F482271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 390 | 1642 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0072420|Ga0496109_0072420_1915_2988 |
| Length | 347 |
| Sequence | LPVTRLRLLGELHRAELRPSAERDEGGSPAVAVLVITVCMRSYLDFEKPVAEIEAKIEELRALNAGDSGPAIAEEISRLETKAAEELQELYENLDAWQKTQVARHPERPHSLDYVTALITDFVPLAGDRKFGDDDAIVAGFGRFRGESICIIGHEKGSSTEARLKHNFGMARPEGYRKAERMMQLADRFRIPVLSLVDTAGAYPGIGAEERGQAEAIARSTSASLDLGVPNVAVIIGETANRVLMLEHAIYSVISPEGAASILWRDTSKAQDAATNMKITAQDMIRFGVIDRIVPEPAGGAHRDAAAAIAATGEAIAGALGEISALDPETVRKERRDKFLAMGRAFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 197 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 227 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 228 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 353 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 355 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 358 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 359 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 363 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 364 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 370 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 372 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 373 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 375 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 378 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 379 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 380 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 381 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 382 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 383 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 384 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 385 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 386 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 387 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 388 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 389 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 390 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 0 |
| Isolates | 1.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.58 |
| Nodule | 0.24 |
| Rhizoplane | 6.33 |
| Rhizosphere | 82.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0072420 | 3300048912 | Bacteria | 3165 |
| 2 | JGI25406J46586_10013258 | 3300003203 | Bacteria | 3549 |
| 3 | Ga0055530_10005059 | 3300003791 | Bacteria | 6473 |
| 4 | Ga0055531_10004151 | 3300003794 | Bacteria | 8937 |
| 5 | Ga0065165_1002581 | 3300005262 | Bacteria | 14913 |
| 6 | Ga0070658_10013925 | 3300005327 | Bacteria | 6457 |
| 7 | Ga0070658_10028776 | 3300005327 | Bacteria | 4461 |
| 8 | Ga0070676_10030532 | 3300005328 | Bacteria | 3074 |
| 9 | Ga0070676_10105361 | 3300005328 | Bacteria | 1748 |
| 10 | Ga0070690_100003947 | 3300005330 | Bacteria | 8190 |
| 11 | Ga0070670_100000044 | 3300005331 | Bacteria | 140263 |
| 12 | Ga0070670_100095221 | 3300005331 | Bacteria | 2561 |
| 13 | Ga0070670_100325084 | 3300005331 | Bacteria | 1348 |
| 14 | Ga0070677_10022151 | 3300005333 | Bacteria | 2337 |
| 15 | Ga0068869_100007205 | 3300005334 | Bacteria | 7091 |
| 16 | Ga0070666_10034231 | 3300005335 | Bacteria | 3367 |
| 17 | Ga0070666_10090300 | 3300005335 | Bacteria | 2104 |
| 18 | Ga0070666_10230191 | 3300005335 | Bacteria | 1309 |
| 19 | Ga0070680_100006085 | 3300005336 | Bacteria | 9142 |
| 20 | Ga0070680_100161079 | 3300005336 | Bacteria | 1885 |
| 21 | Ga0070682_100031416 | 3300005337 | Bacteria | 3212 |
| 22 | Ga0068868_100089101 | 3300005338 | Bacteria | 2484 |
| 23 | Ga0068868_100132083 | 3300005338 | Bacteria | 2044 |
| 24 | Ga0070660_100035420 | 3300005339 | Bacteria | 3778 |
| 25 | Ga0070660_100113000 | 3300005339 | Bacteria | 2162 |
| 26 | Ga0070660_100217064 | 3300005339 | Bacteria | 1554 |
| 27 | Ga0070689_100006271 | 3300005340 | Bacteria | 8210 |
| 28 | Ga0070691_10010903 | 3300005341 | Bacteria | 4150 |
| 29 | Ga0070661_100001446 | 3300005344 | Bacteria | 16504 |
| 30 | Ga0070668_100000098 | 3300005347 | Bacteria | 53574 |
| 31 | Ga0070668_100002191 | 3300005347 | Bacteria | 14333 |
| 32 | Ga0070668_100015032 | 3300005347 | Bacteria | 5780 |
| 33 | Ga0070669_100004579 | 3300005353 | Bacteria | 9982 |
| 34 | Ga0070669_100155405 | 3300005353 | Bacteria | 1773 |
| 35 | Ga0070675_100257155 | 3300005354 | Bacteria | 1529 |
| 36 | Ga0070671_100000497 | 3300005355 | Bacteria | 27514 |
| 37 | Ga0070671_100012906 | 3300005355 | Bacteria | 6734 |
| 38 | Ga0070671_100017745 | 3300005355 | Bacteria | 5770 |
| 39 | Ga0070671_100036146 | 3300005355 | Bacteria | 4095 |
| 40 | Ga0070671_100054333 | 3300005355 | Bacteria | 3330 |
| 41 | Ga0070674_100002246 | 3300005356 | Bacteria | 10641 |
| 42 | Ga0070674_100110818 | 3300005356 | Bacteria | 2015 |
| 43 | Ga0070673_100001599 | 3300005364 | Bacteria | 13379 |
| 44 | Ga0070673_100026478 | 3300005364 | Bacteria | 4284 |
| 45 | Ga0070673_100089597 | 3300005364 | Bacteria | 2511 |
| 46 | Ga0070688_100007704 | 3300005365 | Bacteria | 5815 |
| 47 | Ga0070659_100002646 | 3300005366 | Bacteria | 12749 |
| 48 | Ga0070659_100010511 | 3300005366 | Bacteria | 6811 |
| 49 | Ga0070659_100019787 | 3300005366 | Bacteria | 5109 |
| 50 | Ga0070659_100055064 | 3300005366 | Bacteria | 3133 |
| 51 | Ga0070667_100003729 | 3300005367 | Bacteria | 12938 |
| 52 | Ga0070667_100004554 | 3300005367 | Bacteria | 11668 |
| 53 | Ga0070667_100008872 | 3300005367 | Bacteria | 8321 |
| 54 | Ga0070667_100016357 | 3300005367 | Bacteria | 6137 |
| 55 | Ga0070667_100034910 | 3300005367 | Bacteria | 4211 |
| 56 | Ga0070667_100036831 | 3300005367 | Bacteria | 4101 |
| 57 | Ga0070709_10003085 | 3300005434 | Bacteria | 8957 |
| 58 | Ga0070709_10138429 | 3300005434 | Bacteria | 1670 |
| 59 | Ga0070714_100059095 | 3300005435 | Bacteria | 3286 |
| 60 | Ga0070714_100252853 | 3300005435 | Bacteria | 1630 |
| 61 | Ga0070713_100034420 | 3300005436 | Bacteria | 4069 |
| 62 | Ga0070710_10004649 | 3300005437 | Bacteria | 6493 |
| 63 | Ga0070710_10054482 | 3300005437 | Bacteria | 2257 |
| 64 | Ga0070710_10106608 | 3300005437 | Bacteria | 1677 |
| 65 | Ga0070711_100132115 | 3300005439 | Bacteria | 1860 |
| 66 | Ga0070711_100141020 | 3300005439 | Bacteria | 1807 |
| 67 | Ga0070705_100064068 | 3300005440 | Bacteria | 2194 |
| 68 | Ga0070694_100168184 | 3300005444 | Bacteria | 1613 |
| 69 | Ga0070663_100019491 | 3300005455 | Bacteria | 4472 |
| 70 | Ga0070662_100081004 | 3300005457 | Bacteria | 2418 |
| 71 | Ga0070662_100145530 | 3300005457 | Bacteria | 1840 |
| 72 | Ga0070681_10012011 | 3300005458 | Bacteria | 8586 |
| 73 | Ga0070681_10017074 | 3300005458 | Bacteria | 7254 |
| 74 | Ga0070681_10104661 | 3300005458 | Bacteria | 2772 |
| 75 | Ga0068867_100008051 | 3300005459 | Bacteria | 7448 |
| 76 | Ga0068867_100023806 | 3300005459 | Bacteria | 4387 |
| 77 | Ga0070685_10057576 | 3300005466 | Bacteria | 2263 |
| 78 | Ga0070698_100073412 | 3300005471 | Bacteria | 3428 |
| 79 | Ga0070679_100006711 | 3300005530 | Bacteria | 10734 |
| 80 | Ga0070679_100016884 | 3300005530 | Bacteria | 7056 |
| 81 | Ga0070679_100032803 | 3300005530 | Bacteria | 5140 |
| 82 | Ga0070679_100073782 | 3300005530 | Bacteria | 3403 |
| 83 | Ga0070697_100017315 | 3300005536 | Bacteria | 5668 |
| 84 | Ga0068853_100004404 | 3300005539 | Bacteria | 10906 |
| 85 | Ga0068853_100061818 | 3300005539 | Bacteria | 3240 |
| 86 | Ga0070686_100070111 | 3300005544 | Bacteria | 2291 |
| 87 | Ga0070686_100107982 | 3300005544 | Bacteria | 1891 |
| 88 | Ga0070696_100004697 | 3300005546 | Bacteria | 9130 |
| 89 | Ga0070665_100000762 | 3300005548 | Bacteria | 42638 |
| 90 | Ga0070665_100000831 | 3300005548 | Bacteria | 40349 |
| 91 | Ga0070665_100002025 | 3300005548 | Bacteria | 22786 |
| 92 | Ga0070665_100256952 | 3300005548 | Bacteria | 1748 |
| 93 | Ga0070665_100482311 | 3300005548 | Bacteria | 1251 |
| 94 | Ga0070704_100227710 | 3300005549 | Bacteria | 1519 |
| 95 | Ga0068855_100040248 | 3300005563 | Bacteria | 5548 |
| 96 | Ga0068855_100042296 | 3300005563 | Bacteria | 5399 |
| 97 | Ga0068855_100074441 | 3300005563 | Bacteria | 3944 |
| 98 | Ga0068855_100172155 | 3300005563 | Bacteria | 2452 |
| 99 | Ga0068855_100205087 | 3300005563 | Bacteria | 2218 |
| 100 | Ga0068855_100317984 | 3300005563 | Bacteria | 1721 |
| 101 | Ga0068857_100101957 | 3300005577 | Bacteria | 2576 |
| 102 | Ga0068857_100184468 | 3300005577 | Bacteria | 1899 |
| 103 | Ga0068854_100007798 | 3300005578 | Bacteria | 6848 |
| 104 | Ga0068854_100122136 | 3300005578 | Bacteria | 1979 |
| 105 | Ga0068856_100024803 | 3300005614 | Bacteria | 5840 |
| 106 | Ga0068856_100256483 | 3300005614 | Bacteria | 1764 |
| 107 | Ga0068852_100009678 | 3300005616 | Bacteria | 7162 |
| 108 | Ga0068852_100015002 | 3300005616 | Bacteria | 5988 |
| 109 | Ga0068852_100067226 | 3300005616 | Bacteria | 3133 |
| 110 | Ga0068859_100000231 | 3300005617 | Bacteria | 55036 |
| 111 | Ga0068859_100007203 | 3300005617 | Bacteria | 11289 |
| 112 | Ga0068864_100000060 | 3300005618 | Bacteria | 124506 |
| 113 | Ga0068864_100000061 | 3300005618 | Bacteria | 123373 |
| 114 | Ga0068864_100015964 | 3300005618 | Bacteria | 6249 |
| 115 | Ga0068864_100024083 | 3300005618 | Bacteria | 5118 |
| 116 | Ga0068864_100066194 | 3300005618 | Bacteria | 3136 |
| 117 | Ga0068861_100017580 | 3300005719 | Bacteria | 5080 |
| 118 | Ga0068861_100422864 | 3300005719 | Bacteria | 1187 |
| 119 | Ga0068851_10001676 | 3300005834 | Bacteria | 9694 |
| 120 | Ga0068863_100000023 | 3300005841 | Bacteria | 186490 |
| 121 | Ga0068863_100000810 | 3300005841 | Bacteria | 31370 |
| 122 | Ga0068863_100006931 | 3300005841 | Bacteria | 11106 |
| 123 | Ga0068863_100377190 | 3300005841 | Bacteria | 1384 |
| 124 | Ga0068858_100000184 | 3300005842 | Bacteria | 66104 |
| 125 | Ga0068858_100003504 | 3300005842 | Bacteria | 15561 |
| 126 | Ga0068858_100004308 | 3300005842 | Bacteria | 13981 |
| 127 | Ga0068858_100023690 | 3300005842 | Bacteria | 5719 |
| 128 | Ga0068858_100136549 | 3300005842 | Bacteria | 2301 |
| 129 | Ga0068860_100000100 | 3300005843 | Bacteria | 144580 |
| 130 | Ga0068860_100000122 | 3300005843 | Bacteria | 125178 |
| 131 | Ga0068860_100004300 | 3300005843 | Bacteria | 14558 |
| 132 | Ga0068862_100006370 | 3300005844 | Bacteria | 9814 |
| 133 | Ga0068862_100097668 | 3300005844 | Bacteria | 2565 |
| 134 | Ga0068862_100287207 | 3300005844 | Bacteria | 1510 |
| 135 | Ga0081455_10122481 | 3300005937 | Bacteria | 2047 |
| 136 | Ga0081455_10182224 | 3300005937 | Bacteria | 1589 |
| 137 | Ga0081538_10019682 | 3300005981 | Bacteria | 5000 |
| 138 | Ga0081540_1000005 | 3300005983 | Bacteria | 227052 |
| 139 | Ga0081539_10001341 | 3300005985 | Bacteria | 42889 |
| 140 | Ga0070717_10010974 | 3300006028 | Bacteria | 6859 |
| 141 | Ga0070717_10114965 | 3300006028 | Bacteria | 2299 |
| 142 | Ga0075365_10012223 | 3300006038 | Bacteria | 5087 |
| 143 | Ga0075365_10105027 | 3300006038 | Bacteria | 1937 |
| 144 | Ga0075368_10013467 | 3300006042 | Bacteria | 3004 |
| 145 | Ga0075363_100102279 | 3300006048 | Bacteria | 1586 |
| 146 | Ga0075364_10000160 | 3300006051 | Bacteria | 29830 |
| 147 | Ga0070715_10005056 | 3300006163 | Bacteria | 4374 |
| 148 | Ga0070716_100032077 | 3300006173 | Bacteria | 2862 |
| 149 | Ga0070712_100033651 | 3300006175 | Bacteria | 3469 |
| 150 | Ga0070712_100046978 | 3300006175 | Bacteria | 2986 |
| 151 | Ga0070712_100124392 | 3300006175 | Bacteria | 1945 |
| 152 | Ga0075367_10043383 | 3300006178 | Bacteria | 2634 |
| 153 | Ga0075366_10001106 | 3300006195 | Bacteria | 13260 |
| 154 | Ga0097621_100135651 | 3300006237 | Bacteria | 2099 |
| 155 | Ga0075370_10054187 | 3300006353 | Bacteria | 2277 |
| 156 | Ga0068871_100131098 | 3300006358 | Bacteria | 2125 |
| 157 | Ga0068871_100153079 | 3300006358 | Bacteria | 1968 |
| 158 | Ga0075430_100001664 | 3300006846 | Bacteria | 18165 |
| 159 | Ga0075430_100036710 | 3300006846 | Bacteria | 4155 |
| 160 | Ga0075430_100045419 | 3300006846 | Bacteria | 3711 |
| 161 | Ga0075430_100060215 | 3300006846 | Bacteria | 3191 |
| 162 | Ga0075431_100206111 | 3300006847 | Bacteria | 2010 |
| 163 | Ga0075433_10036706 | 3300006852 | Bacteria | 4223 |
| 164 | Ga0075434_100054347 | 3300006871 | Bacteria | 3979 |
| 165 | Ga0075429_100002435 | 3300006880 | Bacteria | 15677 |
| 166 | Ga0068865_100002419 | 3300006881 | Bacteria | 11025 |
| 167 | Ga0068865_100137080 | 3300006881 | Bacteria | 1841 |
| 168 | Ga0068865_100300974 | 3300006881 | Bacteria | 1284 |
| 169 | Ga0075436_100010291 | 3300006914 | Bacteria | 6404 |
| 170 | Ga0075436_100044482 | 3300006914 | Bacteria | 3062 |
| 171 | Ga0097620_100000231 | 3300006931 | Bacteria | 55036 |
| 172 | Ga0097620_100007203 | 3300006931 | Bacteria | 11289 |
| 173 | Ga0075435_100192276 | 3300007076 | Bacteria | 1728 |
| 174 | Ga0099795_10013325 | 3300007788 | Bacteria | 2520 |
| 175 | Ga0105240_10002285 | 3300009093 | Bacteria | 31035 |
| 176 | Ga0105240_10027302 | 3300009093 | Bacteria | 7476 |
| 177 | Ga0105240_10161862 | 3300009093 | Bacteria | 2657 |
| 178 | Ga0105240_10197701 | 3300009093 | Bacteria | 2359 |
| 179 | Ga0105240_10217886 | 3300009093 | Bacteria | 2225 |
| 180 | Ga0111539_10019416 | 3300009094 | Bacteria | 8389 |
| 181 | Ga0111539_10176877 | 3300009094 | Bacteria | 2493 |
| 182 | Ga0111539_10321187 | 3300009094 | Bacteria | 1802 |
| 183 | Ga0105245_10050003 | 3300009098 | Bacteria | 3745 |
| 184 | Ga0105247_10074349 | 3300009101 | Bacteria | 2131 |
| 185 | Ga0105247_10136678 | 3300009101 | Bacteria | 1602 |
| 186 | Ga0114129_10055349 | 3300009147 | Bacteria | 5559 |
| 187 | Ga0105241_10032577 | 3300009174 | Bacteria | 3908 |
| 188 | Ga0105248_10000279 | 3300009177 | Bacteria | 60271 |
| 189 | Ga0105248_10015107 | 3300009177 | Bacteria | 8503 |
| 190 | Ga0105248_10016683 | 3300009177 | Bacteria | 8084 |
| 191 | Ga0105248_10016737 | 3300009177 | Bacteria | 8073 |
| 192 | Ga0105248_10200674 | 3300009177 | Bacteria | 2247 |
| 193 | Ga0105237_10369440 | 3300009545 | Bacteria | 1439 |
| 194 | Ga0105238_10027382 | 3300009551 | Bacteria | 5807 |
| 195 | Ga0105238_10048775 | 3300009551 | Bacteria | 4266 |
| 196 | Ga0105238_10132158 | 3300009551 | Bacteria | 2474 |
| 197 | Ga0105249_10014102 | 3300009553 | Bacteria | 7065 |
| 198 | Ga0105249_10236807 | 3300009553 | Bacteria | 1803 |
| 199 | Ga0099796_10001765 | 3300010159 | Bacteria | 4514 |
| 200 | Ga0099796_10004606 | 3300010159 | Bacteria | 3358 |
| 201 | Ga0105239_10013959 | 3300010375 | Bacteria | 8920 |
| 202 | Ga0105239_10065192 | 3300010375 | Bacteria | 4000 |
| 203 | Ga0105239_10080254 | 3300010375 | Bacteria | 3590 |
| 204 | Ga0105239_10122138 | 3300010375 | Bacteria | 2893 |
| 205 | Ga0157373_10031787 | 3300013100 | Bacteria | 3800 |
| 206 | Ga0157371_10014768 | 3300013102 | Bacteria | 5879 |
| 207 | Ga0157371_10115583 | 3300013102 | Bacteria | 1906 |
| 208 | Ga0157370_10003380 | 3300013104 | Bacteria | 18756 |
| 209 | Ga0157370_10029718 | 3300013104 | Bacteria | 5360 |
| 210 | Ga0157370_10084836 | 3300013104 | Bacteria | 2976 |
| 211 | Ga0157370_10160586 | 3300013104 | Bacteria | 2091 |
| 212 | Ga0157369_10108496 | 3300013105 | Bacteria | 2952 |
| 213 | Ga0163162_10088453 | 3300013306 | Bacteria | 3177 |
| 214 | Ga0163162_10226846 | 3300013306 | Bacteria | 1998 |
| 215 | Ga0163162_10338267 | 3300013306 | Bacteria | 1638 |
| 216 | Ga0157372_10027766 | 3300013307 | Bacteria | 6169 |
| 217 | Ga0157372_10032887 | 3300013307 | Bacteria | 5691 |
| 218 | Ga0157375_10098846 | 3300013308 | Bacteria | 2996 |
| 219 | Ga0163163_10043821 | 3300014325 | Bacteria | 4389 |
| 220 | Ga0163163_10133829 | 3300014325 | Bacteria | 2519 |
| 221 | Ga0163163_10304061 | 3300014325 | Bacteria | 1647 |
| 222 | Ga0157380_10229057 | 3300014326 | Bacteria | 1668 |
| 223 | Ga0157380_10238135 | 3300014326 | Bacteria | 1639 |
| 224 | Ga0157380_10388431 | 3300014326 | Bacteria | 1320 |
| 225 | Ga0157379_10012083 | 3300014968 | Bacteria | 7540 |
| 226 | Ga0157379_10111262 | 3300014968 | Bacteria | 2460 |
| 227 | Ga0163161_10120616 | 3300017792 | Bacteria | 1970 |
| 228 | Ga0213874_10013464 | 3300021377 | Bacteria | 2120 |
| 229 | Ga0213876_10019673 | 3300021384 | Bacteria | 3566 |
| 230 | Ga0209026_1005312 | 3300025250 | Bacteria | 3499 |
| 231 | Ga0209026_1009377 | 3300025250 | Bacteria | 1928 |
| 232 | Ga0209148_1001435 | 3300025254 | Bacteria | 12136 |
| 233 | Ga0209148_1002626 | 3300025254 | Bacteria | 5855 |
| 234 | Ga0209758_1000430 | 3300025297 | Bacteria | 71132 |
| 235 | Ga0209758_1001067 | 3300025297 | Bacteria | 35672 |
| 236 | Ga0209050_1000098 | 3300025298 | Bacteria | 236717 |
| 237 | Ga0209257_1000221 | 3300025304 | Bacteria | 134870 |
| 238 | Ga0209257_1004498 | 3300025304 | Bacteria | 10743 |
| 239 | Ga0207656_10011311 | 3300025321 | Bacteria | 3369 |
| 240 | Ga0207682_10003834 | 3300025893 | Bacteria | 6455 |
| 241 | Ga0207680_10030166 | 3300025903 | Bacteria | 3055 |
| 242 | Ga0207680_10030196 | 3300025903 | Bacteria | 3054 |
| 243 | Ga0207647_10241102 | 3300025904 | Bacteria | 1038 |
| 244 | Ga0207645_10004551 | 3300025907 | Bacteria | 10239 |
| 245 | Ga0207645_10037006 | 3300025907 | Bacteria | 3133 |
| 246 | Ga0207645_10101160 | 3300025907 | Bacteria | 1859 |
| 247 | Ga0207643_10121081 | 3300025908 | Bacteria | 1550 |
| 248 | Ga0207705_10003181 | 3300025909 | Bacteria | 12500 |
| 249 | Ga0207705_10003909 | 3300025909 | Bacteria | 11330 |
| 250 | Ga0207654_10015995 | 3300025911 | Bacteria | 3901 |
| 251 | Ga0207654_10177629 | 3300025911 | Bacteria | 1387 |
| 252 | Ga0207707_10025158 | 3300025912 | Bacteria | 5207 |
| 253 | Ga0207707_10030967 | 3300025912 | Bacteria | 4679 |
| 254 | Ga0207707_10083476 | 3300025912 | Bacteria | 2790 |
| 255 | Ga0207707_10321714 | 3300025912 | Bacteria | 1335 |
| 256 | Ga0207695_10002540 | 3300025913 | Bacteria | 26801 |
| 257 | Ga0207695_10004869 | 3300025913 | Bacteria | 18113 |
| 258 | Ga0207695_10026041 | 3300025913 | Bacteria | 6534 |
| 259 | Ga0207695_10096452 | 3300025913 | Bacteria | 2959 |
| 260 | Ga0207695_10337110 | 3300025913 | Bacteria | 1396 |
| 261 | Ga0207671_10438277 | 3300025914 | Bacteria | 1040 |
| 262 | Ga0207693_10000787 | 3300025915 | Bacteria | 28419 |
| 263 | Ga0207693_10014625 | 3300025915 | Bacteria | 6305 |
| 264 | Ga0207693_10059645 | 3300025915 | Bacteria | 2989 |
| 265 | Ga0207693_10085389 | 3300025915 | Bacteria | 2472 |
| 266 | Ga0207693_10088252 | 3300025915 | Bacteria | 2431 |
| 267 | Ga0207663_10154644 | 3300025916 | Bacteria | 1612 |
| 268 | Ga0207660_10014784 | 3300025917 | Bacteria | 5143 |
| 269 | Ga0207660_10028003 | 3300025917 | Bacteria | 3851 |
| 270 | Ga0207662_10102755 | 3300025918 | Bacteria | 1773 |
| 271 | Ga0207657_10003993 | 3300025919 | Bacteria | 15684 |
| 272 | Ga0207657_10074018 | 3300025919 | Bacteria | 2877 |
| 273 | Ga0207657_10083000 | 3300025919 | Bacteria | 2689 |
| 274 | Ga0207657_10094864 | 3300025919 | Bacteria | 2483 |
| 275 | Ga0207649_10024458 | 3300025920 | Bacteria | 3510 |
| 276 | Ga0207652_10004635 | 3300025921 | Bacteria | 11144 |
| 277 | Ga0207652_10025068 | 3300025921 | Bacteria | 4956 |
| 278 | Ga0207652_10045774 | 3300025921 | Bacteria | 3730 |
| 279 | Ga0207652_10307230 | 3300025921 | Bacteria | 1431 |
| 280 | Ga0207681_10001188 | 3300025923 | Bacteria | 16757 |
| 281 | Ga0207681_10095626 | 3300025923 | Bacteria | 2131 |
| 282 | Ga0207694_10034155 | 3300025924 | Bacteria | 3899 |
| 283 | Ga0207694_10067466 | 3300025924 | Bacteria | 2792 |
| 284 | Ga0207694_10130110 | 3300025924 | Bacteria | 2017 |
| 285 | Ga0207694_10193380 | 3300025924 | Bacteria | 1653 |
| 286 | Ga0207650_10000065 | 3300025925 | Bacteria | 140452 |
| 287 | Ga0207650_10064096 | 3300025925 | Bacteria | 2750 |
| 288 | Ga0207650_10073794 | 3300025925 | Bacteria | 2571 |
| 289 | Ga0207650_10193941 | 3300025925 | Bacteria | 1624 |
| 290 | Ga0207687_10089476 | 3300025927 | Bacteria | 2242 |
| 291 | Ga0207687_10174718 | 3300025927 | Bacteria | 1660 |
| 292 | Ga0207700_10006999 | 3300025928 | Bacteria | 6861 |
| 293 | Ga0207700_10025273 | 3300025928 | Bacteria | 4122 |
| 294 | Ga0207664_10070244 | 3300025929 | Bacteria | 2818 |
| 295 | Ga0207664_10139282 | 3300025929 | Bacteria | 2050 |
| 296 | Ga0207644_10002707 | 3300025931 | Bacteria | 11418 |
| 297 | Ga0207644_10006071 | 3300025931 | Bacteria | 7879 |
| 298 | Ga0207644_10182604 | 3300025931 | Bacteria | 1645 |
| 299 | Ga0207690_10001133 | 3300025932 | Bacteria | 16976 |
| 300 | Ga0207690_10036533 | 3300025932 | Bacteria | 3181 |
| 301 | Ga0207690_10050959 | 3300025932 | Bacteria | 2766 |
| 302 | Ga0207706_10083773 | 3300025933 | Bacteria | 2803 |
| 303 | Ga0207706_10091402 | 3300025933 | Bacteria | 2676 |
| 304 | Ga0207706_10123983 | 3300025933 | Bacteria | 2273 |
| 305 | Ga0207706_10126882 | 3300025933 | Bacteria | 2244 |
| 306 | Ga0207709_10226556 | 3300025935 | Bacteria | 1351 |
| 307 | Ga0207670_10004720 | 3300025936 | Bacteria | 7390 |
| 308 | Ga0207670_10006011 | 3300025936 | Bacteria | 6707 |
| 309 | Ga0207670_10124316 | 3300025936 | Bacteria | 1880 |
| 310 | Ga0207669_10001250 | 3300025937 | Bacteria | 10802 |
| 311 | Ga0207704_10008976 | 3300025938 | Bacteria | 4805 |
| 312 | Ga0207665_10000117 | 3300025939 | Bacteria | 52204 |
| 313 | Ga0207691_10004922 | 3300025940 | Bacteria | 12889 |
| 314 | Ga0207711_10000684 | 3300025941 | Bacteria | 33642 |
| 315 | Ga0207711_10005226 | 3300025941 | Bacteria | 10999 |
| 316 | Ga0207711_10009716 | 3300025941 | Bacteria | 8007 |
| 317 | Ga0207711_10095145 | 3300025941 | Bacteria | 2627 |
| 318 | Ga0207689_10107370 | 3300025942 | Bacteria | 2294 |
| 319 | Ga0207679_10396633 | 3300025945 | Bacteria | 1213 |
| 320 | Ga0207667_10033644 | 3300025949 | Bacteria | 5510 |
| 321 | Ga0207667_10038111 | 3300025949 | Bacteria | 5135 |
| 322 | Ga0207667_10050024 | 3300025949 | Bacteria | 4411 |
| 323 | Ga0207667_10091205 | 3300025949 | Bacteria | 3148 |
| 324 | Ga0207667_10149280 | 3300025949 | Bacteria | 2406 |
| 325 | Ga0207651_10027327 | 3300025960 | Bacteria | 3582 |
| 326 | Ga0207651_10251546 | 3300025960 | Bacteria | 1446 |
| 327 | Ga0207712_10012792 | 3300025961 | Bacteria | 5366 |
| 328 | Ga0207668_10000018 | 3300025972 | Bacteria | 158577 |
| 329 | Ga0207668_10000340 | 3300025972 | Bacteria | 30277 |
| 330 | Ga0207668_10002444 | 3300025972 | Bacteria | 10845 |
| 331 | Ga0207668_10008059 | 3300025972 | Bacteria | 6271 |
| 332 | Ga0207668_10030812 | 3300025972 | Bacteria | 3527 |
| 333 | Ga0207640_10029818 | 3300025981 | Bacteria | 3353 |
| 334 | Ga0207640_10097395 | 3300025981 | Bacteria | 2053 |
| 335 | Ga0207640_10102027 | 3300025981 | Bacteria | 2014 |
| 336 | Ga0207640_10105606 | 3300025981 | Bacteria | 1985 |
| 337 | Ga0207658_10000168 | 3300025986 | Bacteria | 70040 |
| 338 | Ga0207658_10003273 | 3300025986 | Bacteria | 11505 |
| 339 | Ga0207658_10011028 | 3300025986 | Bacteria | 6152 |
| 340 | Ga0207658_10095180 | 3300025986 | Bacteria | 2320 |
| 341 | Ga0207658_10107507 | 3300025986 | Bacteria | 2198 |
| 342 | Ga0207677_10092168 | 3300026023 | Bacteria | 2206 |
| 343 | Ga0207703_10000273 | 3300026035 | Bacteria | 57186 |
| 344 | Ga0207703_10003313 | 3300026035 | Bacteria | 13519 |
| 345 | Ga0207703_10007240 | 3300026035 | Bacteria | 8824 |
| 346 | Ga0207703_10069866 | 3300026035 | Bacteria | 2897 |
| 347 | Ga0207703_10166334 | 3300026035 | Bacteria | 1936 |
| 348 | Ga0207703_10483466 | 3300026035 | Bacteria | 1160 |
| 349 | Ga0207639_10005874 | 3300026041 | Bacteria | 8317 |
| 350 | Ga0207639_10025958 | 3300026041 | Bacteria | 4253 |
| 351 | Ga0207678_10007031 | 3300026067 | Bacteria | 9992 |
| 352 | Ga0207678_10278501 | 3300026067 | Bacteria | 1435 |
| 353 | Ga0207678_10392079 | 3300026067 | Bacteria | 1201 |
| 354 | Ga0207708_10220677 | 3300026075 | Bacteria | 1519 |
| 355 | Ga0207702_10028812 | 3300026078 | Bacteria | 4618 |
| 356 | Ga0207702_10063897 | 3300026078 | Bacteria | 3149 |
| 357 | Ga0207702_10226237 | 3300026078 | Bacteria | 1746 |
| 358 | Ga0207702_10304951 | 3300026078 | Bacteria | 1512 |
| 359 | Ga0207641_10000067 | 3300026088 | Bacteria | 155379 |
| 360 | Ga0207641_10001551 | 3300026088 | Bacteria | 22508 |
| 361 | Ga0207641_10011364 | 3300026088 | Bacteria | 7305 |
| 362 | Ga0207641_10022554 | 3300026088 | Bacteria | 5181 |
| 363 | Ga0207641_10326215 | 3300026088 | Bacteria | 1457 |
| 364 | Ga0207648_10002948 | 3300026089 | Bacteria | 18006 |
| 365 | Ga0207648_10033201 | 3300026089 | Bacteria | 4552 |
| 366 | Ga0207676_10000127 | 3300026095 | Bacteria | 66733 |
| 367 | Ga0207676_10000501 | 3300026095 | Bacteria | 33019 |
| 368 | Ga0207676_10011585 | 3300026095 | Bacteria | 6304 |
| 369 | Ga0207676_10011837 | 3300026095 | Bacteria | 6242 |
| 370 | Ga0207674_10029426 | 3300026116 | Bacteria | 5782 |
| 371 | Ga0207674_10169699 | 3300026116 | Bacteria | 2136 |
| 372 | Ga0207674_10211175 | 3300026116 | Bacteria | 1890 |
| 373 | Ga0207675_100510238 | 3300026118 | Bacteria | 1198 |
| 374 | Ga0207683_10037355 | 3300026121 | Bacteria | 4228 |
| 375 | Ga0207698_10070871 | 3300026142 | Bacteria | 2763 |
| 376 | Ga0207698_10301594 | 3300026142 | Bacteria | 1491 |
| 377 | Ga0209981_1000385 | 3300027378 | Bacteria | 5640 |
| 378 | Ga0209179_1000737 | 3300027512 | Bacteria | 3553 |
| 379 | Ga0209999_1006024 | 3300027543 | Bacteria | 2178 |
| 380 | Ga0209813_10001517 | 3300027866 | Bacteria | 5213 |
| 381 | Ga0207428_10130483 | 3300027907 | Bacteria | 1923 |
| 382 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 383 | Ga0268266_10007459 | 3300028379 | Bacteria | 9866 |
| 384 | Ga0268266_10008942 | 3300028379 | Bacteria | 8863 |
| 385 | Ga0268266_10051971 | 3300028379 | Bacteria | 3518 |
| 386 | Ga0268266_10060923 | 3300028379 | Bacteria | 3254 |
| 387 | Ga0268265_10001199 | 3300028380 | Bacteria | 22587 |
| 388 | Ga0268265_10002874 | 3300028380 | Bacteria | 12649 |
| 389 | Ga0268265_10088418 | 3300028380 | Bacteria | 2468 |
| 390 | Ga0268265_10157050 | 3300028380 | Bacteria | 1926 |
| 391 | Ga0268265_10280705 | 3300028380 | Bacteria | 1490 |
| 392 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 393 | Ga0268264_10000172 | 3300028381 | Bacteria | 140393 |
| 394 | Ga0268264_10140577 | 3300028381 | Bacteria | 2152 |
| 395 | Ga0307517_10001099 | 3300028786 | Bacteria | 45677 |
| 396 | Ga0307517_10017425 | 3300028786 | Bacteria | 9367 |
| 397 | Ga0265338_10013082 | 3300028800 | Bacteria | 9404 |
| 398 | Ga0265338_10033080 | 3300028800 | Bacteria | 5027 |
| 399 | Ga0307511_10042056 | 3300030521 | Bacteria | 3847 |
| 400 | Ga0265332_10025083 | 3300031238 | Bacteria | 2621 |
| 401 | Ga0265325_10001782 | 3300031241 | Bacteria | 14906 |
| 402 | Ga0265325_10010617 | 3300031241 | Bacteria | 5323 |
| 403 | Ga0265325_10123382 | 3300031241 | Bacteria | 1246 |
| 404 | Ga0265340_10017200 | 3300031247 | Bacteria | 3740 |
| 405 | Ga0265340_10017957 | 3300031247 | Bacteria | 3656 |
| 406 | Ga0265339_10000101 | 3300031249 | Bacteria | 69843 |
| 407 | Ga0265327_10110094 | 3300031251 | Bacteria | 1317 |
| 408 | Ga0307513_10003813 | 3300031456 | Bacteria | 20324 |
| 409 | Ga0307513_10007922 | 3300031456 | Bacteria | 13674 |
| 410 | Ga0307513_10015171 | 3300031456 | Bacteria | 9352 |
| 411 | Ga0307513_10138070 | 3300031456 | Bacteria | 2369 |
| 412 | Ga0265313_10000548 | 3300031595 | Bacteria | 39188 |
| 413 | Ga0265313_10063649 | 3300031595 | Bacteria | 1719 |
| 414 | Ga0316579_10000778 | 3300031691 | Bacteria | 10920 |
| 415 | Ga0307516_10000020 | 3300031730 | Bacteria | 195931 |
| 416 | Ga0307416_100288231 | 3300032002 | Bacteria | 1624 |
| 417 | Ga0307510_10013355 | 3300033180 | Bacteria | 9739 |
| 418 | Ga0373926_0025167 | 3300035083 | Bacteria | 2076 |
| 419 | Ga0373929_0006916 | 3300035085 | Bacteria | 2061 |
| 420 | Ga0373944_0002067 | 3300035089 | Bacteria | 5094 |
| 421 | Ga0373944_0013160 | 3300035089 | Bacteria | 2290 |
| 422 | Ga0373952_0031570 | 3300035092 | Bacteria | 1178 |
| 423 | Ga0373952_0032546 | 3300035092 | Bacteria | 1165 |
| 424 | Ga0373923_0095981 | 3300035111 | Bacteria | 1302 |
| 425 | Ga0373936_0020232 | 3300035113 | Bacteria | 2584 |
| 426 | Ga0373945_0032897 | 3300035116 | Bacteria | 1839 |
| 427 | Ga0373954_0008692 | 3300035118 | Bacteria | 4465 |
| 428 | Ga0373954_0018837 | 3300035118 | Bacteria | 3110 |
| 429 | Ga0373954_0072032 | 3300035118 | Bacteria | 1643 |
| 430 | Ga0373957_0042446 | 3300035120 | Bacteria | 1716 |
| 431 | Ga0373943_0001239 | 3300035170 | Bacteria | 11423 |
| 432 | Ga0373943_0036272 | 3300035170 | Bacteria | 2361 |
| 433 | Ga0373946_0000841 | 3300035171 | Bacteria | 10513 |
| 434 | Ga0373946_0034936 | 3300035171 | Bacteria | 2032 |
| 435 | Ga0373946_0108442 | 3300035171 | Bacteria | 1254 |
| 436 | Ga0373955_0002732 | 3300035172 | Bacteria | 7732 |
| 437 | Ga0373924_0016745 | 3300035410 | Bacteria | 2803 |
| 438 | Ga0373931_0007577 | 3300035691 | Bacteria | 5113 |
| 439 | Ga0373931_0015115 | 3300035691 | Bacteria | 3782 |
| 440 | Ga0373935_0014244 | 3300035692 | Bacteria | 4799 |
| 441 | Ga0373935_0026355 | 3300035692 | Bacteria | 3586 |
| 442 | Ga0373935_0065547 | 3300035692 | Bacteria | 2331 |
| 443 | Ga0373935_0211620 | 3300035692 | Bacteria | 1344 |
| 444 | Ga0373927_0001609 | 3300035695 | Bacteria | 16951 |
| 445 | Ga0373927_0002779 | 3300035695 | Bacteria | 12776 |
| 446 | Ga0373927_0012344 | 3300035695 | Bacteria | 5685 |
| 447 | Ga0373927_0024145 | 3300035695 | Bacteria | 3977 |
| 448 | Ga0373927_0202531 | 3300035695 | Bacteria | 1303 |
| 449 | Ga0373933_0001709 | 3300035724 | Bacteria | 12737 |
| 450 | Ga0373933_0028734 | 3300035724 | Bacteria | 3210 |
| 451 | Ga0373947_0001204 | 3300035725 | Bacteria | 15908 |
| 452 | Ga0373947_0084188 | 3300035725 | Bacteria | 1973 |
| 453 | Ga0373937_0000959 | 3300036401 | Bacteria | 24479 |
| 454 | Ga0373937_0009056 | 3300036401 | Bacteria | 8640 |
| 455 | Ga0373937_0145612 | 3300036401 | Bacteria | 2217 |
| 456 | Ga0373937_0408257 | 3300036401 | Bacteria | 1289 |
| 457 | Ga0373937_0431506 | 3300036401 | Bacteria | 1251 |
| 458 | Ga0373937_0526406 | 3300036401 | Bacteria | 1123 |
| 459 | Ga0373925_0000277 | 3300037068 | Bacteria | 53450 |
| 460 | Ga0373925_0007493 | 3300037068 | Bacteria | 7956 |
| 461 | Ga0373925_0011790 | 3300037068 | Bacteria | 6327 |
| 462 | Ga0373925_0032343 | 3300037068 | Bacteria | 3850 |
| 463 | Ga0373925_0126825 | 3300037068 | Bacteria | 1986 |
| 464 | Ga0395899_0000847 | 3300037312 | Bacteria | 29441 |
| 465 | Ga0395899_0272677 | 3300037312 | Bacteria | 1153 |
| 466 | Ga0395899_0296182 | 3300037312 | Bacteria | 1096 |
| 467 | Ga0395900_0000016 | 3300037418 | Bacteria | 382407 |
| 468 | Ga0395898_0025733 | 3300037466 | Bacteria | 5926 |
| 469 | Ga0395898_0115706 | 3300037466 | Bacteria | 2569 |
| 470 | Ga0395905_0008634 | 3300037471 | Bacteria | 10037 |
| 471 | Ga0395905_0034525 | 3300037471 | Bacteria | 4749 |
| 472 | Ga0395905_0206247 | 3300037471 | Bacteria | 1842 |
| 473 | Ga0436364_1039680 | 3300037853 | Bacteria | 1720 |
| 474 | Ga0395901_0000028 | 3300038443 | Bacteria | 242653 |
| 475 | Ga0395901_0067598 | 3300038443 | Bacteria | 3722 |
| 476 | Ga0400483_185390 | 3300039062 | Bacteria | 3076 |
| 477 | Ga0436365_0392568 | 3300039437 | Bacteria | 1624 |
| 478 | Ga0436365_0513635 | 3300039437 | Bacteria | 1028 |
| 479 | Ga0436365_0996971 | 3300039437 | Bacteria | 5522 |
| 480 | Ga0436365_1199935 | 3300039437 | Bacteria | 5250 |
| 481 | Ga0436365_1750823 | 3300039437 | Bacteria | 4669 |
| 482 | Ga0436361_0115059 | 3300039447 | Bacteria | 4096 |
| 483 | Ga0436363_0093454 | 3300039450 | Bacteria | 2841 |
| 484 | Ga0439448_0007095 | 3300042005 | Bacteria | 3238 |
| 485 | Ga0439459_0033545 | 3300042438 | Bacteria | 1058 |
| 486 | Ga0450893_0016054 | 3300042532 | Bacteria | 1266 |
| 487 | Ga0451577_0245810 | 3300042876 | Bacteria | 1619 |
| 488 | Ga0439440_0025807 | 3300042993 | Bacteria | 1356 |
| 489 | Ga0466963_0004016 | 3300044694 | Bacteria | 8508 |
| 490 | Ga0466963_0021477 | 3300044694 | Bacteria | 4073 |
| 491 | Ga0466963_0093046 | 3300044694 | Bacteria | 2055 |
| 492 | Ga0466963_0118151 | 3300044694 | Bacteria | 1823 |
| 493 | Ga0453684_0296846 | 3300044712 | Bacteria | 1838 |
| 494 | Ga0466957_0008453 | 3300044842 | Bacteria | 5855 |
| 495 | Ga0451576_0000040 | 3300045051 | Bacteria | 349778 |
| 496 | Ga0466958_0068378 | 3300045836 | Bacteria | 2171 |
| 497 | Ga0466967_0000138 | 3300045976 | Bacteria | 28201 |
| 498 | Ga0466967_0059354 | 3300045976 | Bacteria | 3386 |
| 499 | Ga0495627_000159 | 3300046453 | Bacteria | 76595 |
| 500 | Ga0495592_0022037 | 3300046454 | Bacteria | 4846 |
| 501 | Ga0495629_0003800 | 3300046459 | Bacteria | 11376 |
| 502 | Ga0495629_0056511 | 3300046459 | Bacteria | 2744 |
| 503 | Ga0495629_0105936 | 3300046459 | Bacteria | 1961 |
| 504 | Ga0495629_0171091 | 3300046459 | Bacteria | 1507 |
| 505 | Ga0495638_0148328 | 3300046460 | Bacteria | 1362 |
| 506 | Ga0495651_0002695 | 3300046462 | Bacteria | 13781 |
| 507 | Ga0495651_0024559 | 3300046462 | Bacteria | 4688 |
| 508 | Ga0495653_0001872 | 3300046463 | Bacteria | 16609 |
| 509 | Ga0495653_0110753 | 3300046463 | Bacteria | 1973 |
| 510 | Ga0495639_0122245 | 3300046475 | Bacteria | 1242 |
| 511 | Ga0495662_0009056 | 3300046476 | Bacteria | 4888 |
| 512 | Ga0495664_0000631 | 3300046477 | Bacteria | 17915 |
| 513 | Ga0495664_0078913 | 3300046477 | Bacteria | 1972 |
| 514 | Ga0495664_0112334 | 3300046477 | Bacteria | 1645 |
| 515 | Ga0495594_0159559 | 3300046499 | Bacteria | 1282 |
| 516 | Ga0495583_0028737 | 3300046506 | Bacteria | 2730 |
| 517 | Ga0495608_0007164 | 3300046511 | Bacteria | 7887 |
| 518 | Ga0495608_0026684 | 3300046511 | Bacteria | 3936 |
| 519 | Ga0495618_0001463 | 3300046514 | Bacteria | 15815 |
| 520 | Ga0495620_0010489 | 3300046515 | Bacteria | 4889 |
| 521 | Ga0495628_0007565 | 3300046516 | Bacteria | 9395 |
| 522 | Ga0495628_0285800 | 3300046516 | Bacteria | 1224 |
| 523 | Ga0495630_0013814 | 3300046517 | Bacteria | 5871 |
| 524 | Ga0495630_0034773 | 3300046517 | Bacteria | 3764 |
| 525 | Ga0495630_0128850 | 3300046517 | Bacteria | 1921 |
| 526 | Ga0495630_0182916 | 3300046517 | Bacteria | 1598 |
| 527 | Ga0495643_0126022 | 3300046522 | Bacteria | 1289 |
| 528 | Ga0495663_0033621 | 3300046525 | Bacteria | 1532 |
| 529 | Ga0495642_0001670 | 3300046528 | Bacteria | 9620 |
| 530 | Ga0495642_0046681 | 3300046528 | Bacteria | 1772 |
| 531 | Ga0495652_0012913 | 3300046529 | Bacteria | 7528 |
| 532 | Ga0495652_0049311 | 3300046529 | Bacteria | 3605 |
| 533 | Ga0495665_0007546 | 3300046531 | Bacteria | 5889 |
| 534 | Ga0495665_0057883 | 3300046531 | Bacteria | 2046 |
| 535 | Ga0495640_0000714 | 3300046533 | Bacteria | 24847 |
| 536 | Ga0495640_0003726 | 3300046533 | Bacteria | 12246 |
| 537 | Ga0495587_0027422 | 3300046536 | Bacteria | 3468 |
| 538 | Ga0495587_0060555 | 3300046536 | Bacteria | 2219 |
| 539 | Ga0495598_0008478 | 3300046537 | Bacteria | 2396 |
| 540 | Ga0495645_0000575 | 3300046543 | Bacteria | 25166 |
| 541 | Ga0495645_0046048 | 3300046543 | Bacteria | 3180 |
| 542 | Ga0495622_0020935 | 3300046557 | Bacteria | 3045 |
| 543 | Ga0495667_0002333 | 3300046559 | Bacteria | 12707 |
| 544 | Ga0495667_0076143 | 3300046559 | Bacteria | 2183 |
| 545 | Ga0495656_0026349 | 3300046615 | Bacteria | 2314 |
| 546 | Ga0495668_0002197 | 3300046616 | Bacteria | 16632 |
| 547 | Ga0495668_0027431 | 3300046616 | Bacteria | 3227 |
| 548 | Ga0495668_0049763 | 3300046616 | Bacteria | 2324 |
| 549 | Ga0495634_0001265 | 3300046642 | Bacteria | 23201 |
| 550 | Ga0495634_0003291 | 3300046642 | Bacteria | 13024 |
| 551 | Ga0495634_0009075 | 3300046642 | Bacteria | 7349 |
| 552 | Ga0495634_0160514 | 3300046642 | Bacteria | 1418 |
| 553 | Ga0495611_0007425 | 3300046648 | Bacteria | 4656 |
| 554 | Ga0495625_0088184 | 3300046660 | Bacteria | 2150 |
| 555 | Ga0495635_0000771 | 3300046663 | Bacteria | 20855 |
| 556 | Ga0495635_0000918 | 3300046663 | Bacteria | 19365 |
| 557 | Ga0495635_0118280 | 3300046663 | Bacteria | 1808 |
| 558 | Ga0495635_0153149 | 3300046663 | Bacteria | 1569 |
| 559 | Ga0495588_0211367 | 3300046674 | Bacteria | 1024 |
| 560 | Ga0495657_0027157 | 3300046675 | Bacteria | 4044 |
| 561 | Ga0495657_0187290 | 3300046675 | Bacteria | 1266 |
| 562 | Ga0495623_0003265 | 3300046679 | Bacteria | 10704 |
| 563 | Ga0495623_0012214 | 3300046679 | Bacteria | 5563 |
| 564 | Ga0495658_0009500 | 3300046683 | Bacteria | 4850 |
| 565 | Ga0495658_0121214 | 3300046683 | Bacteria | 1582 |
| 566 | Ga0495669_0000005 | 3300046684 | Bacteria | 193971 |
| 567 | Ga0495669_0000356 | 3300046684 | Bacteria | 23366 |
| 568 | Ga0495669_0010448 | 3300046684 | Bacteria | 3924 |
| 569 | Ga0495669_0029323 | 3300046684 | Bacteria | 2413 |
| 570 | Ga0495613_0042399 | 3300046689 | Bacteria | 3368 |
| 571 | Ga0495613_0053034 | 3300046689 | Bacteria | 2985 |
| 572 | Ga0495613_0091514 | 3300046689 | Bacteria | 2203 |
| 573 | Ga0495624_0012655 | 3300046690 | Bacteria | 5762 |
| 574 | Ga0495600_0001241 | 3300046809 | Bacteria | 14014 |
| 575 | Ga0495604_0000130 | 3300047317 | Bacteria | 63418 |
| 576 | Ga0495604_0037116 | 3300047317 | Bacteria | 3839 |
| 577 | Ga0495674_0003371 | 3300047319 | Bacteria | 15516 |
| 578 | Ga0495674_0026761 | 3300047319 | Bacteria | 5276 |
| 579 | Ga0495672_0036212 | 3300047320 | Bacteria | 3032 |
| 580 | Ga0495672_0063253 | 3300047320 | Bacteria | 2125 |
| 581 | Ga0495676_0137124 | 3300047321 | Bacteria | 1758 |
| 582 | Ga0495680_0000701 | 3300047322 | Bacteria | 37622 |
| 583 | Ga0495680_0160075 | 3300047322 | Bacteria | 1635 |
| 584 | Ga0495687_041745 | 3300047443 | Bacteria | 2010 |
| 585 | Ga0495675_0023318 | 3300047444 | Bacteria | 3943 |
| 586 | Ga0495675_0054090 | 3300047444 | Bacteria | 2548 |
| 587 | Ga0495677_0002371 | 3300047445 | Bacteria | 7405 |
| 588 | Ga0495685_031603 | 3300047447 | Bacteria | 1819 |
| 589 | Ga0495684_0018296 | 3300047471 | Bacteria | 5400 |
| 590 | Ga0495686_0000134 | 3300047472 | Bacteria | 149997 |
| 591 | Ga0495686_0032777 | 3300047472 | Bacteria | 3360 |
| 592 | Ga0495593_0013246 | 3300047673 | Bacteria | 4708 |
| 593 | Ga0495593_0030305 | 3300047673 | Bacteria | 2961 |
| 594 | Ga0495602_0002441 | 3300048088 | Bacteria | 18923 |
| 595 | Ga0495602_0024309 | 3300048088 | Bacteria | 5879 |
| 596 | Ga0495602_0225080 | 3300048088 | Bacteria | 1413 |
| 597 | Ga0496100_0280250 | 3300048903 | Bacteria | 1242 |
| 598 | Ga0496101_0002031 | 3300048904 | Bacteria | 12306 |
| 599 | Ga0496101_0038096 | 3300048904 | Bacteria | 3413 |
| 600 | Ga0496101_0138270 | 3300048904 | Bacteria | 1855 |
| 601 | Ga0496102_0016745 | 3300048905 | Bacteria | 6411 |
| 602 | Ga0496102_0032897 | 3300048905 | Bacteria | 4660 |
| 603 | Ga0496102_0044054 | 3300048905 | Bacteria | 4048 |
| 604 | Ga0496102_0088304 | 3300048905 | Bacteria | 2866 |
| 605 | Ga0496103_0113617 | 3300048906 | Bacteria | 1721 |
| 606 | Ga0496104_0001419 | 3300048907 | Bacteria | 20752 |
| 607 | Ga0496104_0001499 | 3300048907 | Bacteria | 20140 |
| 608 | Ga0496104_0017387 | 3300048907 | Bacteria | 6548 |
| 609 | Ga0496104_0018342 | 3300048907 | Bacteria | 6385 |
| 610 | Ga0496104_0173445 | 3300048907 | Bacteria | 2067 |
| 611 | Ga0496104_0337094 | 3300048907 | Bacteria | 1421 |
| 612 | Ga0496105_0010619 | 3300048908 | Bacteria | 7245 |
| 613 | Ga0496105_0234953 | 3300048908 | Bacteria | 1489 |
| 614 | Ga0496105_0330342 | 3300048908 | Bacteria | 1220 |
| 615 | Ga0496105_0378385 | 3300048908 | Bacteria | 1127 |
| 616 | Ga0496106_0037312 | 3300048909 | Bacteria | 3635 |
| 617 | Ga0496106_0076746 | 3300048909 | Bacteria | 2561 |
| 618 | Ga0496106_0138851 | 3300048909 | Bacteria | 1911 |
| 619 | Ga0496106_0235231 | 3300048909 | Bacteria | 1463 |
| 620 | Ga0496107_0040633 | 3300048910 | Bacteria | 3339 |
| 621 | Ga0496107_0076366 | 3300048910 | Bacteria | 2440 |
| 622 | Ga0496107_0080448 | 3300048910 | Bacteria | 2376 |
| 623 | Ga0496107_0211959 | 3300048910 | Bacteria | 1440 |
| 624 | Ga0496107_0377632 | 3300048910 | Bacteria | 1054 |
| 625 | Ga0496108_0021301 | 3300048911 | Bacteria | 5328 |
| 626 | Ga0496108_0148022 | 3300048911 | Bacteria | 2025 |
| 627 | Ga0496108_0246113 | 3300048911 | Bacteria | 1555 |
| 628 | Ga0496109_0006507 | 3300048912 | Bacteria | 9840 |
| 629 | Ga0496109_0071276 | 3300048912 | Bacteria | 3190 |
| 630 | Ga0496109_0204285 | 3300048912 | Bacteria | 1857 |
| 631 | Ga0496109_0249034 | 3300048912 | Bacteria | 1673 |
| 632 | Ga0496109_0392421 | 3300048912 | Bacteria | 1311 |
| 633 | Ga0496110_0140811 | 3300048913 | Bacteria | 2180 |
| 634 | Ga0496110_0515042 | 3300048913 | Bacteria | 1088 |
| 635 | Ga0496111_0303478 | 3300048914 | Bacteria | 1183 |
| 636 | Ga0496112_0041029 | 3300048915 | Bacteria | 4527 |
| 637 | Ga0496112_0053208 | 3300048915 | Bacteria | 3975 |
| 638 | Ga0496112_0063830 | 3300048915 | Bacteria | 3633 |
| 639 | Ga0496112_0081641 | 3300048915 | Bacteria | 3197 |
| 640 | Ga0496112_0195406 | 3300048915 | Bacteria | 1984 |
| 641 | Ga0496114_0011438 | 3300048917 | Bacteria | 7091 |
| 642 | Ga0496114_0378072 | 3300048917 | Bacteria | 1254 |
| 643 | Ga0496115_0015358 | 3300048918 | Bacteria | 5808 |
| 644 | Ga0496115_0052116 | 3300048918 | Bacteria | 3282 |
| 645 | Ga0496115_0117746 | 3300048918 | Bacteria | 2185 |
| 646 | Ga0496115_0119661 | 3300048918 | Bacteria | 2166 |
| 647 | Ga0496115_0191835 | 3300048918 | Bacteria | 1688 |
| 648 | Ga0496117_0008365 | 3300048920 | Bacteria | 9839 |
| 649 | Ga0496118_0017509 | 3300048921 | Bacteria | 6518 |
| 650 | Ga0496119_0001362 | 3300048922 | Bacteria | 29824 |
| 651 | Ga0496119_0005397 | 3300048922 | Bacteria | 12280 |
| 652 | Ga0496121_0000053 | 3300048924 | Bacteria | 312611 |
| 653 | Ga0496121_0049046 | 3300048924 | Bacteria | 3586 |
| 654 | Ga0496122_0008006 | 3300048925 | Bacteria | 11545 |
| 655 | Ga0496123_0001238 | 3300048926 | Bacteria | 37104 |
| 656 | Ga0501031_0003183 | 3300049568 | Bacteria | 10533 |
| 657 | Ga0501031_0004683 | 3300049568 | Bacteria | 8875 |
| 658 | Ga0501031_0045743 | 3300049568 | Bacteria | 2856 |
| 659 | Ga0501032_0000278 | 3300049569 | Bacteria | 43318 |
| 660 | Ga0501032_0005549 | 3300049569 | Bacteria | 9357 |
| 661 | Ga0501032_0009956 | 3300049569 | Bacteria | 6865 |
| 662 | Ga0501033_0011636 | 3300049570 | Bacteria | 6728 |
| 663 | Ga0501033_0047650 | 3300049570 | Bacteria | 3186 |
| 664 | Ga0501034_0038681 | 3300049571 | Bacteria | 4830 |
| 665 | Ga0501034_0127301 | 3300049571 | Bacteria | 2532 |
| 666 | Ga0501034_0283865 | 3300049571 | Bacteria | 1595 |
| 667 | Ga0501034_0284199 | 3300049571 | Bacteria | 1594 |
| 668 | Ga0501034_0353913 | 3300049571 | Bacteria | 1396 |
| 669 | Ga0501034_0362196 | 3300049571 | Bacteria | 1377 |
| 670 | Ga0501034_0449579 | 3300049571 | Bacteria | 1206 |
| 671 | Ga0501036_0020497 | 3300049572 | Bacteria | 5552 |
| 672 | Ga0501036_0318641 | 3300049572 | Bacteria | 1299 |
| 673 | Ga0501037_0005407 | 3300049573 | Bacteria | 9302 |
| 674 | Ga0501037_0016422 | 3300049573 | Bacteria | 5449 |
| 675 | Ga0501037_0046733 | 3300049573 | Bacteria | 3174 |
| 676 | Ga0501037_0084701 | 3300049573 | Bacteria | 2296 |
| 677 | Ga0501037_0177063 | 3300049573 | Bacteria | 1514 |
| 678 | Ga0501038_0002487 | 3300049574 | Bacteria | 17144 |
| 679 | Ga0501038_0017203 | 3300049574 | Bacteria | 6537 |
| 680 | Ga0501038_0028216 | 3300049574 | Bacteria | 4987 |
| 681 | Ga0501038_0297076 | 3300049574 | Bacteria | 1268 |
| 682 | Ga0501039_0134505 | 3300049575 | Bacteria | 1941 |
| 683 | Ga0501039_0376353 | 3300049575 | Bacteria | 1115 |
| 684 | Ga0501043_0003959 | 3300049579 | Bacteria | 12143 |
| 685 | Ga0501043_0007512 | 3300049579 | Bacteria | 8657 |
| 686 | Ga0501043_0043780 | 3300049579 | Bacteria | 3519 |
| 687 | Ga0501047_0012392 | 3300049581 | Bacteria | 8070 |
| 688 | Ga0501047_0035166 | 3300049581 | Bacteria | 4839 |
| 689 | Ga0501047_0035960 | 3300049581 | Bacteria | 4786 |
| 690 | Ga0501047_0094898 | 3300049581 | Bacteria | 2862 |
| 691 | Ga0501047_0112023 | 3300049581 | Bacteria | 2611 |
| 692 | Ga0501047_0309809 | 3300049581 | Bacteria | 1419 |
| 693 | Ga0501067_0000691 | 3300049583 | Bacteria | 18172 |
| 694 | Ga0501067_0029083 | 3300049583 | Bacteria | 3063 |
| 695 | Ga0501068_0002506 | 3300049584 | Bacteria | 9753 |
| 696 | Ga0501068_0038218 | 3300049584 | Bacteria | 2875 |
| 697 | Ga0501070_0059597 | 3300049586 | Bacteria | 3164 |
| 698 | Ga0501070_0152036 | 3300049586 | Bacteria | 1910 |
| 699 | Ga0501071_0025739 | 3300049587 | Bacteria | 4123 |
| 700 | Ga0501071_0152743 | 3300049587 | Bacteria | 1723 |
| 701 | Ga0501071_0295264 | 3300049587 | Bacteria | 1228 |
| 702 | Ga0501071_0412368 | 3300049587 | Bacteria | 1032 |
| 703 | Ga0501072_0009547 | 3300049588 | Bacteria | 7378 |
| 704 | Ga0501072_0012316 | 3300049588 | Bacteria | 6536 |
| 705 | Ga0501072_0016364 | 3300049588 | Bacteria | 5692 |
| 706 | Ga0501072_0074329 | 3300049588 | Bacteria | 2687 |
| 707 | Ga0501072_0311596 | 3300049588 | Bacteria | 1251 |
| 708 | Ga0501073_0000008 | 3300049589 | Bacteria | 204458 |
| 709 | Ga0501073_0016295 | 3300049589 | Bacteria | 5385 |
| 710 | Ga0501074_0049875 | 3300049590 | Bacteria | 3022 |
| 711 | Ga0501074_0172885 | 3300049590 | Bacteria | 1542 |
| 712 | Ga0501075_0004641 | 3300049591 | Bacteria | 9323 |
| 713 | Ga0501075_0113816 | 3300049591 | Bacteria | 2057 |
| 714 | Ga0501076_0082886 | 3300049592 | Bacteria | 2575 |
| 715 | Ga0501077_0000029 | 3300049593 | Bacteria | 72357 |
| 716 | Ga0501077_0052930 | 3300049593 | Bacteria | 2577 |
| 717 | Ga0501079_0105952 | 3300049741 | Bacteria | 2182 |
| 718 | Ga0501080_0003545 | 3300049742 | Bacteria | 13752 |
| 719 | Ga0501080_0066796 | 3300049742 | Bacteria | 3344 |
| 720 | Ga0501080_0099380 | 3300049742 | Bacteria | 2700 |
| 721 | Ga0501083_0180738 | 3300049744 | Bacteria | 1377 |
| 722 | Ga0501035_0016275 | 3300049822 | Bacteria | 6861 |
| 723 | Ga0501035_0040539 | 3300049822 | Bacteria | 4207 |
| 724 | Ga0501035_0047769 | 3300049822 | Bacteria | 3841 |
| 725 | Ga0501035_0120690 | 3300049822 | Bacteria | 2292 |
| 726 | Ga0501035_0133541 | 3300049822 | Bacteria | 2162 |
| 727 | Ga0501035_0369271 | 3300049822 | Bacteria | 1198 |
| 728 | Ga0501044_0000878 | 3300049823 | Bacteria | 36229 |
| 729 | Ga0501044_0000909 | 3300049823 | Bacteria | 35611 |
| 730 | Ga0501044_0003119 | 3300049823 | Bacteria | 18782 |
| 731 | Ga0501044_0013327 | 3300049823 | Bacteria | 8898 |
| 732 | Ga0501044_0023625 | 3300049823 | Bacteria | 6536 |
| 733 | Ga0501044_0045140 | 3300049823 | Bacteria | 4569 |
| 734 | Ga0501044_0419977 | 3300049823 | Bacteria | 1247 |
| 735 | nmdc:mga00v17_1417_c2 | 3300050491 | Bacteria | 1783 |
| 736 | nmdc:mga0k408_21017_c1 | 3300050493 | Bacteria | 3663 |
| 737 | nmdc:mga06z11_58424_c1 | 3300050494 | Bacteria | 2001 |
| 738 | nmdc:mga07m45_2901_c1 | 3300050496 | Bacteria | 8127 |
| 739 | nmdc:mga07m45_32145_c1 | 3300050496 | Bacteria | 2910 |
| 740 | nmdc:mga05p37_67713_c1 | 3300050507 | Bacteria | 4392 |
| 741 | nmdc:mga09592_133425_c1 | 3300050508 | Bacteria | 2138 |
| 742 | nmdc:mga0qj67_123304_c1 | 3300050509 | Bacteria | 2096 |
| 743 | nmdc:mga0qj67_37_c1 | 3300050509 | Bacteria | 92978 |
| 744 | nmdc:mga0qj67_43465_c1 | 3300050509 | Bacteria | 3538 |
| 745 | nmdc:mga08y16_267194_c1 | 3300050511 | Bacteria | 1766 |
| 746 | nmdc:mga08y16_282679_c1 | 3300050511 | Bacteria | 1711 |
| 747 | nmdc:mga08y16_290251_c1 | 3300050511 | Bacteria | 1686 |
| 748 | nmdc:mga0rr50_530496_c1 | 3300050513 | Bacteria | 1002 |
| 749 | nmdc:mga0rr50_65508_c1 | 3300050513 | Bacteria | 2752 |
| 750 | nmdc:mga08x19_50883_c1 | 3300050514 | Bacteria | 2659 |
| 751 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 752 | nmdc:mga0a205_22285_c2 | 3300050515 | Bacteria | 5408 |
| 753 | nmdc:mga0a205_370820_c1 | 3300050515 | Bacteria | 1297 |
| 754 | nmdc:mga0a205_399441_c1 | 3300050515 | Bacteria | 1238 |
| 755 | Ga0495601_0002074 | 3300053077 | Bacteria | 11250 |
| 756 | Ga0495601_0013016 | 3300053077 | Bacteria | 4998 |
| 757 | Ga0495601_0021475 | 3300053077 | Bacteria | 3954 |
| 758 | Ga0495601_0028607 | 3300053077 | Bacteria | 3452 |
| 759 | Ga0495601_0029696 | 3300053077 | Bacteria | 3393 |
| 760 | Ga0495612_0000056 | 3300053078 | Bacteria | 50144 |
| 761 | Ga0495612_0107197 | 3300053078 | Bacteria | 1193 |
| 762 | Ga0495655_0013964 | 3300053083 | Bacteria | 1674 |
| 763 | Ga0495595_0001109 | 3300053084 | Bacteria | 10439 |
| 764 | Ga0495595_0167969 | 3300053084 | Bacteria | 1085 |
| 765 | Ga0495619_0002023 | 3300053085 | Bacteria | 13480 |
| 766 | Ga0495619_0037801 | 3300053085 | Bacteria | 3148 |
| 767 | Ga0495619_0135813 | 3300053085 | Bacteria | 1692 |
| 768 | Ga0500651_0236583 | 3300053093 | Bacteria | 1066 |
| 769 | Ga0500566_0020100 | 3300053094 | Bacteria | 3923 |
| 770 | Ga0500641_0009037 | 3300053096 | Bacteria | 3574 |
| 771 | Ga0500555_007355 | 3300053103 | Bacteria | 3128 |
| 772 | Ga0500556_0002668 | 3300053104 | Bacteria | 5560 |
| 773 | Ga0500562_000897 | 3300053108 | Bacteria | 7240 |
| 774 | Ga0500562_006617 | 3300053108 | Bacteria | 2920 |
| 775 | Ga0500569_001333 | 3300053109 | Bacteria | 4624 |
| 776 | Ga0500572_001806 | 3300053111 | Bacteria | 5478 |
| 777 | Ga0500593_000044 | 3300053117 | Bacteria | 45032 |
| 778 | Ga0500595_007231 | 3300053119 | Bacteria | 4620 |
| 779 | Ga0500595_031275 | 3300053119 | Bacteria | 1787 |
| 780 | Ga0500608_000842 | 3300053122 | Bacteria | 11112 |
| 781 | Ga0500614_002256 | 3300053123 | Bacteria | 4345 |
| 782 | Ga0500642_0073828 | 3300053130 | Bacteria | 1556 |
| 783 | Ga0500652_079690 | 3300053131 | Bacteria | 1363 |
| 784 | Ga0500559_0000018 | 3300053136 | Bacteria | 140924 |
| 785 | Ga0500559_0022529 | 3300053136 | Bacteria | 2671 |
| 786 | Ga0500559_0048026 | 3300053136 | Bacteria | 1876 |
| 787 | Ga0500564_088486 | 3300053138 | Bacteria | 1381 |
| 788 | Ga0500568_0000004 | 3300053139 | Bacteria | 621666 |
| 789 | Ga0500590_006787 | 3300053148 | Bacteria | 5603 |
| 790 | Ga0500616_0061973 | 3300053153 | Bacteria | 1934 |
| 791 | Ga0500616_0062741 | 3300053153 | Bacteria | 1919 |
| 792 | Ga0500616_0076722 | 3300053153 | Bacteria | 1689 |
| 793 | Ga0500637_0018468 | 3300053178 | Bacteria | 3747 |
| 794 | Ga0500625_021470 | 3300053729 | Bacteria | 3044 |
| 795 | Ga0500645_003850 | 3300053730 | Bacteria | 5943 |
| 796 | Ga0500645_004813 | 3300053730 | Bacteria | 5098 |
| 797 | Ga0500596_000126 | 3300053735 | Bacteria | 11116 |
| 798 | Ga0501084_0030700 | 3300054114 | Bacteria | 4493 |
| 799 | Ga0501084_0333050 | 3300054114 | Bacteria | 1282 |
| 800 | Ga0501082_0000010 | 3300060353 | Bacteria | 122899 |
| 801 | Ga0501082_0025840 | 3300060353 | Bacteria | 5062 |
| 802 | Ga0501082_0078903 | 3300060353 | Bacteria | 2840 |
| 803 | Ga0501082_0252343 | 3300060353 | Bacteria | 1535 |
| 804 | Ga0501082_0255467 | 3300060353 | Bacteria | 1525 |
| 805 | Ga0501082_0501680 | 3300060353 | Bacteria | 1061 |
| 806 | Ga0501082_0564916 | 3300060353 | Bacteria | 995 |
| 807 | Ga0530510_0017181 | 3300061734 | Bacteria | 5125 |
| 808 | Ga0530510_0278041 | 3300061734 | Bacteria | 1250 |
| 809 | 2513591971 | 2513237087 | Bacteria | 5817514 |
| 810 | 2644000603 | 2643221598 | Bacteria | 4578346 |
| 811 | 2644088442 | 2643221614 | Bacteria | 4260023 |
| 812 | 2644290707 | 2643221651 | Bacteria | 4798932 |
| 813 | 2644343678 | 2643221661 | Bacteria | 4267604 |
| 814 | 2644368844 | 2643221666 | Bacteria | 4265935 |
| 815 | 2739309828 | 2738543024 | Bacteria | 5603683 |
| 816 | 2828306277 | 2828305725 | Bacteria | 4916900 |
| 817 | 2842700104 | 2842698319 | Bacteria | 5190321 |
| 818 | 2889793154 | 2889790730 | Bacteria | 5689708 |
| 819 | 2889917614 | 2889914905 | Bacteria | 5702301 |
| 820 | 2894818500 | 2894817345 | Bacteria | 4892941 |
| 821 | 3005483508 | 3005474847 | Bacteria | 9259049 |
| 822 | Ga0496109_0072420 | |||
| 823 | JGI25406J46586_10013258 | |||
| 824 | Ga0055530_10005059 | |||
| 825 | Ga0055531_10004151 | |||
| 826 | Ga0065165_1002581 | |||
| 827 | Ga0070658_10013925 | |||
| 828 | Ga0070658_10028776 | |||
| 829 | Ga0070676_10030532 | |||
| 830 | Ga0070676_10105361 | |||
| 831 | Ga0070690_100003947 | |||
| 832 | Ga0070670_100000044 | |||
| 833 | Ga0070670_100095221 | |||
| 834 | Ga0070670_100325084 | |||
| 835 | Ga0070677_10022151 | |||
| 836 | Ga0068869_100007205 | |||
| 837 | Ga0070666_10034231 | |||
| 838 | Ga0070666_10090300 | |||
| 839 | Ga0070666_10230191 | |||
| 840 | Ga0070680_100006085 | |||
| 841 | Ga0070680_100161079 | |||
| 842 | Ga0070682_100031416 | |||
| 843 | Ga0068868_100089101 | |||
| 844 | Ga0068868_100132083 | |||
| 845 | Ga0070660_100035420 | |||
| 846 | Ga0070660_100113000 | |||
| 847 | Ga0070660_100217064 | |||
| 848 | Ga0070689_100006271 | |||
| 849 | Ga0070691_10010903 | |||
| 850 | Ga0070661_100001446 | |||
| 851 | Ga0070668_100000098 | |||
| 852 | Ga0070668_100002191 | |||
| 853 | Ga0070668_100015032 | |||
| 854 | Ga0070669_100004579 | |||
| 855 | Ga0070669_100155405 | |||
| 856 | Ga0070675_100257155 | |||
| 857 | Ga0070671_100000497 | |||
| 858 | Ga0070671_100012906 | |||
| 859 | Ga0070671_100017745 | |||
| 860 | Ga0070671_100036146 | |||
| 861 | Ga0070671_100054333 | |||
| 862 | Ga0070674_100002246 | |||
| 863 | Ga0070674_100110818 | |||
| 864 | Ga0070673_100001599 | |||
| 865 | Ga0070673_100026478 | |||
| 866 | Ga0070673_100089597 | |||
| 867 | Ga0070688_100007704 | |||
| 868 | Ga0070659_100002646 | |||
| 869 | Ga0070659_100010511 | |||
| 870 | Ga0070659_100019787 | |||
| 871 | Ga0070659_100055064 | |||
| 872 | Ga0070667_100003729 | |||
| 873 | Ga0070667_100004554 | |||
| 874 | Ga0070667_100008872 | |||
| 875 | Ga0070667_100016357 | |||
| 876 | Ga0070667_100034910 | |||
| 877 | Ga0070667_100036831 | |||
| 878 | Ga0070709_10003085 | |||
| 879 | Ga0070709_10138429 | |||
| 880 | Ga0070714_100059095 | |||
| 881 | Ga0070714_100252853 | |||
| 882 | Ga0070713_100034420 | |||
| 883 | Ga0070710_10004649 | |||
| 884 | Ga0070710_10054482 | |||
| 885 | Ga0070710_10106608 | |||
| 886 | Ga0070711_100132115 | |||
| 887 | Ga0070711_100141020 | |||
| 888 | Ga0070705_100064068 | |||
| 889 | Ga0070694_100168184 | |||
| 890 | Ga0070663_100019491 | |||
| 891 | Ga0070662_100081004 | |||
| 892 | Ga0070662_100145530 | |||
| 893 | Ga0070681_10012011 | |||
| 894 | Ga0070681_10017074 | |||
| 895 | Ga0070681_10104661 | |||
| 896 | Ga0068867_100008051 | |||
| 897 | Ga0068867_100023806 | |||
| 898 | Ga0070685_10057576 | |||
| 899 | Ga0070698_100073412 | |||
| 900 | Ga0070679_100006711 | |||
| 901 | Ga0070679_100016884 | |||
| 902 | Ga0070679_100032803 | |||
| 903 | Ga0070679_100073782 | |||
| 904 | Ga0070697_100017315 | |||
| 905 | Ga0068853_100004404 | |||
| 906 | Ga0068853_100061818 | |||
| 907 | Ga0070686_100070111 | |||
| 908 | Ga0070686_100107982 | |||
| 909 | Ga0070696_100004697 | |||
| 910 | Ga0070665_100000762 | |||
| 911 | Ga0070665_100000831 | |||
| 912 | Ga0070665_100002025 | |||
| 913 | Ga0070665_100256952 | |||
| 914 | Ga0070665_100482311 | |||
| 915 | Ga0070704_100227710 | |||
| 916 | Ga0068855_100040248 | |||
| 917 | Ga0068855_100042296 | |||
| 918 | Ga0068855_100074441 | |||
| 919 | Ga0068855_100172155 | |||
| 920 | Ga0068855_100205087 | |||
| 921 | Ga0068855_100317984 | |||
| 922 | Ga0068857_100101957 | |||
| 923 | Ga0068857_100184468 | |||
| 924 | Ga0068854_100007798 | |||
| 925 | Ga0068854_100122136 | |||
| 926 | Ga0068856_100024803 | |||
| 927 | Ga0068856_100256483 | |||
| 928 | Ga0068852_100009678 | |||
| 929 | Ga0068852_100015002 | |||
| 930 | Ga0068852_100067226 | |||
| 931 | Ga0068859_100000231 | |||
| 932 | Ga0068859_100007203 | |||
| 933 | Ga0068864_100000060 | |||
| 934 | Ga0068864_100000061 | |||
| 935 | Ga0068864_100015964 | |||
| 936 | Ga0068864_100024083 | |||
| 937 | Ga0068864_100066194 | |||
| 938 | Ga0068861_100017580 | |||
| 939 | Ga0068861_100422864 | |||
| 940 | Ga0068851_10001676 | |||
| 941 | Ga0068863_100000023 | |||
| 942 | Ga0068863_100000810 | |||
| 943 | Ga0068863_100006931 | |||
| 944 | Ga0068863_100377190 | |||
| 945 | Ga0068858_100000184 | |||
| 946 | Ga0068858_100003504 | |||
| 947 | Ga0068858_100004308 | |||
| 948 | Ga0068858_100023690 | |||
| 949 | Ga0068858_100136549 | |||
| 950 | Ga0068860_100000100 | |||
| 951 | Ga0068860_100000122 | |||
| 952 | Ga0068860_100004300 | |||
| 953 | Ga0068862_100006370 | |||
| 954 | Ga0068862_100097668 | |||
| 955 | Ga0068862_100287207 | |||
| 956 | Ga0081455_10122481 | |||
| 957 | Ga0081455_10182224 | |||
| 958 | Ga0081538_10019682 | |||
| 959 | Ga0081540_1000005 | |||
| 960 | Ga0081539_10001341 | |||
| 961 | Ga0070717_10010974 | |||
| 962 | Ga0070717_10114965 | |||
| 963 | Ga0075365_10012223 | |||
| 964 | Ga0075365_10105027 | |||
| 965 | Ga0075368_10013467 | |||
| 966 | Ga0075363_100102279 | |||
| 967 | Ga0075364_10000160 | |||
| 968 | Ga0070715_10005056 | |||
| 969 | Ga0070716_100032077 | |||
| 970 | Ga0070712_100033651 | |||
| 971 | Ga0070712_100046978 | |||
| 972 | Ga0070712_100124392 | |||
| 973 | Ga0075367_10043383 | |||
| 974 | Ga0075366_10001106 | |||
| 975 | Ga0097621_100135651 | |||
| 976 | Ga0075370_10054187 | |||
| 977 | Ga0068871_100131098 | |||
| 978 | Ga0068871_100153079 | |||
| 979 | Ga0075430_100001664 | |||
| 980 | Ga0075430_100036710 | |||
| 981 | Ga0075430_100045419 | |||
| 982 | Ga0075430_100060215 | |||
| 983 | Ga0075431_100206111 | |||
| 984 | Ga0075433_10036706 | |||
| 985 | Ga0075434_100054347 | |||
| 986 | Ga0075429_100002435 | |||
| 987 | Ga0068865_100002419 | |||
| 988 | Ga0068865_100137080 | |||
| 989 | Ga0068865_100300974 | |||
| 990 | Ga0075436_100010291 | |||
| 991 | Ga0075436_100044482 | |||
| 992 | Ga0097620_100000231 | |||
| 993 | Ga0097620_100007203 | |||
| 994 | Ga0075435_100192276 | |||
| 995 | Ga0099795_10013325 | |||
| 996 | Ga0105240_10002285 | |||
| 997 | Ga0105240_10027302 | |||
| 998 | Ga0105240_10161862 | |||
| 999 | Ga0105240_10197701 | |||
| 1000 | Ga0105240_10217886 | |||
| 1001 | Ga0111539_10019416 | |||
| 1002 | Ga0111539_10176877 | |||
| 1003 | Ga0111539_10321187 | |||
| 1004 | Ga0105245_10050003 | |||
| 1005 | Ga0105247_10074349 | |||
| 1006 | Ga0105247_10136678 | |||
| 1007 | Ga0114129_10055349 | |||
| 1008 | Ga0105241_10032577 | |||
| 1009 | Ga0105248_10000279 | |||
| 1010 | Ga0105248_10015107 | |||
| 1011 | Ga0105248_10016683 | |||
| 1012 | Ga0105248_10016737 | |||
| 1013 | Ga0105248_10200674 | |||
| 1014 | Ga0105237_10369440 | |||
| 1015 | Ga0105238_10027382 | |||
| 1016 | Ga0105238_10048775 | |||
| 1017 | Ga0105238_10132158 | |||
| 1018 | Ga0105249_10014102 | |||
| 1019 | Ga0105249_10236807 | |||
| 1020 | Ga0099796_10001765 | |||
| 1021 | Ga0099796_10004606 | |||
| 1022 | Ga0105239_10013959 | |||
| 1023 | Ga0105239_10065192 | |||
| 1024 | Ga0105239_10080254 | |||
| 1025 | Ga0105239_10122138 | |||
| 1026 | Ga0157373_10031787 | |||
| 1027 | Ga0157371_10014768 | |||
| 1028 | Ga0157371_10115583 | |||
| 1029 | Ga0157370_10003380 | |||
| 1030 | Ga0157370_10029718 | |||
| 1031 | Ga0157370_10084836 | |||
| 1032 | Ga0157370_10160586 | |||
| 1033 | Ga0157369_10108496 | |||
| 1034 | Ga0163162_10088453 | |||
| 1035 | Ga0163162_10226846 | |||
| 1036 | Ga0163162_10338267 | |||
| 1037 | Ga0157372_10027766 | |||
| 1038 | Ga0157372_10032887 | |||
| 1039 | Ga0157375_10098846 | |||
| 1040 | Ga0163163_10043821 | |||
| 1041 | Ga0163163_10133829 | |||
| 1042 | Ga0163163_10304061 | |||
| 1043 | Ga0157380_10229057 | |||
| 1044 | Ga0157380_10238135 | |||
| 1045 | Ga0157380_10388431 | |||
| 1046 | Ga0157379_10012083 | |||
| 1047 | Ga0157379_10111262 | |||
| 1048 | Ga0163161_10120616 | |||
| 1049 | Ga0213874_10013464 | |||
| 1050 | Ga0213876_10019673 | |||
| 1051 | Ga0209026_1005312 | |||
| 1052 | Ga0209026_1009377 | |||
| 1053 | Ga0209148_1001435 | |||
| 1054 | Ga0209148_1002626 | |||
| 1055 | Ga0209758_1000430 | |||
| 1056 | Ga0209758_1001067 | |||
| 1057 | Ga0209050_1000098 | |||
| 1058 | Ga0209257_1000221 | |||
| 1059 | Ga0209257_1004498 | |||
| 1060 | Ga0207656_10011311 | |||
| 1061 | Ga0207682_10003834 | |||
| 1062 | Ga0207680_10030166 | |||
| 1063 | Ga0207680_10030196 | |||
| 1064 | Ga0207647_10241102 | |||
| 1065 | Ga0207645_10004551 | |||
| 1066 | Ga0207645_10037006 | |||
| 1067 | Ga0207645_10101160 | |||
| 1068 | Ga0207643_10121081 | |||
| 1069 | Ga0207705_10003181 | |||
| 1070 | Ga0207705_10003909 | |||
| 1071 | Ga0207654_10015995 | |||
| 1072 | Ga0207654_10177629 | |||
| 1073 | Ga0207707_10025158 | |||
| 1074 | Ga0207707_10030967 | |||
| 1075 | Ga0207707_10083476 | |||
| 1076 | Ga0207707_10321714 | |||
| 1077 | Ga0207695_10002540 | |||
| 1078 | Ga0207695_10004869 | |||
| 1079 | Ga0207695_10026041 | |||
| 1080 | Ga0207695_10096452 | |||
| 1081 | Ga0207695_10337110 | |||
| 1082 | Ga0207671_10438277 | |||
| 1083 | Ga0207693_10000787 | |||
| 1084 | Ga0207693_10014625 | |||
| 1085 | Ga0207693_10059645 | |||
| 1086 | Ga0207693_10085389 | |||
| 1087 | Ga0207693_10088252 | |||
| 1088 | Ga0207663_10154644 | |||
| 1089 | Ga0207660_10014784 | |||
| 1090 | Ga0207660_10028003 | |||
| 1091 | Ga0207662_10102755 | |||
| 1092 | Ga0207657_10003993 | |||
| 1093 | Ga0207657_10074018 | |||
| 1094 | Ga0207657_10083000 | |||
| 1095 | Ga0207657_10094864 | |||
| 1096 | Ga0207649_10024458 | |||
| 1097 | Ga0207652_10004635 | |||
| 1098 | Ga0207652_10025068 | |||
| 1099 | Ga0207652_10045774 | |||
| 1100 | Ga0207652_10307230 | |||
| 1101 | Ga0207681_10001188 | |||
| 1102 | Ga0207681_10095626 | |||
| 1103 | Ga0207694_10034155 | |||
| 1104 | Ga0207694_10067466 | |||
| 1105 | Ga0207694_10130110 | |||
| 1106 | Ga0207694_10193380 | |||
| 1107 | Ga0207650_10000065 | |||
| 1108 | Ga0207650_10064096 | |||
| 1109 | Ga0207650_10073794 | |||
| 1110 | Ga0207650_10193941 | |||
| 1111 | Ga0207687_10089476 | |||
| 1112 | Ga0207687_10174718 | |||
| 1113 | Ga0207700_10006999 | |||
| 1114 | Ga0207700_10025273 | |||
| 1115 | Ga0207664_10070244 | |||
| 1116 | Ga0207664_10139282 | |||
| 1117 | Ga0207644_10002707 | |||
| 1118 | Ga0207644_10006071 | |||
| 1119 | Ga0207644_10182604 | |||
| 1120 | Ga0207690_10001133 | |||
| 1121 | Ga0207690_10036533 | |||
| 1122 | Ga0207690_10050959 | |||
| 1123 | Ga0207706_10083773 | |||
| 1124 | Ga0207706_10091402 | |||
| 1125 | Ga0207706_10123983 | |||
| 1126 | Ga0207706_10126882 | |||
| 1127 | Ga0207709_10226556 | |||
| 1128 | Ga0207670_10004720 | |||
| 1129 | Ga0207670_10006011 | |||
| 1130 | Ga0207670_10124316 | |||
| 1131 | Ga0207669_10001250 | |||
| 1132 | Ga0207704_10008976 | |||
| 1133 | Ga0207665_10000117 | |||
| 1134 | Ga0207691_10004922 | |||
| 1135 | Ga0207711_10000684 | |||
| 1136 | Ga0207711_10005226 | |||
| 1137 | Ga0207711_10009716 | |||
| 1138 | Ga0207711_10095145 | |||
| 1139 | Ga0207689_10107370 | |||
| 1140 | Ga0207679_10396633 | |||
| 1141 | Ga0207667_10033644 | |||
| 1142 | Ga0207667_10038111 | |||
| 1143 | Ga0207667_10050024 | |||
| 1144 | Ga0207667_10091205 | |||
| 1145 | Ga0207667_10149280 | |||
| 1146 | Ga0207651_10027327 | |||
| 1147 | Ga0207651_10251546 | |||
| 1148 | Ga0207712_10012792 | |||
| 1149 | Ga0207668_10000018 | |||
| 1150 | Ga0207668_10000340 | |||
| 1151 | Ga0207668_10002444 | |||
| 1152 | Ga0207668_10008059 | |||
| 1153 | Ga0207668_10030812 | |||
| 1154 | Ga0207640_10029818 | |||
| 1155 | Ga0207640_10097395 | |||
| 1156 | Ga0207640_10102027 | |||
| 1157 | Ga0207640_10105606 | |||
| 1158 | Ga0207658_10000168 | |||
| 1159 | Ga0207658_10003273 | |||
| 1160 | Ga0207658_10011028 | |||
| 1161 | Ga0207658_10095180 | |||
| 1162 | Ga0207658_10107507 | |||
| 1163 | Ga0207677_10092168 | |||
| 1164 | Ga0207703_10000273 | |||
| 1165 | Ga0207703_10003313 | |||
| 1166 | Ga0207703_10007240 | |||
| 1167 | Ga0207703_10069866 | |||
| 1168 | Ga0207703_10166334 | |||
| 1169 | Ga0207703_10483466 | |||
| 1170 | Ga0207639_10005874 | |||
| 1171 | Ga0207639_10025958 | |||
| 1172 | Ga0207678_10007031 | |||
| 1173 | Ga0207678_10278501 | |||
| 1174 | Ga0207678_10392079 | |||
| 1175 | Ga0207708_10220677 | |||
| 1176 | Ga0207702_10028812 | |||
| 1177 | Ga0207702_10063897 | |||
| 1178 | Ga0207702_10226237 | |||
| 1179 | Ga0207702_10304951 | |||
| 1180 | Ga0207641_10000067 | |||
| 1181 | Ga0207641_10001551 | |||
| 1182 | Ga0207641_10011364 | |||
| 1183 | Ga0207641_10022554 | |||
| 1184 | Ga0207641_10326215 | |||
| 1185 | Ga0207648_10002948 | |||
| 1186 | Ga0207648_10033201 | |||
| 1187 | Ga0207676_10000127 | |||
| 1188 | Ga0207676_10000501 | |||
| 1189 | Ga0207676_10011585 | |||
| 1190 | Ga0207676_10011837 | |||
| 1191 | Ga0207674_10029426 | |||
| 1192 | Ga0207674_10169699 | |||
| 1193 | Ga0207674_10211175 | |||
| 1194 | Ga0207675_100510238 | |||
| 1195 | Ga0207683_10037355 | |||
| 1196 | Ga0207698_10070871 | |||
| 1197 | Ga0207698_10301594 | |||
| 1198 | Ga0209981_1000385 | |||
| 1199 | Ga0209179_1000737 | |||
| 1200 | Ga0209999_1006024 | |||
| 1201 | Ga0209813_10001517 | |||
| 1202 | Ga0207428_10130483 | |||
| 1203 | Ga0268266_10000003 | |||
| 1204 | Ga0268266_10007459 | |||
| 1205 | Ga0268266_10008942 | |||
| 1206 | Ga0268266_10051971 | |||
| 1207 | Ga0268266_10060923 | |||
| 1208 | Ga0268265_10001199 | |||
| 1209 | Ga0268265_10002874 | |||
| 1210 | Ga0268265_10088418 | |||
| 1211 | Ga0268265_10157050 | |||
| 1212 | Ga0268265_10280705 | |||
| 1213 | Ga0268264_10000002 | |||
| 1214 | Ga0268264_10000172 | |||
| 1215 | Ga0268264_10140577 | |||
| 1216 | Ga0307517_10001099 | |||
| 1217 | Ga0307517_10017425 | |||
| 1218 | Ga0265338_10013082 | |||
| 1219 | Ga0265338_10033080 | |||
| 1220 | Ga0307511_10042056 | |||
| 1221 | Ga0265332_10025083 | |||
| 1222 | Ga0265325_10001782 | |||
| 1223 | Ga0265325_10010617 | |||
| 1224 | Ga0265325_10123382 | |||
| 1225 | Ga0265340_10017200 | |||
| 1226 | Ga0265340_10017957 | |||
| 1227 | Ga0265339_10000101 | |||
| 1228 | Ga0265327_10110094 | |||
| 1229 | Ga0307513_10003813 | |||
| 1230 | Ga0307513_10007922 | |||
| 1231 | Ga0307513_10015171 | |||
| 1232 | Ga0307513_10138070 | |||
| 1233 | Ga0265313_10000548 | |||
| 1234 | Ga0265313_10063649 | |||
| 1235 | Ga0316579_10000778 | |||
| 1236 | Ga0307516_10000020 | |||
| 1237 | Ga0307416_100288231 | |||
| 1238 | Ga0307510_10013355 | |||
| 1239 | Ga0373926_0025167 | |||
| 1240 | Ga0373929_0006916 | |||
| 1241 | Ga0373944_0002067 | |||
| 1242 | Ga0373944_0013160 | |||
| 1243 | Ga0373952_0031570 | |||
| 1244 | Ga0373952_0032546 | |||
| 1245 | Ga0373923_0095981 | |||
| 1246 | Ga0373936_0020232 | |||
| 1247 | Ga0373945_0032897 | |||
| 1248 | Ga0373954_0008692 | |||
| 1249 | Ga0373954_0018837 | |||
| 1250 | Ga0373954_0072032 | |||
| 1251 | Ga0373957_0042446 | |||
| 1252 | Ga0373943_0001239 | |||
| 1253 | Ga0373943_0036272 | |||
| 1254 | Ga0373946_0000841 | |||
| 1255 | Ga0373946_0034936 | |||
| 1256 | Ga0373946_0108442 | |||
| 1257 | Ga0373955_0002732 | |||
| 1258 | Ga0373924_0016745 | |||
| 1259 | Ga0373931_0007577 | |||
| 1260 | Ga0373931_0015115 | |||
| 1261 | Ga0373935_0014244 | |||
| 1262 | Ga0373935_0026355 | |||
| 1263 | Ga0373935_0065547 | |||
| 1264 | Ga0373935_0211620 | |||
| 1265 | Ga0373927_0001609 | |||
| 1266 | Ga0373927_0002779 | |||
| 1267 | Ga0373927_0012344 | |||
| 1268 | Ga0373927_0024145 | |||
| 1269 | Ga0373927_0202531 | |||
| 1270 | Ga0373933_0001709 | |||
| 1271 | Ga0373933_0028734 | |||
| 1272 | Ga0373947_0001204 | |||
| 1273 | Ga0373947_0084188 | |||
| 1274 | Ga0373937_0000959 | |||
| 1275 | Ga0373937_0009056 | |||
| 1276 | Ga0373937_0145612 | |||
| 1277 | Ga0373937_0408257 | |||
| 1278 | Ga0373937_0431506 | |||
| 1279 | Ga0373937_0526406 | |||
| 1280 | Ga0373925_0000277 | |||
| 1281 | Ga0373925_0007493 | |||
| 1282 | Ga0373925_0011790 | |||
| 1283 | Ga0373925_0032343 | |||
| 1284 | Ga0373925_0126825 | |||
| 1285 | Ga0395899_0000847 | |||
| 1286 | Ga0395899_0272677 | |||
| 1287 | Ga0395899_0296182 | |||
| 1288 | Ga0395900_0000016 | |||
| 1289 | Ga0395898_0025733 | |||
| 1290 | Ga0395898_0115706 | |||
| 1291 | Ga0395905_0008634 | |||
| 1292 | Ga0395905_0034525 | |||
| 1293 | Ga0395905_0206247 | |||
| 1294 | Ga0436364_1039680 | |||
| 1295 | Ga0395901_0000028 | |||
| 1296 | Ga0395901_0067598 | |||
| 1297 | Ga0400483_185390 | |||
| 1298 | Ga0436365_0392568 | |||
| 1299 | Ga0436365_0513635 | |||
| 1300 | Ga0436365_0996971 | |||
| 1301 | Ga0436365_1199935 | |||
| 1302 | Ga0436365_1750823 | |||
| 1303 | Ga0436361_0115059 | |||
| 1304 | Ga0436363_0093454 | |||
| 1305 | Ga0439448_0007095 | |||
| 1306 | Ga0439459_0033545 | |||
| 1307 | Ga0450893_0016054 | |||
| 1308 | Ga0451577_0245810 | |||
| 1309 | Ga0439440_0025807 | |||
| 1310 | Ga0466963_0004016 | |||
| 1311 | Ga0466963_0021477 | |||
| 1312 | Ga0466963_0093046 | |||
| 1313 | Ga0466963_0118151 | |||
| 1314 | Ga0453684_0296846 | |||
| 1315 | Ga0466957_0008453 | |||
| 1316 | Ga0451576_0000040 | |||
| 1317 | Ga0466958_0068378 | |||
| 1318 | Ga0466967_0000138 | |||
| 1319 | Ga0466967_0059354 | |||
| 1320 | Ga0495627_000159 | |||
| 1321 | Ga0495592_0022037 | |||
| 1322 | Ga0495629_0003800 | |||
| 1323 | Ga0495629_0056511 | |||
| 1324 | Ga0495629_0105936 | |||
| 1325 | Ga0495629_0171091 | |||
| 1326 | Ga0495638_0148328 | |||
| 1327 | Ga0495651_0002695 | |||
| 1328 | Ga0495651_0024559 | |||
| 1329 | Ga0495653_0001872 | |||
| 1330 | Ga0495653_0110753 | |||
| 1331 | Ga0495639_0122245 | |||
| 1332 | Ga0495662_0009056 | |||
| 1333 | Ga0495664_0000631 | |||
| 1334 | Ga0495664_0078913 | |||
| 1335 | Ga0495664_0112334 | |||
| 1336 | Ga0495594_0159559 | |||
| 1337 | Ga0495583_0028737 | |||
| 1338 | Ga0495608_0007164 | |||
| 1339 | Ga0495608_0026684 | |||
| 1340 | Ga0495618_0001463 | |||
| 1341 | Ga0495620_0010489 | |||
| 1342 | Ga0495628_0007565 | |||
| 1343 | Ga0495628_0285800 | |||
| 1344 | Ga0495630_0013814 | |||
| 1345 | Ga0495630_0034773 | |||
| 1346 | Ga0495630_0128850 | |||
| 1347 | Ga0495630_0182916 | |||
| 1348 | Ga0495643_0126022 | |||
| 1349 | Ga0495663_0033621 | |||
| 1350 | Ga0495642_0001670 | |||
| 1351 | Ga0495642_0046681 | |||
| 1352 | Ga0495652_0012913 | |||
| 1353 | Ga0495652_0049311 | |||
| 1354 | Ga0495665_0007546 | |||
| 1355 | Ga0495665_0057883 | |||
| 1356 | Ga0495640_0000714 | |||
| 1357 | Ga0495640_0003726 | |||
| 1358 | Ga0495587_0027422 | |||
| 1359 | Ga0495587_0060555 | |||
| 1360 | Ga0495598_0008478 | |||
| 1361 | Ga0495645_0000575 | |||
| 1362 | Ga0495645_0046048 | |||
| 1363 | Ga0495622_0020935 | |||
| 1364 | Ga0495667_0002333 | |||
| 1365 | Ga0495667_0076143 | |||
| 1366 | Ga0495656_0026349 | |||
| 1367 | Ga0495668_0002197 | |||
| 1368 | Ga0495668_0027431 | |||
| 1369 | Ga0495668_0049763 | |||
| 1370 | Ga0495634_0001265 | |||
| 1371 | Ga0495634_0003291 | |||
| 1372 | Ga0495634_0009075 | |||
| 1373 | Ga0495634_0160514 | |||
| 1374 | Ga0495611_0007425 | |||
| 1375 | Ga0495625_0088184 | |||
| 1376 | Ga0495635_0000771 | |||
| 1377 | Ga0495635_0000918 | |||
| 1378 | Ga0495635_0118280 | |||
| 1379 | Ga0495635_0153149 | |||
| 1380 | Ga0495588_0211367 | |||
| 1381 | Ga0495657_0027157 | |||
| 1382 | Ga0495657_0187290 | |||
| 1383 | Ga0495623_0003265 | |||
| 1384 | Ga0495623_0012214 | |||
| 1385 | Ga0495658_0009500 | |||
| 1386 | Ga0495658_0121214 | |||
| 1387 | Ga0495669_0000005 | |||
| 1388 | Ga0495669_0000356 | |||
| 1389 | Ga0495669_0010448 | |||
| 1390 | Ga0495669_0029323 | |||
| 1391 | Ga0495613_0042399 | |||
| 1392 | Ga0495613_0053034 | |||
| 1393 | Ga0495613_0091514 | |||
| 1394 | Ga0495624_0012655 | |||
| 1395 | Ga0495600_0001241 | |||
| 1396 | Ga0495604_0000130 | |||
| 1397 | Ga0495604_0037116 | |||
| 1398 | Ga0495674_0003371 | |||
| 1399 | Ga0495674_0026761 | |||
| 1400 | Ga0495672_0036212 | |||
| 1401 | Ga0495672_0063253 | |||
| 1402 | Ga0495676_0137124 | |||
| 1403 | Ga0495680_0000701 | |||
| 1404 | Ga0495680_0160075 | |||
| 1405 | Ga0495687_041745 | |||
| 1406 | Ga0495675_0023318 | |||
| 1407 | Ga0495675_0054090 | |||
| 1408 | Ga0495677_0002371 | |||
| 1409 | Ga0495685_031603 | |||
| 1410 | Ga0495684_0018296 | |||
| 1411 | Ga0495686_0000134 | |||
| 1412 | Ga0495686_0032777 | |||
| 1413 | Ga0495593_0013246 | |||
| 1414 | Ga0495593_0030305 | |||
| 1415 | Ga0495602_0002441 | |||
| 1416 | Ga0495602_0024309 | |||
| 1417 | Ga0495602_0225080 | |||
| 1418 | Ga0496100_0280250 | |||
| 1419 | Ga0496101_0002031 | |||
| 1420 | Ga0496101_0038096 | |||
| 1421 | Ga0496101_0138270 | |||
| 1422 | Ga0496102_0016745 | |||
| 1423 | Ga0496102_0032897 | |||
| 1424 | Ga0496102_0044054 | |||
| 1425 | Ga0496102_0088304 | |||
| 1426 | Ga0496103_0113617 | |||
| 1427 | Ga0496104_0001419 | |||
| 1428 | Ga0496104_0001499 | |||
| 1429 | Ga0496104_0017387 | |||
| 1430 | Ga0496104_0018342 | |||
| 1431 | Ga0496104_0173445 | |||
| 1432 | Ga0496104_0337094 | |||
| 1433 | Ga0496105_0010619 | |||
| 1434 | Ga0496105_0234953 | |||
| 1435 | Ga0496105_0330342 | |||
| 1436 | Ga0496105_0378385 | |||
| 1437 | Ga0496106_0037312 | |||
| 1438 | Ga0496106_0076746 | |||
| 1439 | Ga0496106_0138851 | |||
| 1440 | Ga0496106_0235231 | |||
| 1441 | Ga0496107_0040633 | |||
| 1442 | Ga0496107_0076366 | |||
| 1443 | Ga0496107_0080448 | |||
| 1444 | Ga0496107_0211959 | |||
| 1445 | Ga0496107_0377632 | |||
| 1446 | Ga0496108_0021301 | |||
| 1447 | Ga0496108_0148022 | |||
| 1448 | Ga0496108_0246113 | |||
| 1449 | Ga0496109_0006507 | |||
| 1450 | Ga0496109_0071276 | |||
| 1451 | Ga0496109_0204285 | |||
| 1452 | Ga0496109_0249034 | |||
| 1453 | Ga0496109_0392421 | |||
| 1454 | Ga0496110_0140811 | |||
| 1455 | Ga0496110_0515042 | |||
| 1456 | Ga0496111_0303478 | |||
| 1457 | Ga0496112_0041029 | |||
| 1458 | Ga0496112_0053208 | |||
| 1459 | Ga0496112_0063830 | |||
| 1460 | Ga0496112_0081641 | |||
| 1461 | Ga0496112_0195406 | |||
| 1462 | Ga0496114_0011438 | |||
| 1463 | Ga0496114_0378072 | |||
| 1464 | Ga0496115_0015358 | |||
| 1465 | Ga0496115_0052116 | |||
| 1466 | Ga0496115_0117746 | |||
| 1467 | Ga0496115_0119661 | |||
| 1468 | Ga0496115_0191835 | |||
| 1469 | Ga0496117_0008365 | |||
| 1470 | Ga0496118_0017509 | |||
| 1471 | Ga0496119_0001362 | |||
| 1472 | Ga0496119_0005397 | |||
| 1473 | Ga0496121_0000053 | |||
| 1474 | Ga0496121_0049046 | |||
| 1475 | Ga0496122_0008006 | |||
| 1476 | Ga0496123_0001238 | |||
| 1477 | Ga0501031_0003183 | |||
| 1478 | Ga0501031_0004683 | |||
| 1479 | Ga0501031_0045743 | |||
| 1480 | Ga0501032_0000278 | |||
| 1481 | Ga0501032_0005549 | |||
| 1482 | Ga0501032_0009956 | |||
| 1483 | Ga0501033_0011636 | |||
| 1484 | Ga0501033_0047650 | |||
| 1485 | Ga0501034_0038681 | |||
| 1486 | Ga0501034_0127301 | |||
| 1487 | Ga0501034_0283865 | |||
| 1488 | Ga0501034_0284199 | |||
| 1489 | Ga0501034_0353913 | |||
| 1490 | Ga0501034_0362196 | |||
| 1491 | Ga0501034_0449579 | |||
| 1492 | Ga0501036_0020497 | |||
| 1493 | Ga0501036_0318641 | |||
| 1494 | Ga0501037_0005407 | |||
| 1495 | Ga0501037_0016422 | |||
| 1496 | Ga0501037_0046733 | |||
| 1497 | Ga0501037_0084701 | |||
| 1498 | Ga0501037_0177063 | |||
| 1499 | Ga0501038_0002487 | |||
| 1500 | Ga0501038_0017203 | |||
| 1501 | Ga0501038_0028216 | |||
| 1502 | Ga0501038_0297076 | |||
| 1503 | Ga0501039_0134505 | |||
| 1504 | Ga0501039_0376353 | |||
| 1505 | Ga0501043_0003959 | |||
| 1506 | Ga0501043_0007512 | |||
| 1507 | Ga0501043_0043780 | |||
| 1508 | Ga0501047_0012392 | |||
| 1509 | Ga0501047_0035166 | |||
| 1510 | Ga0501047_0035960 | |||
| 1511 | Ga0501047_0094898 | |||
| 1512 | Ga0501047_0112023 | |||
| 1513 | Ga0501047_0309809 | |||
| 1514 | Ga0501067_0000691 | |||
| 1515 | Ga0501067_0029083 | |||
| 1516 | Ga0501068_0002506 | |||
| 1517 | Ga0501068_0038218 | |||
| 1518 | Ga0501070_0059597 | |||
| 1519 | Ga0501070_0152036 | |||
| 1520 | Ga0501071_0025739 | |||
| 1521 | Ga0501071_0152743 | |||
| 1522 | Ga0501071_0295264 | |||
| 1523 | Ga0501071_0412368 | |||
| 1524 | Ga0501072_0009547 | |||
| 1525 | Ga0501072_0012316 | |||
| 1526 | Ga0501072_0016364 | |||
| 1527 | Ga0501072_0074329 | |||
| 1528 | Ga0501072_0311596 | |||
| 1529 | Ga0501073_0000008 | |||
| 1530 | Ga0501073_0016295 | |||
| 1531 | Ga0501074_0049875 | |||
| 1532 | Ga0501074_0172885 | |||
| 1533 | Ga0501075_0004641 | |||
| 1534 | Ga0501075_0113816 | |||
| 1535 | Ga0501076_0082886 | |||
| 1536 | Ga0501077_0000029 | |||
| 1537 | Ga0501077_0052930 | |||
| 1538 | Ga0501079_0105952 | |||
| 1539 | Ga0501080_0003545 | |||
| 1540 | Ga0501080_0066796 | |||
| 1541 | Ga0501080_0099380 | |||
| 1542 | Ga0501083_0180738 | |||
| 1543 | Ga0501035_0016275 | |||
| 1544 | Ga0501035_0040539 | |||
| 1545 | Ga0501035_0047769 | |||
| 1546 | Ga0501035_0120690 | |||
| 1547 | Ga0501035_0133541 | |||
| 1548 | Ga0501035_0369271 | |||
| 1549 | Ga0501044_0000878 | |||
| 1550 | Ga0501044_0000909 | |||
| 1551 | Ga0501044_0003119 | |||
| 1552 | Ga0501044_0013327 | |||
| 1553 | Ga0501044_0023625 | |||
| 1554 | Ga0501044_0045140 | |||
| 1555 | Ga0501044_0419977 | |||
| 1556 | nmdc:mga00v17_1417_c2 | |||
| 1557 | nmdc:mga0k408_21017_c1 | |||
| 1558 | nmdc:mga06z11_58424_c1 | |||
| 1559 | nmdc:mga07m45_2901_c1 | |||
| 1560 | nmdc:mga07m45_32145_c1 | |||
| 1561 | nmdc:mga05p37_67713_c1 | |||
| 1562 | nmdc:mga09592_133425_c1 | |||
| 1563 | nmdc:mga0qj67_123304_c1 | |||
| 1564 | nmdc:mga0qj67_37_c1 | |||
| 1565 | nmdc:mga0qj67_43465_c1 | |||
| 1566 | nmdc:mga08y16_267194_c1 | |||
| 1567 | nmdc:mga08y16_282679_c1 | |||
| 1568 | nmdc:mga08y16_290251_c1 | |||
| 1569 | nmdc:mga0rr50_530496_c1 | |||
| 1570 | nmdc:mga0rr50_65508_c1 | |||
| 1571 | nmdc:mga08x19_50883_c1 | |||
| 1572 | nmdc:mga08x19_6_c1 | |||
| 1573 | nmdc:mga0a205_22285_c2 | |||
| 1574 | nmdc:mga0a205_370820_c1 | |||
| 1575 | nmdc:mga0a205_399441_c1 | |||
| 1576 | Ga0495601_0002074 | |||
| 1577 | Ga0495601_0013016 | |||
| 1578 | Ga0495601_0021475 | |||
| 1579 | Ga0495601_0028607 | |||
| 1580 | Ga0495601_0029696 | |||
| 1581 | Ga0495612_0000056 | |||
| 1582 | Ga0495612_0107197 | |||
| 1583 | Ga0495655_0013964 | |||
| 1584 | Ga0495595_0001109 | |||
| 1585 | Ga0495595_0167969 | |||
| 1586 | Ga0495619_0002023 | |||
| 1587 | Ga0495619_0037801 | |||
| 1588 | Ga0495619_0135813 | |||
| 1589 | Ga0500651_0236583 | |||
| 1590 | Ga0500566_0020100 | |||
| 1591 | Ga0500641_0009037 | |||
| 1592 | Ga0500555_007355 | |||
| 1593 | Ga0500556_0002668 | |||
| 1594 | Ga0500562_000897 | |||
| 1595 | Ga0500562_006617 | |||
| 1596 | Ga0500569_001333 | |||
| 1597 | Ga0500572_001806 | |||
| 1598 | Ga0500593_000044 | |||
| 1599 | Ga0500595_007231 | |||
| 1600 | Ga0500595_031275 | |||
| 1601 | Ga0500608_000842 | |||
| 1602 | Ga0500614_002256 | |||
| 1603 | Ga0500642_0073828 | |||
| 1604 | Ga0500652_079690 | |||
| 1605 | Ga0500559_0000018 | |||
| 1606 | Ga0500559_0022529 | |||
| 1607 | Ga0500559_0048026 | |||
| 1608 | Ga0500564_088486 | |||
| 1609 | Ga0500568_0000004 | |||
| 1610 | Ga0500590_006787 | |||
| 1611 | Ga0500616_0061973 | |||
| 1612 | Ga0500616_0062741 | |||
| 1613 | Ga0500616_0076722 | |||
| 1614 | Ga0500637_0018468 | |||
| 1615 | Ga0500625_021470 | |||
| 1616 | Ga0500645_003850 | |||
| 1617 | Ga0500645_004813 | |||
| 1618 | Ga0500596_000126 | |||
| 1619 | Ga0501084_0030700 | |||
| 1620 | Ga0501084_0333050 | |||
| 1621 | Ga0501082_0000010 | |||
| 1622 | Ga0501082_0025840 | |||
| 1623 | Ga0501082_0078903 | |||
| 1624 | Ga0501082_0252343 | |||
| 1625 | Ga0501082_0255467 | |||
| 1626 | Ga0501082_0501680 | |||
| 1627 | Ga0501082_0564916 | |||
| 1628 | Ga0530510_0017181 | |||
| 1629 | Ga0530510_0278041 | |||
| 1630 | 2513591971 | |||
| 1631 | 2644000603 | |||
| 1632 | 2644088442 | |||
| 1633 | 2644290707 | |||
| 1634 | 2644343678 | |||
| 1635 | 2644368844 | |||
| 1636 | 2739309828 | |||
| 1637 | 2828306277 | |||
| 1638 | 2842700104 | |||
| 1639 | 2889793154 | |||
| 1640 | 2889917614 | |||
| 1641 | 2894818500 | |||
| 1642 | 3005483508 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9431 | 4 | 313 |
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9394 | 3 | 310 |
| 5kdr-assembly1.cif.gz_A-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.9383 | 5 | 313 |
| 2f9i-assembly1.cif.gz_A | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9377 | 2 | 311 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9279 | 4 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9532 | 4 | 313 | 3.90.226.10 |
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9385 | 4 | 313 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9155 | 53 | 313 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9053 | 53 | 313 | 3.90.226.10 |
| 5iniB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8105 | 53 | 296 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5Z6L7-F1-model_v4 | deleted | 0.9836 | 212 | 310 |
|
| AF-A0A536GMN9-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.9742 | 210 | 313 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A560D570-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9738 | 1 | 314 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A562KXJ5-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9737 | 1 | 316 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A2E1VRP1-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9737 | 4 | 314 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |