Bacteria | 4065 |
| 605 | Ga0495678_000578 | 3300049459 | Bacteria | 34746 |
| 606 | Ga0495678_000634 | 3300049459 | Bacteria | 32563 |
| 607 | Ga0495678_004245 | 3300049459 | Bacteria | 8392 |
| 608 | Ga0495678_013459 | 3300049459 | Bacteria | 3839 |
| 609 | Ga0495678_017574 | 3300049459 | Bacteria | 3236 |
| 610 | Ga0495678_020293 | 3300049459 | Bacteria | 2946 |
| 611 | Ga0495678_024207 | 3300049459 | Bacteria | 2625 |
| 612 | Ga0495682_0000025 | 3300049460 | Bacteria | 147931 |
| 613 | Ga0495682_0000099 | 3300049460 | Bacteria | 76287 |
| 614 | Ga0495682_0001201 | 3300049460 | Bacteria | 14720 |
| 615 | Ga0495682_0001269 | 3300049460 | Bacteria | 14164 |
| 616 | Ga0495682_0001679 | 3300049460 | Bacteria | 11289 |
| 617 | Ga0495682_0003138 | 3300049460 | Bacteria | 7470 |
| 618 | Ga0495682_0006579 | 3300049460 | Bacteria | 4697 |
| 619 | nmdc:mga03683_12119_c1 | 3300050489 | Bacteria | 3140 |
| 620 | nmdc:mga03683_7051_c1 | 3300050489 | Bacteria | 3498 |
| 621 | nmdc:mga00v17_48890_c1 | 3300050491 | Bacteria | 2564 |
| 622 | Ga0500618_005847 | 3300053125 | Bacteria | 3683 |
| 623 | Ga0500573_0029972 | 3300053140 | Bacteria | 3137 |
| 624 | Ga0500634_0000141 | 3300053161 | Bacteria | 26079 |
| 625 | Ga0500634_0031016 | 3300053161 | Bacteria | 2913 |
| 626 | 2511255183 | 2511231004 | Bacteria | 6669789 |
| 627 | 2511271811 | 2511231007 | Bacteria | 6306603 |
| 628 | 2511271823 | 2511231007 | Bacteria | 6306603 |
| 629 | 2511277938 | 2511231008 | Bacteria | 6624100 |
| 630 | 2511301533 | 2511231012 | Bacteria | 6738011 |
| 631 | 2511301542 | 2511231012 | Bacteria | 6738011 |
| 632 | 2511312487 | 2511231014 | Bacteria | 6462302 |
| 633 | 2511312496 | 2511231014 | Bacteria | 6462302 |
| 634 | 2511318147 | 2511231015 | Bacteria | 6598026 |
| 635 | 2511318249 | 2511231015 | Bacteria | 6598026 |
| 636 | 2511334555 | 2511231017 | Bacteria | 6503007 |
| 637 | 2511334571 | 2511231017 | Bacteria | 6503007 |
| 638 | 2511351798 | 2511231020 | Bacteria | 6115223 |
| 639 | 2511351807 | 2511231020 | Bacteria | 6115223 |
| 640 | 2511363438 | 2511231022 | Bacteria | 6719296 |
| 641 | 2554813761 | 2554235132 | Bacteria | 6772433 |
| 642 | 2555671476 | 2554235341 | Bacteria | 6867980 |
| 643 | 2597863932 | 2597489888 | Bacteria | 6179543 |
| 644 | 2597864743 | 2597489888 | Bacteria | 6179543 |
| 645 | 2597869835 | 2597489889 | Bacteria | 6297495 |
| 646 | 2597870596 | 2597489889 | Bacteria | 6297495 |
| 647 | 2599354365 | 2599185160 | Bacteria | 6844013 |
| 648 | 2599359921 | 2599185161 | Bacteria | 6960462 |
| 649 | 2599366243 | 2599185162 | Bacteria | 6957254 |
| 650 | 2599373033 | 2599185163 | Bacteria | 6995158 |
| 651 | 2599379473 | 2599185164 | Bacteria | 6841688 |
| 652 | 2599385549 | 2599185165 | Bacteria | 6843250 |
| 653 | 2599391892 | 2599185166 | Bacteria | 6959206 |
| 654 | 2599397925 | 2599185167 | Bacteria | 6353609 |
| 655 | 2599398329 | 2599185167 | Bacteria | 6353609 |
| 656 | 2599403658 | 2599185168 | Bacteria | 6997636 |
| 657 | 2599450351 | 2599185179 | Bacteria | 6611171 |
| 658 | 2599452371 | 2599185179 | Bacteria | 6611171 |
| 659 | 2599461199 | 2599185181 | Bacteria | 6844519 |
| 660 | 2599469741 | 2599185182 | Bacteria | 6883168 |
| 661 | 2599490219 | 2599185186 | Bacteria | 6831633 |
| 662 | 2599506935 | 2599185189 | Bacteria | 5862825 |
| 663 | 2599507375 | 2599185189 | Bacteria | 5862825 |
| 664 | 2599512833 | 2599185190 | Bacteria | 6285678 |
| 665 | 2599513250 | 2599185190 | Bacteria | 6285678 |
| 666 | 2599518250 | 2599185191 | Bacteria | 6297582 |
| 667 | 2599522139 | 2599185191 | Bacteria | 6297582 |
| 668 | 2599878044 | 2599185288 | Bacteria | 6666191 |
| 669 | 2599881331 | 2599185288 | Bacteria | 6666191 |
| 670 | 2599891510 | 2599185290 | Bacteria | 6289611 |
| 671 | 2599891926 | 2599185290 | Bacteria | 6289611 |
| 672 | 2599946649 | 2599185303 | Bacteria | 6512725 |
| 673 | 2599947256 | 2599185303 | Bacteria | 6512725 |
| 674 | 2600213814 | 2599185356 | Bacteria | 6843884 |
| 675 | 2601689973 | 2600255296 | Bacteria | 5784754 |
| 676 | 2601691873 | 2600255296 | Bacteria | 5784754 |
| 677 | 2601773982 | 2600255313 | Bacteria | 6842543 |
| 678 | 2608381083 | 2606217733 | Bacteria | 6360972 |
| 679 | 2621298734 | 2619619299 | Bacteria | 6649820 |
| 680 | 2621299892 | 2619619299 | Bacteria | 6649820 |
| 681 | 2624492219 | 2623620446 | Bacteria | 6500345 |
| 682 | 2624492231 | 2623620446 | Bacteria | 6500345 |
| 683 | 2643871441 | 2643221571 | Bacteria | 6228673 |
| 684 | 2643874216 | 2643221571 | Bacteria | 6228673 |
| 685 | 2643956783 | 2643221589 | Bacteria | 6250934 |
| 686 | 2644024706 | 2643221602 | Bacteria | 6249926 |
| 687 | 2644189894 | 2643221633 | Bacteria | 6733554 |
| 688 | 2644189906 | 2643221633 | Bacteria | 6733554 |
| 689 | 2644620202 | 2643221713 | Bacteria | 6554480 |
| 690 | 2644622432 | 2643221713 | Bacteria | 6554480 |
| 691 | 2671096946 | 2667528171 | Bacteria | 6900659 |
| 692 | 2677896551 | 2675903420 | Bacteria | 6247433 |
| 693 | 2677900777 | 2675903420 | Bacteria | 6247433 |
| 694 | 2723248720 | 2721755607 | Bacteria | 5841722 |
| 695 | 2723249518 | 2721755607 | Bacteria | 5841722 |
| 696 | 2738669889 | 2738541265 | Bacteria | 6594665 |
| 697 | 2738671983 | 2738541265 | Bacteria | 6594665 |
| 698 | 2738748282 | 2738541282 | Bacteria | 6593925 |
| 699 | 2738750377 | 2738541282 | Bacteria | 6593925 |
| 700 | 2738806848 | 2738541294 | Bacteria | 6925949 |
| 701 | 2738809973 | 2738541294 | Bacteria | 6925949 |
| 702 | 2738857324 | 2738541303 | Bacteria | 6591772 |
| 703 | 2738859417 | 2738541303 | Bacteria | 6591772 |
| 704 | 2738894208 | 2738541309 | Bacteria | 6926455 |
| 705 | 2738897333 | 2738541309 | Bacteria | 6926455 |
| 706 | 2739197511 | 2738543004 | Bacteria | 6381073 |
| 707 | 2739197520 | 2738543004 | Bacteria | 6381073 |
| 708 | 2739258763 | 2738543015 | Bacteria | 6750701 |
| 709 | 2739258772 | 2738543015 | Bacteria | 6750701 |
| 710 | 2774122517 | 2773857670 | Bacteria | 6407454 |
| 711 | 2784314650 | 2784132072 | Bacteria | 6596533 |
| 712 | 2808929135 | 2808606377 | Bacteria | 6646337 |
| 713 | 2808951256 | 2808606381 | Bacteria | 6646461 |
| 714 | 2808977061 | 2808606385 | Bacteria | 6711065 |
| 715 | 2808979105 | 2808606385 | Bacteria | 6711065 |
| 716 | 2808992216 | 2808606388 | Bacteria | 6706662 |
| 717 | 2808995012 | 2808606388 | Bacteria | 6706662 |
| 718 | 2817491185 | 2816332298 | Bacteria | 6852809 |
| 719 | 2817492109 | 2816332298 | Bacteria | 6852809 |
| 720 | 2819702039 | 2818991464 | Bacteria | 6907494 |
| 721 | 2834032927 | 2834028612 | Bacteria | 6354979 |
| 722 | 2834034024 | 2834028612 | Bacteria | 6354979 |
| 723 | 2842826941 | 2842826826 | Bacteria | 5974129 |
| 724 | 2842828132 | 2842826826 | Bacteria | 5974129 |
| 725 | 2842839288 | 2842837860 | Bacteria | 6066181 |
| 726 | 2842842798 | 2842837860 | Bacteria | 6066181 |
| 727 | 2844672001 | 2844665904 | Bacteria | 6817974 |
| 728 | 2852613605 | 2852612431 | Bacteria | 6885235 |
| 729 | 2852614451 | 2852612431 | Bacteria | 6885235 |
| 730 | 2852667811 | 2852667396 | Bacteria | 6885555 |
| 731 | 2852668659 | 2852667396 | Bacteria | 6885555 |
| 732 | 2860342749 | 2860339153 | Bacteria | 6846989 |
| 733 | 2860342759 | 2860339153 | Bacteria | 6846989 |
| 734 | 2860870616 | 2860867994 | Bacteria | 5645326 |
| 735 | 2860871225 | 2860867994 | Bacteria | 5645326 |
| 736 | 2904552456 | 2904550169 | Bacteria | 6221258 |
| 737 | 2904552465 | 2904550169 | Bacteria | 6221258 |
| 738 | 2908449745 | 2908446538 | Bacteria | 6829095 |
| 739 | 2908450579 | 2908446538 | Bacteria | 6829095 |
| 740 | 2917075346 | 2917070673 | Bacteria | 6868303 |
| 741 | 2919460668 | 2919456309 | Bacteria | 6586567 |
| 742 | 2919460678 | 2919456309 | Bacteria | 6586567 |
| 743 | 2919698405 | 2919697872 | Bacteria | 6553725 |
| 744 | 2919698417 | 2919697872 | Bacteria | 6553725 |
| 745 | 2929192611 | 2929189879 | Bacteria | 5930554 |
| 746 | 2929193285 | 2929189879 | Bacteria | 5930554 |
| 747 | 2931394003 | 2931390751 | Bacteria | 6273349 |
| 748 | 2931394601 | 2931390751 | Bacteria | 6273349 |
| 749 | 2931401702 | 2931396565 | Bacteria | 7251677 |
| 750 | 2931401712 | 2931396565 | Bacteria | 7251677 |
| 751 | 2935356333 | 2935353572 | Unclassified | 6955622 |
| 752 | 2945932721 | 2945928738 | Bacteria | 6053221 |
| 753 | 2945933465 | 2945928738 | Bacteria | 6053221 |
| 754 | 2945962708 | 2945961074 | Bacteria | 7342064 |
| 755 | 2945963427 | 2945961074 | Bacteria | 7342064 |
| 756 | 2946009780 | 2946006987 | Bacteria | 6705746 |
| 757 | 2946030935 | 2946027586 | Bacteria | 6049274 |
| 758 | 2946031581 | 2946027586 | Bacteria | 6049274 |
| 759 | 2947237748 | 2947233263 | Bacteria | 6439278 |
| 760 | 2947238553 | 2947233263 | Bacteria | 6439278 |
| 761 | 2984289450 | 2984286254 | Bacteria | 6702062 |
| 762 | 3007396013 | 3007395558 | Bacteria | 6755444 |
| 763 | 3007422050 | 3007419365 | Bacteria | 7026924 |
| 764 | 3007422904 | 3007419365 | Bacteria | 7026924 |
| 765 | 3007514403 | 3007511990 | Bacteria | 6481491 |
| 766 | 3007620804 | 3007619802 | Bacteria | 6411688 |
| 767 | 637321798 | 637000220 | Bacteria | 7074893 |
| 768 | 8019772944 | 8019769354 | Bacteria | 6924660 |
| 769 | 8019779154 | 8019775933 | Bacteria | 6858656 |
| 770 | 8019779166 | 8019775933 | Bacteria | 6858656 |
| 771 | 8054285360 | 8054285046 | Bacteria | 6919322 |
| 772 | 8054286657 | 8054285046 | Bacteria | 6919322 |
| 773 | 8054348573 | 8054347763 | Bacteria | 5901107 |
| 774 | 8054352278 | 8054347763 | Bacteria | 5901107 |
| 775 | 8054506365 | 8054503363 | Bacteria | 6101651 |
| 776 | 8054507104 | 8054503363 | Bacteria | 6101651 |
| 777 | 8055821114 | 8055817908 | Bacteria | 6609162 |
| 778 | 8055822054 | 8055817908 | Bacteria | 6609162 |
| 779 | 8056134797 | 8056131705 | Bacteria | 6107031 |
| 780 | 8056135546 | 8056131705 | Bacteria | 6107031 |
| 781 | 8056151991 | 8056148874 | Bacteria | 6479865 |
| 782 | 8056154770 | 8056148874 | Bacteria | 6479865 |
| 783 | 8056161710 | 8056161164 | Bacteria | 6106669 |
| 784 | 8056166069 | 8056161164 | Bacteria | 6106669 |
| 785 | 8057804296 | 8057798959 | Bacteria | 6713499 |
| 786 | Ga0495687_003273 | |||
| 787 | MRS2a_Contig_19 | |||
| 788 | MRS2a_Contig_7067 | |||
| 789 | SwRhRL2b_contig_219132 | |||
| 790 | JGI25162J39368_1000065 | |||
| 791 | JGI25162J39368_1000190 | |||
| 792 | JGI25163J39215_1000128 | |||
| 793 | JGI25163J39215_1000338 | |||
| 794 | JGI25164J39214_1000038 | |||
| 795 | JGI25164J39214_1000157 | |||
| 796 | JGI25165J46597_1000126 | |||
| 797 | JGI25165J46597_1000284 | |||
| 798 | Ga0055538_1000007 | |||
| 799 | Ga0055539_1000011 | |||
| 800 | Ga0055533_1000014 | |||
| 801 | Ga0055532_1000009 | |||
| 802 | Ga0055525_1000016 | |||
| 803 | Ga0055536_1000025 | |||
| 804 | Ga0055536_1000053 | |||
| 805 | Ga0055530_10000007 | |||
| 806 | Ga0055530_10000219 | |||
| 807 | Ga0055530_10007271 | |||
| 808 | Ga0055530_10008051 | |||
| 809 | Ga0055540_1000006 | |||
| 810 | Ga0055540_1000125 | |||
| 811 | Ga0055531_10001653 | |||
| 812 | Ga0055541_1000008 | |||
| 813 | Ga0065714_10000048 | |||
| 814 | Ga0065714_10002770 | |||
| 815 | Ga0065714_10003988 | |||
| 816 | Ga0065714_10007581 | |||
| 817 | Ga0065714_10065674 | |||
| 818 | Ga0065714_10066434 | |||
| 819 | Ga0065714_10069400 | |||
| 820 | Ga0065714_10069849 | |||
| 821 | Ga0065704_10083380 | |||
| 822 | Ga0065712_10071467 | |||
| 823 | Ga0070670_100000079 | |||
| 824 | Ga0070670_100000242 | |||
| 825 | Ga0070670_100001182 | |||
| 826 | Ga0070670_100034655 | |||
| 827 | Ga0070661_100000024 | |||
| 828 | Ga0070661_100000151 | |||
| 829 | Ga0070669_100000630 | |||
| 830 | Ga0070669_100001022 | |||
| 831 | Ga0068853_100013996 | |||
| 832 | Ga0068853_100039228 | |||
| 833 | Ga0070664_100000024 | |||
| 834 | Ga0070664_100000095 | |||
| 835 | Ga0068851_10000119 | |||
| 836 | Ga0068851_10000552 | |||
| 837 | Ga0075364_10009199 | |||
| 838 | Ga0075364_10052995 | |||
| 839 | Ga0075432_10000898 | |||
| 840 | Ga0075432_10002446 | |||
| 841 | Ga0075432_10005364 | |||
| 842 | Ga0075432_10013825 | |||
| 843 | Ga0075362_10005910 | |||
| 844 | Ga0079104_1000143 | |||
| 845 | Ga0105251_10000056 | |||
| 846 | Ga0105251_10000088 | |||
| 847 | Ga0105251_10000571 | |||
| 848 | Ga0105251_10002980 | |||
| 849 | Ga0105251_10008065 | |||
| 850 | Ga0105251_10008927 | |||
| 851 | Ga0105251_10016806 | |||
| 852 | Ga0105251_10036872 | |||
| 853 | Ga0105244_10000277 | |||
| 854 | Ga0105244_10000325 | |||
| 855 | Ga0105244_10000907 | |||
| 856 | Ga0105244_10001433 | |||
| 857 | Ga0105244_10001472 | |||
| 858 | Ga0105244_10002913 | |||
| 859 | Ga0105244_10004021 | |||
| 860 | Ga0105244_10005595 | |||
| 861 | Ga0105244_10006752 | |||
| 862 | Ga0105244_10014311 | |||
| 863 | Ga0105244_10026854 | |||
| 864 | Ga0105250_10000015 | |||
| 865 | Ga0105250_10000038 | |||
| 866 | Ga0105250_10000304 | |||
| 867 | Ga0105250_10001563 | |||
| 868 | Ga0105250_10005002 | |||
| 869 | Ga0105250_10030287 | |||
| 870 | Ga0105243_10000020 | |||
| 871 | Ga0105243_10000321 | |||
| 872 | Ga0105243_10123106 | |||
| 873 | Ga0105242_10002506 | |||
| 874 | Ga0105242_10005013 | |||
| 875 | Ga0105237_10000009 | |||
| 876 | Ga0105237_10000042 | |||
| 877 | Ga0105237_10094990 | |||
| 878 | Ga0105249_10019228 | |||
| 879 | Ga0105246_10000010 | |||
| 880 | Ga0105246_10002448 | |||
| 881 | Ga0157373_10000084 | |||
| 882 | Ga0157373_10000144 | |||
| 883 | Ga0157373_10003092 | |||
| 884 | Ga0157373_10003868 | |||
| 885 | Ga0157373_10005100 | |||
| 886 | Ga0157373_10015658 | |||
| 887 | Ga0157373_10027029 | |||
| 888 | Ga0157373_10029199 | |||
| 889 | Ga0157373_10030727 | |||
| 890 | Ga0157373_10066447 | |||
| 891 | Ga0157371_10000635 | |||
| 892 | Ga0157371_10001258 | |||
| 893 | Ga0157370_10002554 | |||
| 894 | Ga0157370_10016221 | |||
| 895 | Ga0157370_10035914 | |||
| 896 | Ga0157370_10041014 | |||
| 897 | Ga0157370_10121599 | |||
| 898 | Ga0157369_10001116 | |||
| 899 | Ga0157369_10004854 | |||
| 900 | Ga0157369_10019056 | |||
| 901 | Ga0157369_10094355 | |||
| 902 | Ga0157375_10000930 | |||
| 903 | Ga0157375_10001060 | |||
| 904 | Ga0157375_10001137 | |||
| 905 | Ga0157375_10037492 | |||
| 906 | Ga0157375_10092698 | |||
| 907 | Ga0182008_10000153 | |||
| 908 | Ga0182008_10000483 | |||
| 909 | Ga0182008_10000907 | |||
| 910 | Ga0182008_10001506 | |||
| 911 | Ga0182008_10002733 | |||
| 912 | Ga0182008_10016275 | |||
| 913 | Ga0182008_10021821 | |||
| 914 | Ga0182006_1000165 | |||
| 915 | Ga0182006_1000196 | |||
| 916 | Ga0182006_1000387 | |||
| 917 | Ga0182006_1007913 | |||
| 918 | Ga0182007_10000089 | |||
| 919 | Ga0182007_10000108 | |||
| 920 | Ga0182007_10009387 | |||
| 921 | Ga0182005_1000470 | |||
| 922 | Ga0182005_1000917 | |||
| 923 | Ga0182005_1000969 | |||
| 924 | Ga0163161_10001603 | |||
| 925 | Ga0163161_10003345 | |||
| 926 | Ga0163161_10004392 | |||
| 927 | Ga0163161_10006781 | |||
| 928 | Ga0163161_10009162 | |||
| 929 | Ga0163161_10010601 | |||
| 930 | Ga0163161_10023843 | |||
| 931 | Ga0163161_10029906 | |||
| 932 | Ga0163161_10053825 | |||
| 933 | Ga0163161_10071678 | |||
| 934 | Ga0163161_10103718 | |||
| 935 | Ga0209435_100687 | |||
| 936 | Ga0209760_100036 | |||
| 937 | Ga0209760_100095 | |||
| 938 | Ga0209784_100023 | |||
| 939 | Ga0209566_100019 | |||
| 940 | Ga0209674_100034 | |||
| 941 | Ga0209147_100027 | |||
| 942 | Ga0209563_100037 | |||
| 943 | Ga0207427_100004 | |||
| 944 | Ga0207427_100007 | |||
| 945 | Ga0209437_100006 | |||
| 946 | Ga0209437_100025 | |||
| 947 | Ga0209258_100166 | |||
| 948 | Ga0209646_1000318 | |||
| 949 | Ga0209677_100021 | |||
| 950 | Ga0209759_1002349 | |||
| 951 | Ga0209233_1000086 | |||
| 952 | Ga0209233_1000145 | |||
| 953 | Ga0209676_1000002 | |||
| 954 | Ga0209676_1000003 | |||
| 955 | Ga0209676_1003284 | |||
| 956 | Ga0209050_1000004 | |||
| 957 | Ga0209050_1000006 | |||
| 958 | Ga0209050_1000763 | |||
| 959 | Ga0209051_1000001 | |||
| 960 | Ga0209051_1000006 | |||
| 961 | Ga0209051_1004500 | |||
| 962 | Ga0209257_1000029 | |||
| 963 | Ga0207696_1000017 | |||
| 964 | Ga0207696_1000108 | |||
| 965 | Ga0207696_1000123 | |||
| 966 | Ga0207696_1000460 | |||
| 967 | Ga0207655_1000006 | |||
| 968 | Ga0207655_1000074 | |||
| 969 | Ga0207655_1000098 | |||
| 970 | Ga0207655_1000114 | |||
| 971 | Ga0207655_1000410 | |||
| 972 | Ga0207655_1002318 | |||
| 973 | Ga0207655_1003616 | |||
| 974 | Ga0207655_1004568 | |||
| 975 | Ga0207655_1006831 | |||
| 976 | Ga0207655_1008809 | |||
| 977 | Ga0207655_1009171 | |||
| 978 | Ga0207655_1015886 | |||
| 979 | Ga0207655_1034974 | |||
| 980 | Ga0207713_1000061 | |||
| 981 | Ga0207713_1000097 | |||
| 982 | Ga0207713_1000284 | |||
| 983 | Ga0207713_1006155 | |||
| 984 | Ga0207713_1008243 | |||
| 985 | Ga0207713_1011419 | |||
| 986 | Ga0207713_1041350 | |||
| 987 | Ga0207671_10000474 | |||
| 988 | Ga0207671_10000561 | |||
| 989 | Ga0207649_10000010 | |||
| 990 | Ga0207649_10000032 | |||
| 991 | Ga0207681_10000299 | |||
| 992 | Ga0207681_10003542 | |||
| 993 | Ga0207650_10000068 | |||
| 994 | Ga0207650_10000259 | |||
| 995 | Ga0207650_10000690 | |||
| 996 | Ga0207650_10023505 | |||
| 997 | Ga0207706_10002181 | |||
| 998 | Ga0207706_10004102 | |||
| 999 | Ga0207686_10002348 | |||
| 1000 | Ga0207686_10008489 | |||
| 1001 | Ga0207709_10000004 | |||
| 1002 | Ga0207709_10001932 | |||
| 1003 | Ga0207679_10000022 | |||
| 1004 | Ga0207679_10000059 | |||
| 1005 | Ga0207639_10052864 | |||
| 1006 | Ga0209281_1000063 | |||
| 1007 | Ga0207428_10032595 | |||
| 1008 | Ga0207428_10127558 | |||
| 1009 | Ga0307511_10053051 | |||
| 1010 | Ga0307405_10000118 | |||
| 1011 | Ga0307405_10018233 | |||
| 1012 | Ga0439447_001977 | |||
| 1013 | Ga0439466_0001711 | |||
| 1014 | Ga0439466_0015323 | |||
| 1015 | Ga0439432_000084 | |||
| 1016 | Ga0439432_000085 | |||
| 1017 | Ga0439451_005228 | |||
| 1018 | Ga0495617_000148 | |||
| 1019 | Ga0495617_000512 | |||
| 1020 | Ga0495617_001162 | |||
| 1021 | Ga0495617_001573 | |||
| 1022 | Ga0495617_003501 | |||
| 1023 | Ga0495617_007522 | |||
| 1024 | Ga0495627_000779 | |||
| 1025 | Ga0495603_0020988 | |||
| 1026 | Ga0495603_0051857 | |||
| 1027 | Ga0495590_0000177 | |||
| 1028 | Ga0495590_0000641 | |||
| 1029 | Ga0495590_0001583 | |||
| 1030 | Ga0495590_0003703 | |||
| 1031 | Ga0495590_0014179 | |||
| 1032 | Ga0495591_000786 | |||
| 1033 | Ga0495591_001537 | |||
| 1034 | Ga0495591_002201 | |||
| 1035 | Ga0495591_009526 | |||
| 1036 | Ga0495638_0001323 | |||
| 1037 | Ga0495638_0002354 | |||
| 1038 | Ga0495638_0011453 | |||
| 1039 | Ga0495638_0021055 | |||
| 1040 | Ga0495653_0004505 | |||
| 1041 | Ga0495653_0019284 | |||
| 1042 | Ga0495650_0001775 | |||
| 1043 | Ga0495650_0002651 | |||
| 1044 | Ga0495650_0002735 | |||
| 1045 | Ga0495650_0015582 | |||
| 1046 | Ga0495582_0002904 | |||
| 1047 | Ga0495582_0003371 | |||
| 1048 | Ga0495605_0000054 | |||
| 1049 | Ga0495605_0000778 | |||
| 1050 | Ga0495605_0000840 | |||
| 1051 | Ga0495605_0002335 | |||
| 1052 | Ga0495605_0009888 | |||
| 1053 | Ga0495605_0010382 | |||
| 1054 | Ga0495605_0025277 | |||
| 1055 | Ga0495639_0000053 | |||
| 1056 | Ga0495639_0032617 | |||
| 1057 | Ga0495639_0038065 | |||
| 1058 | Ga0495584_0000120 | |||
| 1059 | Ga0495584_0002083 | |||
| 1060 | Ga0495584_0002413 | |||
| 1061 | Ga0495584_0006307 | |||
| 1062 | Ga0495584_0008390 | |||
| 1063 | Ga0495584_0029166 | |||
| 1064 | Ga0495585_0002861 | |||
| 1065 | Ga0495585_0010533 | |||
| 1066 | Ga0495585_0010605 | |||
| 1067 | Ga0495585_0042153 | |||
| 1068 | Ga0495594_0001277 | |||
| 1069 | Ga0495594_0020571 | |||
| 1070 | Ga0495594_0020880 | |||
| 1071 | Ga0495594_0021067 | |||
| 1072 | Ga0495607_0000036 | |||
| 1073 | Ga0495607_0000041 | |||
| 1074 | Ga0495607_0003777 | |||
| 1075 | Ga0495607_0003897 | |||
| 1076 | Ga0495607_0006048 | |||
| 1077 | Ga0495607_0007191 | |||
| 1078 | Ga0495607_0015516 | |||
| 1079 | Ga0495607_0019764 | |||
| 1080 | Ga0495607_0039221 | |||
| 1081 | Ga0495607_0045522 | |||
| 1082 | Ga0495583_0000387 | |||
| 1083 | Ga0495583_0001245 | |||
| 1084 | Ga0495583_0005112 | |||
| 1085 | Ga0495583_0009646 | |||
| 1086 | Ga0495583_0016921 | |||
| 1087 | Ga0495583_0017034 | |||
| 1088 | Ga0495606_0000079 | |||
| 1089 | Ga0495606_0000191 | |||
| 1090 | Ga0495606_0001484 | |||
| 1091 | Ga0495606_0002351 | |||
| 1092 | Ga0495606_0002606 | |||
| 1093 | Ga0495606_0016943 | |||
| 1094 | Ga0495606_0025524 | |||
| 1095 | Ga0495610_0000455 | |||
| 1096 | Ga0495610_0000653 | |||
| 1097 | Ga0495610_0023899 | |||
| 1098 | Ga0495610_0032676 | |||
| 1099 | Ga0495616_0000535 | |||
| 1100 | Ga0495616_0000695 | |||
| 1101 | Ga0495616_0006004 | |||
| 1102 | Ga0495620_0000152 | |||
| 1103 | Ga0495620_0001300 | |||
| 1104 | Ga0495620_0001539 | |||
| 1105 | Ga0495620_0011843 | |||
| 1106 | Ga0495620_0017374 | |||
| 1107 | Ga0495630_0004903 | |||
| 1108 | Ga0495630_0009776 | |||
| 1109 | Ga0495630_0011384 | |||
| 1110 | Ga0495630_0016625 | |||
| 1111 | Ga0495631_0000175 | |||
| 1112 | Ga0495631_0009829 | |||
| 1113 | Ga0495631_0015945 | |||
| 1114 | Ga0495632_0001161 | |||
| 1115 | Ga0495632_0001632 | |||
| 1116 | Ga0495632_0003232 | |||
| 1117 | Ga0495632_0008562 | |||
| 1118 | Ga0495637_0000950 | |||
| 1119 | Ga0495637_0001455 | |||
| 1120 | Ga0495637_0002447 | |||
| 1121 | Ga0495637_0011047 | |||
| 1122 | Ga0495643_0035792 | |||
| 1123 | Ga0495648_0000062 | |||
| 1124 | Ga0495648_0002500 | |||
| 1125 | Ga0495648_0004708 | |||
| 1126 | Ga0495648_0021752 | |||
| 1127 | Ga0495648_0022960 | |||
| 1128 | Ga0495648_0023943 | |||
| 1129 | Ga0495648_0024744 | |||
| 1130 | Ga0495648_0024972 | |||
| 1131 | Ga0495648_0026624 | |||
| 1132 | Ga0495648_0032415 | |||
| 1133 | Ga0495666_0000675 | |||
| 1134 | Ga0495666_0000908 | |||
| 1135 | Ga0495666_0001190 | |||
| 1136 | Ga0495666_0001595 | |||
| 1137 | Ga0495666_0004499 | |||
| 1138 | Ga0495666_0016517 | |||
| 1139 | Ga0495642_0000006 | |||
| 1140 | Ga0495642_0000044 | |||
| 1141 | Ga0495642_0000453 | |||
| 1142 | Ga0495642_0001263 | |||
| 1143 | Ga0495654_0000166 | |||
| 1144 | Ga0495654_0000600 | |||
| 1145 | Ga0495654_0001154 | |||
| 1146 | Ga0495654_0004479 | |||
| 1147 | Ga0495654_0006971 | |||
| 1148 | Ga0495654_0013073 | |||
| 1149 | Ga0495654_0016886 | |||
| 1150 | Ga0495654_0017811 | |||
| 1151 | Ga0495654_0018902 | |||
| 1152 | Ga0495654_0024159 | |||
| 1153 | Ga0495654_0027907 | |||
| 1154 | Ga0495587_0001167 | |||
| 1155 | Ga0495587_0001738 | |||
| 1156 | Ga0495587_0003803 | |||
| 1157 | Ga0495609_0001281 | |||
| 1158 | Ga0495609_0001936 | |||
| 1159 | Ga0495609_0005054 | |||
| 1160 | Ga0495609_0038226 | |||
| 1161 | Ga0495597_0004988 | |||
| 1162 | Ga0495645_0116822 | |||
| 1163 | Ga0495622_0000182 | |||
| 1164 | Ga0495622_0000249 | |||
| 1165 | Ga0495622_0002204 | |||
| 1166 | Ga0495622_0006591 | |||
| 1167 | Ga0495622_0011716 | |||
| 1168 | Ga0495622_0012172 | |||
| 1169 | Ga0495622_0017579 | |||
| 1170 | Ga0495622_0019411 | |||
| 1171 | Ga0495633_0002268 | |||
| 1172 | Ga0495633_0012603 | |||
| 1173 | Ga0495633_0015354 | |||
| 1174 | Ga0495633_0019111 | |||
| 1175 | Ga0495633_0022226 | |||
| 1176 | Ga0495656_0000803 | |||
| 1177 | Ga0495668_0007019 | |||
| 1178 | Ga0495634_0000815 | |||
| 1179 | Ga0495611_0001469 | |||
| 1180 | Ga0495625_0015061 | |||
| 1181 | Ga0495625_0019113 | |||
| 1182 | Ga0495625_0029114 | |||
| 1183 | Ga0495635_0000522 | |||
| 1184 | Ga0495635_0003105 | |||
| 1185 | Ga0495635_0005853 | |||
| 1186 | Ga0495659_0000119 | |||
| 1187 | Ga0495661_0000051 | |||
| 1188 | Ga0495661_0000269 | |||
| 1189 | Ga0495661_0000692 | |||
| 1190 | Ga0495661_0000896 | |||
| 1191 | Ga0495661_0005186 | |||
| 1192 | Ga0495661_0006152 | |||
| 1193 | Ga0495661_0025282 | |||
| 1194 | Ga0495588_0003667 | |||
| 1195 | Ga0495588_0061956 | |||
| 1196 | Ga0495623_0002086 | |||
| 1197 | Ga0495623_0009066 | |||
| 1198 | Ga0495623_0016801 | |||
| 1199 | Ga0495646_0003353 | |||
| 1200 | Ga0495646_0003495 | |||
| 1201 | Ga0495646_0008611 | |||
| 1202 | Ga0495669_0001087 | |||
| 1203 | Ga0495613_0020085 | |||
| 1204 | Ga0495670_0000666 | |||
| 1205 | Ga0495670_0007044 | |||
| 1206 | Ga0495670_0012161 | |||
| 1207 | Ga0495671_0000210 | |||
| 1208 | Ga0495671_0001187 | |||
| 1209 | Ga0495671_0001243 | |||
| 1210 | Ga0495671_0004999 | |||
| 1211 | Ga0495671_0006777 | |||
| 1212 | Ga0495671_0007263 | |||
| 1213 | Ga0495671_0013549 | |||
| 1214 | Ga0495671_0017328 | |||
| 1215 | Ga0495671_0060924 | |||
| 1216 | Ga0495649_0000027 | |||
| 1217 | Ga0495649_0000661 | |||
| 1218 | Ga0495649_0000748 | |||
| 1219 | Ga0495649_0002235 | |||
| 1220 | Ga0495649_0002964 | |||
| 1221 | Ga0495649_0005325 | |||
| 1222 | Ga0495649_0007535 | |||
| 1223 | Ga0495649_0009159 | |||
| 1224 | Ga0495649_0012051 | |||
| 1225 | Ga0495649_0040307 | |||
| 1226 | Ga0495589_0000326 | |||
| 1227 | Ga0495589_0000352 | |||
| 1228 | Ga0495589_0001445 | |||
| 1229 | Ga0495589_0012195 | |||
| 1230 | Ga0495589_0014155 | |||
| 1231 | Ga0495589_0017546 | |||
| 1232 | Ga0495589_0019080 | |||
| 1233 | Ga0495600_0005060 | |||
| 1234 | Ga0495600_0006261 | |||
| 1235 | Ga0495600_0027497 | |||
| 1236 | Ga0495600_0030109 | |||
| 1237 | Ga0495660_0001157 | |||
| 1238 | Ga0495660_0003033 | |||
| 1239 | Ga0495660_0005612 | |||
| 1240 | Ga0495660_0017436 | |||
| 1241 | Ga0495660_0039345 | |||
| 1242 | Ga0495660_0049689 | |||
| 1243 | Ga0495581_0000629 | |||
| 1244 | Ga0495581_0025132 | |||
| 1245 | Ga0495581_0035195 | |||
| 1246 | Ga0495604_0000719 | |||
| 1247 | Ga0495604_0003585 | |||
| 1248 | Ga0495604_0023955 | |||
| 1249 | Ga0495604_0045394 | |||
| 1250 | Ga0495636_0005847 | |||
| 1251 | Ga0495674_0009374 | |||
| 1252 | Ga0495674_0022058 | |||
| 1253 | Ga0495672_0000817 | |||
| 1254 | Ga0495672_0001555 | |||
| 1255 | Ga0495672_0001972 | |||
| 1256 | Ga0495672_0002413 | |||
| 1257 | Ga0495672_0003184 | |||
| 1258 | Ga0495672_0003332 | |||
| 1259 | Ga0495672_0025473 | |||
| 1260 | Ga0495676_0091561 | |||
| 1261 | Ga0495680_0002029 | |||
| 1262 | Ga0495680_0008709 | |||
| 1263 | Ga0495680_0027810 | |||
| 1264 | Ga0495680_0034253 | |||
| 1265 | Ga0495680_0077415 | |||
| 1266 | Ga0495680_0163023 | |||
| 1267 | Ga0495683_0000318 | |||
| 1268 | Ga0495683_0000356 | |||
| 1269 | Ga0495683_0000412 | |||
| 1270 | Ga0495683_0013044 | |||
| 1271 | Ga0495683_0020041 | |||
| 1272 | Ga0495687_000977 | |||
| 1273 | Ga0495687_001427 | |||
| 1274 | Ga0495687_002230 | |||
| 1275 | Ga0495687_006152 | |||
| 1276 | Ga0495687_007971 | |||
| 1277 | Ga0495687_014259 | |||
| 1278 | Ga0495675_0005089 | |||
| 1279 | Ga0495675_0006802 | |||
| 1280 | Ga0495675_0009385 | |||
| 1281 | Ga0495675_0023304 | |||
| 1282 | Ga0495677_0000848 | |||
| 1283 | Ga0495679_000571 | |||
| 1284 | Ga0495679_000688 | |||
| 1285 | Ga0495679_001183 | |||
| 1286 | Ga0495679_008771 | |||
| 1287 | Ga0495679_010574 | |||
| 1288 | Ga0495679_010914 | |||
| 1289 | Ga0495679_015261 | |||
| 1290 | Ga0495673_0000118 | |||
| 1291 | Ga0495673_0000465 | |||
| 1292 | Ga0495673_0001380 | |||
| 1293 | Ga0495673_0001451 | |||
| 1294 | Ga0495673_0002619 | |||
| 1295 | Ga0495673_0003971 | |||
| 1296 | Ga0495673_0004085 | |||
| 1297 | Ga0495673_0011327 | |||
| 1298 | Ga0495673_0012355 | |||
| 1299 | Ga0495673_0014936 | |||
| 1300 | Ga0495673_0029955 | |||
| 1301 | Ga0495681_0000353 | |||
| 1302 | Ga0495681_0001105 | |||
| 1303 | Ga0495681_0001797 | |||
| 1304 | Ga0495681_0002137 | |||
| 1305 | Ga0495681_0003644 | |||
| 1306 | Ga0495681_0004853 | |||
| 1307 | Ga0495681_0005548 | |||
| 1308 | Ga0495681_0019515 | |||
| 1309 | Ga0495684_0009792 | |||
| 1310 | Ga0495684_0010777 | |||
| 1311 | Ga0495593_0001031 | |||
| 1312 | Ga0495593_0001066 | |||
| 1313 | Ga0495593_0001207 | |||
| 1314 | Ga0495593_0014141 | |||
| 1315 | Ga0495593_0017983 | |||
| 1316 | Ga0495626_0000064 | |||
| 1317 | Ga0495626_0000616 | |||
| 1318 | Ga0495626_0000958 | |||
| 1319 | Ga0495626_0010980 | |||
| 1320 | Ga0495626_0018101 | |||
| 1321 | Ga0496102_0000774 | |||
| 1322 | Ga0496103_0001166 | |||
| 1323 | Ga0496103_0020077 | |||
| 1324 | Ga0496105_0104696 | |||
| 1325 | Ga0496110_0029657 | |||
| 1326 | Ga0496111_0041086 | |||
| 1327 | Ga0496112_0008665 | |||
| 1328 | Ga0496116_0000825 | |||
| 1329 | Ga0496116_0001933 | |||
| 1330 | Ga0496116_0003233 | |||
| 1331 | Ga0496116_0029546 | |||
| 1332 | Ga0496117_0001387 | |||
| 1333 | Ga0496117_0001466 | |||
| 1334 | Ga0496117_0004097 | |||
| 1335 | Ga0496117_0004579 | |||
| 1336 | Ga0496117_0006305 | |||
| 1337 | Ga0496117_0007085 | |||
| 1338 | Ga0496117_0012383 | |||
| 1339 | Ga0496117_0020112 | |||
| 1340 | Ga0496117_0037708 | |||
| 1341 | Ga0496117_0057678 | |||
| 1342 | Ga0496118_0006407 | |||
| 1343 | Ga0496118_0006676 | |||
| 1344 | Ga0496118_0007833 | |||
| 1345 | Ga0496118_0008698 | |||
| 1346 | Ga0496118_0013212 | |||
| 1347 | Ga0496118_0021455 | |||
| 1348 | Ga0496118_0032834 | |||
| 1349 | Ga0496118_0034082 | |||
| 1350 | Ga0496118_0042318 | |||
| 1351 | Ga0496119_0005391 | |||
| 1352 | Ga0496119_0012038 | |||
| 1353 | Ga0496120_0002592 | |||
| 1354 | Ga0496120_0003163 | |||
| 1355 | Ga0496120_0025586 | |||
| 1356 | Ga0496121_0001708 | |||
| 1357 | Ga0496121_0001836 | |||
| 1358 | Ga0496121_0004020 | |||
| 1359 | Ga0496121_0059820 | |||
| 1360 | Ga0496122_0003219 | |||
| 1361 | Ga0496122_0004867 | |||
| 1362 | Ga0496122_0005852 | |||
| 1363 | Ga0496122_0025179 | |||
| 1364 | Ga0496122_0054287 | |||
| 1365 | Ga0496123_0001969 | |||
| 1366 | Ga0496123_0004383 | |||
| 1367 | Ga0496123_0004572 | |||
| 1368 | Ga0496123_0018021 | |||
| 1369 | Ga0496123_0024051 | |||
| 1370 | Ga0496123_0045752 | |||
| 1371 | Ga0496124_0001124 | |||
| 1372 | Ga0496124_0001537 | |||
| 1373 | Ga0496124_0004348 | |||
| 1374 | Ga0496124_0016348 | |||
| 1375 | Ga0496124_0018426 | |||
| 1376 | Ga0496124_0045697 | |||
| 1377 | Ga0496124_0099058 | |||
| 1378 | Ga0496124_0203069 | |||
| 1379 | Ga0496125_0000842 | |||
| 1380 | Ga0496125_0002577 | |||
| 1381 | Ga0496125_0004187 | |||
| 1382 | Ga0496125_0004204 | |||
| 1383 | Ga0496125_0039387 | |||
| 1384 | Ga0496125_0048564 | |||
| 1385 | Ga0496125_0060557 | |||
| 1386 | Ga0496125_0072714 | |||
| 1387 | Ga0496126_0001228 | |||
| 1388 | Ga0496126_0002401 | |||
| 1389 | Ga0496126_0044914 | |||
| 1390 | Ga0495678_000578 | |||
| 1391 | Ga0495678_000634 | |||
| 1392 | Ga0495678_004245 | |||
| 1393 | Ga0495678_013459 | |||
| 1394 | Ga0495678_017574 | |||
| 1395 | Ga0495678_020293 | |||
| 1396 | Ga0495678_024207 | |||
| 1397 | Ga0495682_0000025 | |||
| 1398 | Ga0495682_0000099 | |||
| 1399 | Ga0495682_0001201 | |||
| 1400 | Ga0495682_0001269 | |||
| 1401 | Ga0495682_0001679 | |||
| 1402 | Ga0495682_0003138 | |||
| 1403 | Ga0495682_0006579 | |||
| 1404 | nmdc:mga03683_12119_c1 | |||
| 1405 | nmdc:mga03683_7051_c1 | |||
| 1406 | nmdc:mga00v17_48890_c1 | |||
| 1407 | Ga0500618_005847 | |||
| 1408 | Ga0500573_0029972 | |||
| 1409 | Ga0500634_0000141 | |||
| 1410 | Ga0500634_0031016 | |||
| 1411 | 2511255183 | |||
| 1412 | 2511271811 | |||
| 1413 | 2511271823 | |||
| 1414 | 2511277938 | |||
| 1415 | 2511301533 | |||
| 1416 | 2511301542 | |||
| 1417 | 2511312487 | |||
| 1418 | 2511312496 | |||
| 1419 | 2511318147 | |||
| 1420 | 2511318249 | |||
| 1421 | 2511334555 | |||
| 1422 | 2511334571 | |||
| 1423 | 2511351798 | |||
| 1424 | 2511351807 | |||
| 1425 | 2511363438 | |||
| 1426 | 2554813761 | |||
| 1427 | 2555671476 | |||
| 1428 | 2597863932 | |||
| 1429 | 2597864743 | |||
| 1430 | 2597869835 | |||
| 1431 | 2597870596 | |||
| 1432 | 2599354365 | |||
| 1433 | 2599359921 | |||
| 1434 | 2599366243 | |||
| 1435 | 2599373033 | |||
| 1436 | 2599379473 | |||
| 1437 | 2599385549 | |||
| 1438 | 2599391892 | |||
| 1439 | 2599397925 | |||
| 1440 | 2599398329 | |||
| 1441 | 2599403658 | |||
| 1442 | 2599450351 | |||
| 1443 | 2599452371 | |||
| 1444 | 2599461199 | |||
| 1445 | 2599469741 | |||
| 1446 | 2599490219 | |||
| 1447 | 2599506935 | |||
| 1448 | 2599507375 | |||
| 1449 | 2599512833 | |||
| 1450 | 2599513250 | |||
| 1451 | 2599518250 | |||
| 1452 | 2599522139 | |||
| 1453 | 2599878044 | |||
| 1454 | 2599881331 | |||
| 1455 | 2599891510 | |||
| 1456 | 2599891926 | |||
| 1457 | 2599946649 | |||
| 1458 | 2599947256 | |||
| 1459 | 2600213814 | |||
| 1460 | 2601689973 | |||
| 1461 | 2601691873 | |||
| 1462 | 2601773982 | |||
| 1463 | 2608381083 | |||
| 1464 | 2621298734 | |||
| 1465 | 2621299892 | |||
| 1466 | 2624492219 | |||
| 1467 | 2624492231 | |||
| 1468 | 2643871441 | |||
| 1469 | 2643874216 | |||
| 1470 | 2643956783 | |||
| 1471 | 2644024706 | |||
| 1472 | 2644189894 | |||
| 1473 | 2644189906 | |||
| 1474 | 2644620202 | |||
| 1475 | 2644622432 | |||
| 1476 | 2671096946 | |||
| 1477 | 2677896551 | |||
| 1478 | 2677900777 | |||
| 1479 | 2723248720 | |||
| 1480 | 2723249518 | |||
| 1481 | 2738669889 | |||
| 1482 | 2738671983 | |||
| 1483 | 2738748282 | |||
| 1484 | 2738750377 | |||
| 1485 | 2738806848 | |||
| 1486 | 2738809973 | |||
| 1487 | 2738857324 | |||
| 1488 | 2738859417 | |||
| 1489 | 2738894208 | |||
| 1490 | 2738897333 | |||
| 1491 | 2739197511 | |||
| 1492 | 2739197520 | |||
| 1493 | 2739258763 | |||
| 1494 | 2739258772 | |||
| 1495 | 2774122517 | |||
| 1496 | 2784314650 | |||
| 1497 | 2808929135 | |||
| 1498 | 2808951256 | |||
| 1499 | 2808977061 | |||
| 1500 | 2808979105 | |||
| 1501 | 2808992216 | |||
| 1502 | 2808995012 | |||
| 1503 | 2817491185 | |||
| 1504 | 2817492109 | |||
| 1505 | 2819702039 | |||
| 1506 | 2834032927 | |||
| 1507 | 2834034024 | |||
| 1508 | 2842826941 | |||
| 1509 | 2842828132 | |||
| 1510 | 2842839288 | |||
| 1511 | 2842842798 | |||
| 1512 | 2844672001 | |||
| 1513 | 2852613605 | |||
| 1514 | 2852614451 | |||
| 1515 | 2852667811 | |||
| 1516 | 2852668659 | |||
| 1517 | 2860342749 | |||
| 1518 | 2860342759 | |||
| 1519 | 2860870616 | |||
| 1520 | 2860871225 | |||
| 1521 | 2904552456 | |||
| 1522 | 2904552465 | |||
| 1523 | 2908449745 | |||
| 1524 | 2908450579 | |||
| 1525 | 2917075346 | |||
| 1526 | 2919460668 | |||
| 1527 | 2919460678 | |||
| 1528 | 2919698405 | |||
| 1529 | 2919698417 | |||
| 1530 | 2929192611 | |||
| 1531 | 2929193285 | |||
| 1532 | 2931394003 | |||
| 1533 | 2931394601 | |||
| 1534 | 2931401702 | |||
| 1535 | 2931401712 | |||
| 1536 | 2935356333 | |||
| 1537 | 2945932721 | |||
| 1538 | 2945933465 | |||
| 1539 | 2945962708 | |||
| 1540 | 2945963427 | |||
| 1541 | 2946009780 | |||
| 1542 | 2946030935 | |||
| 1543 | 2946031581 | |||
| 1544 | 2947237748 | |||
| 1545 | 2947238553 | |||
| 1546 | 2984289450 | |||
| 1547 | 3007396013 | |||
| 1548 | 3007422050 | |||
| 1549 | 3007422904 | |||
| 1550 | 3007514403 | |||
| 1551 | 3007620804 | |||
| 1552 | 637321798 | |||
| 1553 | 8019772944 | |||
| 1554 | 8019779154 | |||
| 1555 | 8019779166 | |||
| 1556 | 8054285360 | |||
| 1557 | 8054286657 | |||
| 1558 | 8054348573 | |||
| 1559 | 8054352278 | |||
| 1560 | 8054506365 | |||
| 1561 | 8054507104 | |||
| 1562 | 8055821114 | |||
| 1563 | 8055822054 | |||
| 1564 | 8056134797 | |||
| 1565 | 8056135546 | |||
| 1566 | 8056151991 | |||
| 1567 | 8056154770 | |||
| 1568 | 8056161710 | |||
| 1569 | 8056166069 | |||
| 1570 | 8057804296 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5f15-assembly1.cif.gz_A | crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate | 0.8144 | 1 | 523 |
| 5f15-assembly1.cif.gz_A | crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate | 0.8046 | 1 | 523 |
| 5ezm-assembly1.cif.gz_A | crystal structure of arnt from cupriavidus metallidurans in the apo state | 0.7902 | 1 | 523 |
| 5ezm-assembly1.cif.gz_A | crystal structure of arnt from cupriavidus metallidurans in the apo state | 0.7806 | 1 | 523 |
| 6p2r-assembly1.cif.gz_B | structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor | 0.7174 | 9 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06152_111_270_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6698 | 66 | 220 | 1.20.1250.20 |
| af_B0R1B6_262_375_1.25.40.20 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain | 0.6657 | 140 | 179 | 1.25.40.20 |
| af_Q9VEA9_238_314_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.6092 | 108 | 175 | 1.20.58.80 |
| af_O06152_111_270_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6025 | 66 | 220 | 1.20.1250.20 |
| 4a5xB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.5765 | 108 | 175 | 1.20.58.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q4ZSZ0-F1-model_v4 | Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (EC 2.4.2.43) (4-amino-4-deoxy-L-arabinose lipid A transferase) (Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) | 0.9524 | 3 | 529 |
GO:0000030
GO:0005886 GO:0006493 GO:0009103 GO:0009245 GO:0010041 GO:0103015 |
| AF-Q4ZSZ0-F1-model_v4 | Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (EC 2.4.2.43) (4-amino-4-deoxy-L-arabinose lipid A transferase) (Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) | 0.9472 | 3 | 529 |
GO:0000030
GO:0005886 GO:0006493 GO:0009103 GO:0009245 GO:0010041 GO:0103015 |
| AF-A0A656YUT7-F1-model_v4 | deleted | 0.9454 | 126 | 527 |
|
| AF-A0A5M8F875-F1-model_v4 | Phospholipid carrier-dependent glycosyltransferase | 0.9286 | 1 | 302 |
GO:0000030
GO:0005886 GO:0006493 GO:0009103 GO:0010041 GO:0016763 |
| AF-A0A379FIQ2-F1-model_v4 | 4-amino-4-deoxy-L-arabinose transferase (EC 2.4.2.43) | 0.9219 | 42 | 193 |
GO:0000030
GO:0005886 GO:0006493 GO:0009103 GO:0010041 GO:0103015 |