F482271

General Info

Members Datasets Scaffolds Average Seq Length
821 390 1642 317

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0072420|Ga0496109_0072420_1915_2988
Length 347
Sequence LPVTRLRLLGELHRAELRPSAERDEGGSPAVAVLVITVCMRSYLDFEKPVAEIEAKIEELRALNAGDSGPAIAEEISRLETKAAEELQELYENLDAWQKTQVARHPERPHSLDYVTALITDFVPLAGDRKFGDDDAIVAGFGRFRGESICIIGHEKGSSTEARLKHNFGMARPEGYRKAERMMQLADRFRIPVLSLVDTAGAYPGIGAEERGQAEAIARSTSASLDLGVPNVAVIIGETANRVLMLEHAIYSVISPEGAASILWRDTSKAQDAATNMKITAQDMIRFGVIDRIVPEPAGGAHRDAAAAIAATGEAIAGALGEISALDPETVRKERRDKFLAMGRAFG

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
228 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
353 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
354 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
355 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
356 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
357 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
358 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
359 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
363 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
372 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
373 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
374 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
378 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
379 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
380 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
381 2643221651 Afipia sp. Root123D2 Isolate Unclassified
382 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
383 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
384 2738543024 Aminobacter sp. AP02 Isolate Unclassified
385 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
386 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
387 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
388 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
389 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
390 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 0.24
Rhizoplane 6.33
Rhizosphere 82.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0072420 3300048912 Bacteria 3165
2 JGI25406J46586_10013258 3300003203 Bacteria 3549
3 Ga0055530_10005059 3300003791 Bacteria 6473
4 Ga0055531_10004151 3300003794 Bacteria 8937
5 Ga0065165_1002581 3300005262 Bacteria 14913
6 Ga0070658_10013925 3300005327 Bacteria 6457
7 Ga0070658_10028776 3300005327 Bacteria 4461
8 Ga0070676_10030532 3300005328 Bacteria 3074
9 Ga0070676_10105361 3300005328 Bacteria 1748
10 Ga0070690_100003947 3300005330 Bacteria 8190
11 Ga0070670_100000044 3300005331 Bacteria 140263
12 Ga0070670_100095221 3300005331 Bacteria 2561
13 Ga0070670_100325084 3300005331 Bacteria 1348
14 Ga0070677_10022151 3300005333 Bacteria 2337
15 Ga0068869_100007205 3300005334 Bacteria 7091
16 Ga0070666_10034231 3300005335 Bacteria 3367
17 Ga0070666_10090300 3300005335 Bacteria 2104
18 Ga0070666_10230191 3300005335 Bacteria 1309
19 Ga0070680_100006085 3300005336 Bacteria 9142
20 Ga0070680_100161079 3300005336 Bacteria 1885
21 Ga0070682_100031416 3300005337 Bacteria 3212
22 Ga0068868_100089101 3300005338 Bacteria 2484
23 Ga0068868_100132083 3300005338 Bacteria 2044
24 Ga0070660_100035420 3300005339 Bacteria 3778
25 Ga0070660_100113000 3300005339 Bacteria 2162
26 Ga0070660_100217064 3300005339 Bacteria 1554
27 Ga0070689_100006271 3300005340 Bacteria 8210
28 Ga0070691_10010903 3300005341 Bacteria 4150
29 Ga0070661_100001446 3300005344 Bacteria 16504
30 Ga0070668_100000098 3300005347 Bacteria 53574
31 Ga0070668_100002191 3300005347 Bacteria 14333
32 Ga0070668_100015032 3300005347 Bacteria 5780
33 Ga0070669_100004579 3300005353 Bacteria 9982
34 Ga0070669_100155405 3300005353 Bacteria 1773
35 Ga0070675_100257155 3300005354 Bacteria 1529
36 Ga0070671_100000497 3300005355 Bacteria 27514
37 Ga0070671_100012906 3300005355 Bacteria 6734
38 Ga0070671_100017745 3300005355 Bacteria 5770
39 Ga0070671_100036146 3300005355 Bacteria 4095
40 Ga0070671_100054333 3300005355 Bacteria 3330
41 Ga0070674_100002246 3300005356 Bacteria 10641
42 Ga0070674_100110818 3300005356 Bacteria 2015
43 Ga0070673_100001599 3300005364 Bacteria 13379
44 Ga0070673_100026478 3300005364 Bacteria 4284
45 Ga0070673_100089597 3300005364 Bacteria 2511
46 Ga0070688_100007704 3300005365 Bacteria 5815
47 Ga0070659_100002646 3300005366 Bacteria 12749
48 Ga0070659_100010511 3300005366 Bacteria 6811
49 Ga0070659_100019787 3300005366 Bacteria 5109
50 Ga0070659_100055064 3300005366 Bacteria 3133
51 Ga0070667_100003729 3300005367 Bacteria 12938
52 Ga0070667_100004554 3300005367 Bacteria 11668
53 Ga0070667_100008872 3300005367 Bacteria 8321
54 Ga0070667_100016357 3300005367 Bacteria 6137
55 Ga0070667_100034910 3300005367 Bacteria 4211
56 Ga0070667_100036831 3300005367 Bacteria 4101
57 Ga0070709_10003085 3300005434 Bacteria 8957
58 Ga0070709_10138429 3300005434 Bacteria 1670
59 Ga0070714_100059095 3300005435 Bacteria 3286
60 Ga0070714_100252853 3300005435 Bacteria 1630
61 Ga0070713_100034420 3300005436 Bacteria 4069
62 Ga0070710_10004649 3300005437 Bacteria 6493
63 Ga0070710_10054482 3300005437 Bacteria 2257
64 Ga0070710_10106608 3300005437 Bacteria 1677
65 Ga0070711_100132115 3300005439 Bacteria 1860
66 Ga0070711_100141020 3300005439 Bacteria 1807
67 Ga0070705_100064068 3300005440 Bacteria 2194
68 Ga0070694_100168184 3300005444 Bacteria 1613
69 Ga0070663_100019491 3300005455 Bacteria 4472
70 Ga0070662_100081004 3300005457 Bacteria 2418
71 Ga0070662_100145530 3300005457 Bacteria 1840
72 Ga0070681_10012011 3300005458 Bacteria 8586
73 Ga0070681_10017074 3300005458 Bacteria 7254
74 Ga0070681_10104661 3300005458 Bacteria 2772
75 Ga0068867_100008051 3300005459 Bacteria 7448
76 Ga0068867_100023806 3300005459 Bacteria 4387
77 Ga0070685_10057576 3300005466 Bacteria 2263
78 Ga0070698_100073412 3300005471 Bacteria 3428
79 Ga0070679_100006711 3300005530 Bacteria 10734
80 Ga0070679_100016884 3300005530 Bacteria 7056
81 Ga0070679_100032803 3300005530 Bacteria 5140
82 Ga0070679_100073782 3300005530 Bacteria 3403
83 Ga0070697_100017315 3300005536 Bacteria 5668
84 Ga0068853_100004404 3300005539 Bacteria 10906
85 Ga0068853_100061818 3300005539 Bacteria 3240
86 Ga0070686_100070111 3300005544 Bacteria 2291
87 Ga0070686_100107982 3300005544 Bacteria 1891
88 Ga0070696_100004697 3300005546 Bacteria 9130
89 Ga0070665_100000762 3300005548 Bacteria 42638
90 Ga0070665_100000831 3300005548 Bacteria 40349
91 Ga0070665_100002025 3300005548 Bacteria 22786
92 Ga0070665_100256952 3300005548 Bacteria 1748
93 Ga0070665_100482311 3300005548 Bacteria 1251
94 Ga0070704_100227710 3300005549 Bacteria 1519
95 Ga0068855_100040248 3300005563 Bacteria 5548
96 Ga0068855_100042296 3300005563 Bacteria 5399
97 Ga0068855_100074441 3300005563 Bacteria 3944
98 Ga0068855_100172155 3300005563 Bacteria 2452
99 Ga0068855_100205087 3300005563 Bacteria 2218
100 Ga0068855_100317984 3300005563 Bacteria 1721
101 Ga0068857_100101957 3300005577 Bacteria 2576
102 Ga0068857_100184468 3300005577 Bacteria 1899
103 Ga0068854_100007798 3300005578 Bacteria 6848
104 Ga0068854_100122136 3300005578 Bacteria 1979
105 Ga0068856_100024803 3300005614 Bacteria 5840
106 Ga0068856_100256483 3300005614 Bacteria 1764
107 Ga0068852_100009678 3300005616 Bacteria 7162
108 Ga0068852_100015002 3300005616 Bacteria 5988
109 Ga0068852_100067226 3300005616 Bacteria 3133
110 Ga0068859_100000231 3300005617 Bacteria 55036
111 Ga0068859_100007203 3300005617 Bacteria 11289
112 Ga0068864_100000060 3300005618 Bacteria 124506
113 Ga0068864_100000061 3300005618 Bacteria 123373
114 Ga0068864_100015964 3300005618 Bacteria 6249
115 Ga0068864_100024083 3300005618 Bacteria 5118
116 Ga0068864_100066194 3300005618 Bacteria 3136
117 Ga0068861_100017580 3300005719 Bacteria 5080
118 Ga0068861_100422864 3300005719 Bacteria 1187
119 Ga0068851_10001676 3300005834 Bacteria 9694
120 Ga0068863_100000023 3300005841 Bacteria 186490
121 Ga0068863_100000810 3300005841 Bacteria 31370
122 Ga0068863_100006931 3300005841 Bacteria 11106
123 Ga0068863_100377190 3300005841 Bacteria 1384
124 Ga0068858_100000184 3300005842 Bacteria 66104
125 Ga0068858_100003504 3300005842 Bacteria 15561
126 Ga0068858_100004308 3300005842 Bacteria 13981
127 Ga0068858_100023690 3300005842 Bacteria 5719
128 Ga0068858_100136549 3300005842 Bacteria 2301
129 Ga0068860_100000100 3300005843 Bacteria 144580
130 Ga0068860_100000122 3300005843 Bacteria 125178
131 Ga0068860_100004300 3300005843 Bacteria 14558
132 Ga0068862_100006370 3300005844 Bacteria 9814
133 Ga0068862_100097668 3300005844 Bacteria 2565
134 Ga0068862_100287207 3300005844 Bacteria 1510
135 Ga0081455_10122481 3300005937 Bacteria 2047
136 Ga0081455_10182224 3300005937 Bacteria 1589
137 Ga0081538_10019682 3300005981 Bacteria 5000
138 Ga0081540_1000005 3300005983 Bacteria 227052
139 Ga0081539_10001341 3300005985 Bacteria 42889
140 Ga0070717_10010974 3300006028 Bacteria 6859
141 Ga0070717_10114965 3300006028 Bacteria 2299
142 Ga0075365_10012223 3300006038 Bacteria 5087
143 Ga0075365_10105027 3300006038 Bacteria 1937
144 Ga0075368_10013467 3300006042 Bacteria 3004
145 Ga0075363_100102279 3300006048 Bacteria 1586
146 Ga0075364_10000160 3300006051 Bacteria 29830
147 Ga0070715_10005056 3300006163 Bacteria 4374
148 Ga0070716_100032077 3300006173 Bacteria 2862
149 Ga0070712_100033651 3300006175 Bacteria 3469
150 Ga0070712_100046978 3300006175 Bacteria 2986
151 Ga0070712_100124392 3300006175 Bacteria 1945
152 Ga0075367_10043383 3300006178 Bacteria 2634
153 Ga0075366_10001106 3300006195 Bacteria 13260
154 Ga0097621_100135651 3300006237 Bacteria 2099
155 Ga0075370_10054187 3300006353 Bacteria 2277
156 Ga0068871_100131098 3300006358 Bacteria 2125
157 Ga0068871_100153079 3300006358 Bacteria 1968
158 Ga0075430_100001664 3300006846 Bacteria 18165
159 Ga0075430_100036710 3300006846 Bacteria 4155
160 Ga0075430_100045419 3300006846 Bacteria 3711
161 Ga0075430_100060215 3300006846 Bacteria 3191
162 Ga0075431_100206111 3300006847 Bacteria 2010
163 Ga0075433_10036706 3300006852 Bacteria 4223
164 Ga0075434_100054347 3300006871 Bacteria 3979
165 Ga0075429_100002435 3300006880 Bacteria 15677
166 Ga0068865_100002419 3300006881 Bacteria 11025
167 Ga0068865_100137080 3300006881 Bacteria 1841
168 Ga0068865_100300974 3300006881 Bacteria 1284
169 Ga0075436_100010291 3300006914 Bacteria 6404
170 Ga0075436_100044482 3300006914 Bacteria 3062
171 Ga0097620_100000231 3300006931 Bacteria 55036
172 Ga0097620_100007203 3300006931 Bacteria 11289
173 Ga0075435_100192276 3300007076 Bacteria 1728
174 Ga0099795_10013325 3300007788 Bacteria 2520
175 Ga0105240_10002285 3300009093 Bacteria 31035
176 Ga0105240_10027302 3300009093 Bacteria 7476
177 Ga0105240_10161862 3300009093 Bacteria 2657
178 Ga0105240_10197701 3300009093 Bacteria 2359
179 Ga0105240_10217886 3300009093 Bacteria 2225
180 Ga0111539_10019416 3300009094 Bacteria 8389
181 Ga0111539_10176877 3300009094 Bacteria 2493
182 Ga0111539_10321187 3300009094 Bacteria 1802
183 Ga0105245_10050003 3300009098 Bacteria 3745
184 Ga0105247_10074349 3300009101 Bacteria 2131
185 Ga0105247_10136678 3300009101 Bacteria 1602
186 Ga0114129_10055349 3300009147 Bacteria 5559
187 Ga0105241_10032577 3300009174 Bacteria 3908
188 Ga0105248_10000279 3300009177 Bacteria 60271
189 Ga0105248_10015107 3300009177 Bacteria 8503
190 Ga0105248_10016683 3300009177 Bacteria 8084
191 Ga0105248_10016737 3300009177 Bacteria 8073
192 Ga0105248_10200674 3300009177 Bacteria 2247
193 Ga0105237_10369440 3300009545 Bacteria 1439
194 Ga0105238_10027382 3300009551 Bacteria 5807
195 Ga0105238_10048775 3300009551 Bacteria 4266
196 Ga0105238_10132158 3300009551 Bacteria 2474
197 Ga0105249_10014102 3300009553 Bacteria 7065
198 Ga0105249_10236807 3300009553 Bacteria 1803
199 Ga0099796_10001765 3300010159 Bacteria 4514
200 Ga0099796_10004606 3300010159 Bacteria 3358
201 Ga0105239_10013959 3300010375 Bacteria 8920
202 Ga0105239_10065192 3300010375 Bacteria 4000
203 Ga0105239_10080254 3300010375 Bacteria 3590
204 Ga0105239_10122138 3300010375 Bacteria 2893
205 Ga0157373_10031787 3300013100 Bacteria 3800
206 Ga0157371_10014768 3300013102 Bacteria 5879
207 Ga0157371_10115583 3300013102 Bacteria 1906
208 Ga0157370_10003380 3300013104 Bacteria 18756
209 Ga0157370_10029718 3300013104 Bacteria 5360
210 Ga0157370_10084836 3300013104 Bacteria 2976
211 Ga0157370_10160586 3300013104 Bacteria 2091
212 Ga0157369_10108496 3300013105 Bacteria 2952
213 Ga0163162_10088453 3300013306 Bacteria 3177
214 Ga0163162_10226846 3300013306 Bacteria 1998
215 Ga0163162_10338267 3300013306 Bacteria 1638
216 Ga0157372_10027766 3300013307 Bacteria 6169
217 Ga0157372_10032887 3300013307 Bacteria 5691
218 Ga0157375_10098846 3300013308 Bacteria 2996
219 Ga0163163_10043821 3300014325 Bacteria 4389
220 Ga0163163_10133829 3300014325 Bacteria 2519
221 Ga0163163_10304061 3300014325 Bacteria 1647
222 Ga0157380_10229057 3300014326 Bacteria 1668
223 Ga0157380_10238135 3300014326 Bacteria 1639
224 Ga0157380_10388431 3300014326 Bacteria 1320
225 Ga0157379_10012083 3300014968 Bacteria 7540
226 Ga0157379_10111262 3300014968 Bacteria 2460
227 Ga0163161_10120616 3300017792 Bacteria 1970
228 Ga0213874_10013464 3300021377 Bacteria 2120
229 Ga0213876_10019673 3300021384 Bacteria 3566
230 Ga0209026_1005312 3300025250 Bacteria 3499
231 Ga0209026_1009377 3300025250 Bacteria 1928
232 Ga0209148_1001435 3300025254 Bacteria 12136
233 Ga0209148_1002626 3300025254 Bacteria 5855
234 Ga0209758_1000430 3300025297 Bacteria 71132
235 Ga0209758_1001067 3300025297 Bacteria 35672
236 Ga0209050_1000098 3300025298 Bacteria 236717
237 Ga0209257_1000221 3300025304 Bacteria 134870
238 Ga0209257_1004498 3300025304 Bacteria 10743
239 Ga0207656_10011311 3300025321 Bacteria 3369
240 Ga0207682_10003834 3300025893 Bacteria 6455
241 Ga0207680_10030166 3300025903 Bacteria 3055
242 Ga0207680_10030196 3300025903 Bacteria 3054
243 Ga0207647_10241102 3300025904 Bacteria 1038
244 Ga0207645_10004551 3300025907 Bacteria 10239
245 Ga0207645_10037006 3300025907 Bacteria 3133
246 Ga0207645_10101160 3300025907 Bacteria 1859
247 Ga0207643_10121081 3300025908 Bacteria 1550
248 Ga0207705_10003181 3300025909 Bacteria 12500
249 Ga0207705_10003909 3300025909 Bacteria 11330
250 Ga0207654_10015995 3300025911 Bacteria 3901
251 Ga0207654_10177629 3300025911 Bacteria 1387
252 Ga0207707_10025158 3300025912 Bacteria 5207
253 Ga0207707_10030967 3300025912 Bacteria 4679
254 Ga0207707_10083476 3300025912 Bacteria 2790
255 Ga0207707_10321714 3300025912 Bacteria 1335
256 Ga0207695_10002540 3300025913 Bacteria 26801
257 Ga0207695_10004869 3300025913 Bacteria 18113
258 Ga0207695_10026041 3300025913 Bacteria 6534
259 Ga0207695_10096452 3300025913 Bacteria 2959
260 Ga0207695_10337110 3300025913 Bacteria 1396
261 Ga0207671_10438277 3300025914 Bacteria 1040
262 Ga0207693_10000787 3300025915 Bacteria 28419
263 Ga0207693_10014625 3300025915 Bacteria 6305
264 Ga0207693_10059645 3300025915 Bacteria 2989
265 Ga0207693_10085389 3300025915 Bacteria 2472
266 Ga0207693_10088252 3300025915 Bacteria 2431
267 Ga0207663_10154644 3300025916 Bacteria 1612
268 Ga0207660_10014784 3300025917 Bacteria 5143
269 Ga0207660_10028003 3300025917 Bacteria 3851
270 Ga0207662_10102755 3300025918 Bacteria 1773
271 Ga0207657_10003993 3300025919 Bacteria 15684
272 Ga0207657_10074018 3300025919 Bacteria 2877
273 Ga0207657_10083000 3300025919 Bacteria 2689
274 Ga0207657_10094864 3300025919 Bacteria 2483
275 Ga0207649_10024458 3300025920 Bacteria 3510
276 Ga0207652_10004635 3300025921 Bacteria 11144
277 Ga0207652_10025068 3300025921 Bacteria 4956
278 Ga0207652_10045774 3300025921 Bacteria 3730
279 Ga0207652_10307230 3300025921 Bacteria 1431
280 Ga0207681_10001188 3300025923 Bacteria 16757
281 Ga0207681_10095626 3300025923 Bacteria 2131
282 Ga0207694_10034155 3300025924 Bacteria 3899
283 Ga0207694_10067466 3300025924 Bacteria 2792
284 Ga0207694_10130110 3300025924 Bacteria 2017
285 Ga0207694_10193380 3300025924 Bacteria 1653
286 Ga0207650_10000065 3300025925 Bacteria 140452
287 Ga0207650_10064096 3300025925 Bacteria 2750
288 Ga0207650_10073794 3300025925 Bacteria 2571
289 Ga0207650_10193941 3300025925 Bacteria 1624
290 Ga0207687_10089476 3300025927 Bacteria 2242
291 Ga0207687_10174718 3300025927 Bacteria 1660
292 Ga0207700_10006999 3300025928 Bacteria 6861
293 Ga0207700_10025273 3300025928 Bacteria 4122
294 Ga0207664_10070244 3300025929 Bacteria 2818
295 Ga0207664_10139282 3300025929 Bacteria 2050
296 Ga0207644_10002707 3300025931 Bacteria 11418
297 Ga0207644_10006071 3300025931 Bacteria 7879
298 Ga0207644_10182604 3300025931 Bacteria 1645
299 Ga0207690_10001133 3300025932 Bacteria 16976
300 Ga0207690_10036533 3300025932 Bacteria 3181
301 Ga0207690_10050959 3300025932 Bacteria 2766
302 Ga0207706_10083773 3300025933 Bacteria 2803
303 Ga0207706_10091402 3300025933 Bacteria 2676
304 Ga0207706_10123983 3300025933 Bacteria 2273
305 Ga0207706_10126882 3300025933 Bacteria 2244
306 Ga0207709_10226556 3300025935 Bacteria 1351
307 Ga0207670_10004720 3300025936 Bacteria 7390
308 Ga0207670_10006011 3300025936 Bacteria 6707
309 Ga0207670_10124316 3300025936 Bacteria 1880
310 Ga0207669_10001250 3300025937 Bacteria 10802
311 Ga0207704_10008976 3300025938 Bacteria 4805
312 Ga0207665_10000117 3300025939 Bacteria 52204
313 Ga0207691_10004922 3300025940 Bacteria 12889
314 Ga0207711_10000684 3300025941 Bacteria 33642
315 Ga0207711_10005226 3300025941 Bacteria 10999
316 Ga0207711_10009716 3300025941 Bacteria 8007
317 Ga0207711_10095145 3300025941 Bacteria 2627
318 Ga0207689_10107370 3300025942 Bacteria 2294
319 Ga0207679_10396633 3300025945 Bacteria 1213
320 Ga0207667_10033644 3300025949 Bacteria 5510
321 Ga0207667_10038111 3300025949 Bacteria 5135
322 Ga0207667_10050024 3300025949 Bacteria 4411
323 Ga0207667_10091205 3300025949 Bacteria 3148
324 Ga0207667_10149280 3300025949 Bacteria 2406
325 Ga0207651_10027327 3300025960 Bacteria 3582
326 Ga0207651_10251546 3300025960 Bacteria 1446
327 Ga0207712_10012792 3300025961 Bacteria 5366
328 Ga0207668_10000018 3300025972 Bacteria 158577
329 Ga0207668_10000340 3300025972 Bacteria 30277
330 Ga0207668_10002444 3300025972 Bacteria 10845
331 Ga0207668_10008059 3300025972 Bacteria 6271
332 Ga0207668_10030812 3300025972 Bacteria 3527
333 Ga0207640_10029818 3300025981 Bacteria 3353
334 Ga0207640_10097395 3300025981 Bacteria 2053
335 Ga0207640_10102027 3300025981 Bacteria 2014
336 Ga0207640_10105606 3300025981 Bacteria 1985
337 Ga0207658_10000168 3300025986 Bacteria 70040
338 Ga0207658_10003273 3300025986 Bacteria 11505
339 Ga0207658_10011028 3300025986 Bacteria 6152
340 Ga0207658_10095180 3300025986 Bacteria 2320
341 Ga0207658_10107507 3300025986 Bacteria 2198
342 Ga0207677_10092168 3300026023 Bacteria 2206
343 Ga0207703_10000273 3300026035 Bacteria 57186
344 Ga0207703_10003313 3300026035 Bacteria 13519
345 Ga0207703_10007240 3300026035 Bacteria 8824
346 Ga0207703_10069866 3300026035 Bacteria 2897
347 Ga0207703_10166334 3300026035 Bacteria 1936
348 Ga0207703_10483466 3300026035 Bacteria 1160
349 Ga0207639_10005874 3300026041 Bacteria 8317
350 Ga0207639_10025958 3300026041 Bacteria 4253
351 Ga0207678_10007031 3300026067 Bacteria 9992
352 Ga0207678_10278501 3300026067 Bacteria 1435
353 Ga0207678_10392079 3300026067 Bacteria 1201
354 Ga0207708_10220677 3300026075 Bacteria 1519
355 Ga0207702_10028812 3300026078 Bacteria 4618
356 Ga0207702_10063897 3300026078 Bacteria 3149
357 Ga0207702_10226237 3300026078 Bacteria 1746
358 Ga0207702_10304951 3300026078 Bacteria 1512
359 Ga0207641_10000067 3300026088 Bacteria 155379
360 Ga0207641_10001551 3300026088 Bacteria 22508
361 Ga0207641_10011364 3300026088 Bacteria 7305
362 Ga0207641_10022554 3300026088 Bacteria 5181
363 Ga0207641_10326215 3300026088 Bacteria 1457
364 Ga0207648_10002948 3300026089 Bacteria 18006
365 Ga0207648_10033201 3300026089 Bacteria 4552
366 Ga0207676_10000127 3300026095 Bacteria 66733
367 Ga0207676_10000501 3300026095 Bacteria 33019
368 Ga0207676_10011585 3300026095 Bacteria 6304
369 Ga0207676_10011837 3300026095 Bacteria 6242
370 Ga0207674_10029426 3300026116 Bacteria 5782
371 Ga0207674_10169699 3300026116 Bacteria 2136
372 Ga0207674_10211175 3300026116 Bacteria 1890
373 Ga0207675_100510238 3300026118 Bacteria 1198
374 Ga0207683_10037355 3300026121 Bacteria 4228
375 Ga0207698_10070871 3300026142 Bacteria 2763
376 Ga0207698_10301594 3300026142 Bacteria 1491
377 Ga0209981_1000385 3300027378 Bacteria 5640
378 Ga0209179_1000737 3300027512 Bacteria 3553
379 Ga0209999_1006024 3300027543 Bacteria 2178
380 Ga0209813_10001517 3300027866 Bacteria 5213
381 Ga0207428_10130483 3300027907 Bacteria 1923
382 Ga0268266_10000003 3300028379 Bacteria 1701703
383 Ga0268266_10007459 3300028379 Bacteria 9866
384 Ga0268266_10008942 3300028379 Bacteria 8863
385 Ga0268266_10051971 3300028379 Bacteria 3518
386 Ga0268266_10060923 3300028379 Bacteria 3254
387 Ga0268265_10001199 3300028380 Bacteria 22587
388 Ga0268265_10002874 3300028380 Bacteria 12649
389 Ga0268265_10088418 3300028380 Bacteria 2468
390 Ga0268265_10157050 3300028380 Bacteria 1926
391 Ga0268265_10280705 3300028380 Bacteria 1490
392 Ga0268264_10000002 3300028381 Bacteria 1153045
393 Ga0268264_10000172 3300028381 Bacteria 140393
394 Ga0268264_10140577 3300028381 Bacteria 2152
395 Ga0307517_10001099 3300028786 Bacteria 45677
396 Ga0307517_10017425 3300028786 Bacteria 9367
397 Ga0265338_10013082 3300028800 Bacteria 9404
398 Ga0265338_10033080 3300028800 Bacteria 5027
399 Ga0307511_10042056 3300030521 Bacteria 3847
400 Ga0265332_10025083 3300031238 Bacteria 2621
401 Ga0265325_10001782 3300031241 Bacteria 14906
402 Ga0265325_10010617 3300031241 Bacteria 5323
403 Ga0265325_10123382 3300031241 Bacteria 1246
404 Ga0265340_10017200 3300031247 Bacteria 3740
405 Ga0265340_10017957 3300031247 Bacteria 3656
406 Ga0265339_10000101 3300031249 Bacteria 69843
407 Ga0265327_10110094 3300031251 Bacteria 1317
408 Ga0307513_10003813 3300031456 Bacteria 20324
409 Ga0307513_10007922 3300031456 Bacteria 13674
410 Ga0307513_10015171 3300031456 Bacteria 9352
411 Ga0307513_10138070 3300031456 Bacteria 2369
412 Ga0265313_10000548 3300031595 Bacteria 39188
413 Ga0265313_10063649 3300031595 Bacteria 1719
414 Ga0316579_10000778 3300031691 Bacteria 10920
415 Ga0307516_10000020 3300031730 Bacteria 195931
416 Ga0307416_100288231 3300032002 Bacteria 1624
417 Ga0307510_10013355 3300033180 Bacteria 9739
418 Ga0373926_0025167 3300035083 Bacteria 2076
419 Ga0373929_0006916 3300035085 Bacteria 2061
420 Ga0373944_0002067 3300035089 Bacteria 5094
421 Ga0373944_0013160 3300035089 Bacteria 2290
422 Ga0373952_0031570 3300035092 Bacteria 1178
423 Ga0373952_0032546 3300035092 Bacteria 1165
424 Ga0373923_0095981 3300035111 Bacteria 1302
425 Ga0373936_0020232 3300035113 Bacteria 2584
426 Ga0373945_0032897 3300035116 Bacteria 1839
427 Ga0373954_0008692 3300035118 Bacteria 4465
428 Ga0373954_0018837 3300035118 Bacteria 3110
429 Ga0373954_0072032 3300035118 Bacteria 1643
430 Ga0373957_0042446 3300035120 Bacteria 1716
431 Ga0373943_0001239 3300035170 Bacteria 11423
432 Ga0373943_0036272 3300035170 Bacteria 2361
433 Ga0373946_0000841 3300035171 Bacteria 10513
434 Ga0373946_0034936 3300035171 Bacteria 2032
435 Ga0373946_0108442 3300035171 Bacteria 1254
436 Ga0373955_0002732 3300035172 Bacteria 7732
437 Ga0373924_0016745 3300035410 Bacteria 2803
438 Ga0373931_0007577 3300035691 Bacteria 5113
439 Ga0373931_0015115 3300035691 Bacteria 3782
440 Ga0373935_0014244 3300035692 Bacteria 4799
441 Ga0373935_0026355 3300035692 Bacteria 3586
442 Ga0373935_0065547 3300035692 Bacteria 2331
443 Ga0373935_0211620 3300035692 Bacteria 1344
444 Ga0373927_0001609 3300035695 Bacteria 16951
445 Ga0373927_0002779 3300035695 Bacteria 12776
446 Ga0373927_0012344 3300035695 Bacteria 5685
447 Ga0373927_0024145 3300035695 Bacteria 3977
448 Ga0373927_0202531 3300035695 Bacteria 1303
449 Ga0373933_0001709 3300035724 Bacteria 12737
450 Ga0373933_0028734 3300035724 Bacteria 3210
451 Ga0373947_0001204 3300035725 Bacteria 15908
452 Ga0373947_0084188 3300035725 Bacteria 1973
453 Ga0373937_0000959 3300036401 Bacteria 24479
454 Ga0373937_0009056 3300036401 Bacteria 8640
455 Ga0373937_0145612 3300036401 Bacteria 2217
456 Ga0373937_0408257 3300036401 Bacteria 1289
457 Ga0373937_0431506 3300036401 Bacteria 1251
458 Ga0373937_0526406 3300036401 Bacteria 1123
459 Ga0373925_0000277 3300037068 Bacteria 53450
460 Ga0373925_0007493 3300037068 Bacteria 7956
461 Ga0373925_0011790 3300037068 Bacteria 6327
462 Ga0373925_0032343 3300037068 Bacteria 3850
463 Ga0373925_0126825 3300037068 Bacteria 1986
464 Ga0395899_0000847 3300037312 Bacteria 29441
465 Ga0395899_0272677 3300037312 Bacteria 1153
466 Ga0395899_0296182 3300037312 Bacteria 1096
467 Ga0395900_0000016 3300037418 Bacteria 382407
468 Ga0395898_0025733 3300037466 Bacteria 5926
469 Ga0395898_0115706 3300037466 Bacteria 2569
470 Ga0395905_0008634 3300037471 Bacteria 10037
471 Ga0395905_0034525 3300037471 Bacteria 4749
472 Ga0395905_0206247 3300037471 Bacteria 1842
473 Ga0436364_1039680 3300037853 Bacteria 1720
474 Ga0395901_0000028 3300038443 Bacteria 242653
475 Ga0395901_0067598 3300038443 Bacteria 3722
476 Ga0400483_185390 3300039062 Bacteria 3076
477 Ga0436365_0392568 3300039437 Bacteria 1624
478 Ga0436365_0513635 3300039437 Bacteria 1028
479 Ga0436365_0996971 3300039437 Bacteria 5522
480 Ga0436365_1199935 3300039437 Bacteria 5250
481 Ga0436365_1750823 3300039437 Bacteria 4669
482 Ga0436361_0115059 3300039447 Bacteria 4096
483 Ga0436363_0093454 3300039450 Bacteria 2841
484 Ga0439448_0007095 3300042005 Bacteria 3238
485 Ga0439459_0033545 3300042438 Bacteria 1058
486 Ga0450893_0016054 3300042532 Bacteria 1266
487 Ga0451577_0245810 3300042876 Bacteria 1619
488 Ga0439440_0025807 3300042993 Bacteria 1356
489 Ga0466963_0004016 3300044694 Bacteria 8508
490 Ga0466963_0021477 3300044694 Bacteria 4073
491 Ga0466963_0093046 3300044694 Bacteria 2055
492 Ga0466963_0118151 3300044694 Bacteria 1823
493 Ga0453684_0296846 3300044712 Bacteria 1838
494 Ga0466957_0008453 3300044842 Bacteria 5855
495 Ga0451576_0000040 3300045051 Bacteria 349778
496 Ga0466958_0068378 3300045836 Bacteria 2171
497 Ga0466967_0000138 3300045976 Bacteria 28201
498 Ga0466967_0059354 3300045976 Bacteria 3386
499 Ga0495627_000159 3300046453 Bacteria 76595
500 Ga0495592_0022037 3300046454 Bacteria 4846
501 Ga0495629_0003800 3300046459 Bacteria 11376
502 Ga0495629_0056511 3300046459 Bacteria 2744
503 Ga0495629_0105936 3300046459 Bacteria 1961
504 Ga0495629_0171091 3300046459 Bacteria 1507
505 Ga0495638_0148328 3300046460 Bacteria 1362
506 Ga0495651_0002695 3300046462 Bacteria 13781
507 Ga0495651_0024559 3300046462 Bacteria 4688
508 Ga0495653_0001872 3300046463 Bacteria 16609
509 Ga0495653_0110753 3300046463 Bacteria 1973
510 Ga0495639_0122245 3300046475 Bacteria 1242
511 Ga0495662_0009056 3300046476 Bacteria 4888
512 Ga0495664_0000631 3300046477 Bacteria 17915
513 Ga0495664_0078913 3300046477 Bacteria 1972
514 Ga0495664_0112334 3300046477 Bacteria 1645
515 Ga0495594_0159559 3300046499 Bacteria 1282
516 Ga0495583_0028737 3300046506 Bacteria 2730
517 Ga0495608_0007164 3300046511 Bacteria 7887
518 Ga0495608_0026684 3300046511 Bacteria 3936
519 Ga0495618_0001463 3300046514 Bacteria 15815
520 Ga0495620_0010489 3300046515 Bacteria 4889
521 Ga0495628_0007565 3300046516 Bacteria 9395
522 Ga0495628_0285800 3300046516 Bacteria 1224
523 Ga0495630_0013814 3300046517 Bacteria 5871
524 Ga0495630_0034773 3300046517 Bacteria 3764
525 Ga0495630_0128850 3300046517 Bacteria 1921
526 Ga0495630_0182916 3300046517 Bacteria 1598
527 Ga0495643_0126022 3300046522 Bacteria 1289
528 Ga0495663_0033621 3300046525 Bacteria 1532
529 Ga0495642_0001670 3300046528 Bacteria 9620
530 Ga0495642_0046681 3300046528 Bacteria 1772
531 Ga0495652_0012913 3300046529 Bacteria 7528
532 Ga0495652_0049311 3300046529 Bacteria 3605
533 Ga0495665_0007546 3300046531 Bacteria 5889
534 Ga0495665_0057883 3300046531 Bacteria 2046
535 Ga0495640_0000714 3300046533 Bacteria 24847
536 Ga0495640_0003726 3300046533 Bacteria 12246
537 Ga0495587_0027422 3300046536 Bacteria 3468
538 Ga0495587_0060555 3300046536 Bacteria 2219
539 Ga0495598_0008478 3300046537 Bacteria 2396
540 Ga0495645_0000575 3300046543 Bacteria 25166
541 Ga0495645_0046048 3300046543 Bacteria 3180
542 Ga0495622_0020935 3300046557 Bacteria 3045
543 Ga0495667_0002333 3300046559 Bacteria 12707
544 Ga0495667_0076143 3300046559 Bacteria 2183
545 Ga0495656_0026349 3300046615 Bacteria 2314
546 Ga0495668_0002197 3300046616 Bacteria 16632
547 Ga0495668_0027431 3300046616 Bacteria 3227
548 Ga0495668_0049763 3300046616 Bacteria 2324
549 Ga0495634_0001265 3300046642 Bacteria 23201
550 Ga0495634_0003291 3300046642 Bacteria 13024
551 Ga0495634_0009075 3300046642 Bacteria 7349
552 Ga0495634_0160514 3300046642 Bacteria 1418
553 Ga0495611_0007425 3300046648 Bacteria 4656
554 Ga0495625_0088184 3300046660 Bacteria 2150
555 Ga0495635_0000771 3300046663 Bacteria 20855
556 Ga0495635_0000918 3300046663 Bacteria 19365
557 Ga0495635_0118280 3300046663 Bacteria 1808
558 Ga0495635_0153149 3300046663 Bacteria 1569
559 Ga0495588_0211367 3300046674 Bacteria 1024
560 Ga0495657_0027157 3300046675 Bacteria 4044
561 Ga0495657_0187290 3300046675 Bacteria 1266
562 Ga0495623_0003265 3300046679 Bacteria 10704
563 Ga0495623_0012214 3300046679 Bacteria 5563
564 Ga0495658_0009500 3300046683 Bacteria 4850
565 Ga0495658_0121214 3300046683 Bacteria 1582
566 Ga0495669_0000005 3300046684 Bacteria 193971
567 Ga0495669_0000356 3300046684 Bacteria 23366
568 Ga0495669_0010448 3300046684 Bacteria 3924
569 Ga0495669_0029323 3300046684 Bacteria 2413
570 Ga0495613_0042399 3300046689 Bacteria 3368
571 Ga0495613_0053034 3300046689 Bacteria 2985
572 Ga0495613_0091514 3300046689 Bacteria 2203
573 Ga0495624_0012655 3300046690 Bacteria 5762
574 Ga0495600_0001241 3300046809 Bacteria 14014
575 Ga0495604_0000130 3300047317 Bacteria 63418
576 Ga0495604_0037116 3300047317 Bacteria 3839
577 Ga0495674_0003371 3300047319 Bacteria 15516
578 Ga0495674_0026761 3300047319 Bacteria 5276
579 Ga0495672_0036212 3300047320 Bacteria 3032
580 Ga0495672_0063253 3300047320 Bacteria 2125
581 Ga0495676_0137124 3300047321 Bacteria 1758
582 Ga0495680_0000701 3300047322 Bacteria 37622
583 Ga0495680_0160075 3300047322 Bacteria 1635
584 Ga0495687_041745 3300047443 Bacteria 2010
585 Ga0495675_0023318 3300047444 Bacteria 3943
586 Ga0495675_0054090 3300047444 Bacteria 2548
587 Ga0495677_0002371 3300047445 Bacteria 7405
588 Ga0495685_031603 3300047447 Bacteria 1819
589 Ga0495684_0018296 3300047471 Bacteria 5400
590 Ga0495686_0000134 3300047472 Bacteria 149997
591 Ga0495686_0032777 3300047472 Bacteria 3360
592 Ga0495593_0013246 3300047673 Bacteria 4708
593 Ga0495593_0030305 3300047673 Bacteria 2961
594 Ga0495602_0002441 3300048088 Bacteria 18923
595 Ga0495602_0024309 3300048088 Bacteria 5879
596 Ga0495602_0225080 3300048088 Bacteria 1413
597 Ga0496100_0280250 3300048903 Bacteria 1242
598 Ga0496101_0002031 3300048904 Bacteria 12306
599 Ga0496101_0038096 3300048904 Bacteria 3413
600 Ga0496101_0138270 3300048904 Bacteria 1855
601 Ga0496102_0016745 3300048905 Bacteria 6411
602 Ga0496102_0032897 3300048905 Bacteria 4660
603 Ga0496102_0044054 3300048905 Bacteria 4048
604 Ga0496102_0088304 3300048905 Bacteria 2866
605 Ga0496103_0113617 3300048906 Bacteria 1721
606 Ga0496104_0001419 3300048907 Bacteria 20752
607 Ga0496104_0001499 3300048907 Bacteria 20140
608 Ga0496104_0017387 3300048907 Bacteria 6548
609 Ga0496104_0018342 3300048907 Bacteria 6385
610 Ga0496104_0173445 3300048907 Bacteria 2067
611 Ga0496104_0337094 3300048907 Bacteria 1421
612 Ga0496105_0010619 3300048908 Bacteria 7245
613 Ga0496105_0234953 3300048908 Bacteria 1489
614 Ga0496105_0330342 3300048908 Bacteria 1220
615 Ga0496105_0378385 3300048908 Bacteria 1127
616 Ga0496106_0037312 3300048909 Bacteria 3635
617 Ga0496106_0076746 3300048909 Bacteria 2561
618 Ga0496106_0138851 3300048909 Bacteria 1911
619 Ga0496106_0235231 3300048909 Bacteria 1463
620 Ga0496107_0040633 3300048910 Bacteria 3339
621 Ga0496107_0076366 3300048910 Bacteria 2440
622 Ga0496107_0080448 3300048910 Bacteria 2376
623 Ga0496107_0211959 3300048910 Bacteria 1440
624 Ga0496107_0377632 3300048910 Bacteria 1054
625 Ga0496108_0021301 3300048911 Bacteria 5328
626 Ga0496108_0148022 3300048911 Bacteria 2025
627 Ga0496108_0246113 3300048911 Bacteria 1555
628 Ga0496109_0006507 3300048912 Bacteria 9840
629 Ga0496109_0071276 3300048912 Bacteria 3190
630 Ga0496109_0204285 3300048912 Bacteria 1857
631 Ga0496109_0249034 3300048912 Bacteria 1673
632 Ga0496109_0392421 3300048912 Bacteria 1311
633 Ga0496110_0140811 3300048913 Bacteria 2180
634 Ga0496110_0515042 3300048913 Bacteria 1088
635 Ga0496111_0303478 3300048914 Bacteria 1183
636 Ga0496112_0041029 3300048915 Bacteria 4527
637 Ga0496112_0053208 3300048915 Bacteria 3975
638 Ga0496112_0063830 3300048915 Bacteria 3633
639 Ga0496112_0081641 3300048915 Bacteria 3197
640 Ga0496112_0195406 3300048915 Bacteria 1984
641 Ga0496114_0011438 3300048917 Bacteria 7091
642 Ga0496114_0378072 3300048917 Bacteria 1254
643 Ga0496115_0015358 3300048918 Bacteria 5808
644 Ga0496115_0052116 3300048918 Bacteria 3282
645 Ga0496115_0117746 3300048918 Bacteria 2185
646 Ga0496115_0119661 3300048918 Bacteria 2166
647 Ga0496115_0191835 3300048918 Bacteria 1688
648 Ga0496117_0008365 3300048920 Bacteria 9839
649 Ga0496118_0017509 3300048921 Bacteria 6518
650 Ga0496119_0001362 3300048922 Bacteria 29824
651 Ga0496119_0005397 3300048922 Bacteria 12280
652 Ga0496121_0000053 3300048924 Bacteria 312611
653 Ga0496121_0049046 3300048924 Bacteria 3586
654 Ga0496122_0008006 3300048925 Bacteria 11545
655 Ga0496123_0001238 3300048926 Bacteria 37104
656 Ga0501031_0003183 3300049568 Bacteria 10533
657 Ga0501031_0004683 3300049568 Bacteria 8875
658 Ga0501031_0045743 3300049568 Bacteria 2856
659 Ga0501032_0000278 3300049569 Bacteria 43318
660 Ga0501032_0005549 3300049569 Bacteria 9357
661 Ga0501032_0009956 3300049569 Bacteria 6865
662 Ga0501033_0011636 3300049570 Bacteria 6728
663 Ga0501033_0047650 3300049570 Bacteria 3186
664 Ga0501034_0038681 3300049571 Bacteria 4830
665 Ga0501034_0127301 3300049571 Bacteria 2532
666 Ga0501034_0283865 3300049571 Bacteria 1595
667 Ga0501034_0284199 3300049571 Bacteria 1594
668 Ga0501034_0353913 3300049571 Bacteria 1396
669 Ga0501034_0362196 3300049571 Bacteria 1377
670 Ga0501034_0449579 3300049571 Bacteria 1206
671 Ga0501036_0020497 3300049572 Bacteria 5552
672 Ga0501036_0318641 3300049572 Bacteria 1299
673 Ga0501037_0005407 3300049573 Bacteria 9302
674 Ga0501037_0016422 3300049573 Bacteria 5449
675 Ga0501037_0046733 3300049573 Bacteria 3174
676 Ga0501037_0084701 3300049573 Bacteria 2296
677 Ga0501037_0177063 3300049573 Bacteria 1514
678 Ga0501038_0002487 3300049574 Bacteria 17144
679 Ga0501038_0017203 3300049574 Bacteria 6537
680 Ga0501038_0028216 3300049574 Bacteria 4987
681 Ga0501038_0297076 3300049574 Bacteria 1268
682 Ga0501039_0134505 3300049575 Bacteria 1941
683 Ga0501039_0376353 3300049575 Bacteria 1115
684 Ga0501043_0003959 3300049579 Bacteria 12143
685 Ga0501043_0007512 3300049579 Bacteria 8657
686 Ga0501043_0043780 3300049579 Bacteria 3519
687 Ga0501047_0012392 3300049581 Bacteria 8070
688 Ga0501047_0035166 3300049581 Bacteria 4839
689 Ga0501047_0035960 3300049581 Bacteria 4786
690 Ga0501047_0094898 3300049581 Bacteria 2862
691 Ga0501047_0112023 3300049581 Bacteria 2611
692 Ga0501047_0309809 3300049581 Bacteria 1419
693 Ga0501067_0000691 3300049583 Bacteria 18172
694 Ga0501067_0029083 3300049583 Bacteria 3063
695 Ga0501068_0002506 3300049584 Bacteria 9753
696 Ga0501068_0038218 3300049584 Bacteria 2875
697 Ga0501070_0059597 3300049586 Bacteria 3164
698 Ga0501070_0152036 3300049586 Bacteria 1910
699 Ga0501071_0025739 3300049587 Bacteria 4123
700 Ga0501071_0152743 3300049587 Bacteria 1723
701 Ga0501071_0295264 3300049587 Bacteria 1228
702 Ga0501071_0412368 3300049587 Bacteria 1032
703 Ga0501072_0009547 3300049588 Bacteria 7378
704 Ga0501072_0012316 3300049588 Bacteria 6536
705 Ga0501072_0016364 3300049588 Bacteria 5692
706 Ga0501072_0074329 3300049588 Bacteria 2687
707 Ga0501072_0311596 3300049588 Bacteria 1251
708 Ga0501073_0000008 3300049589 Bacteria 204458
709 Ga0501073_0016295 3300049589 Bacteria 5385
710 Ga0501074_0049875 3300049590 Bacteria 3022
711 Ga0501074_0172885 3300049590 Bacteria 1542
712 Ga0501075_0004641 3300049591 Bacteria 9323
713 Ga0501075_0113816 3300049591 Bacteria 2057
714 Ga0501076_0082886 3300049592 Bacteria 2575
715 Ga0501077_0000029 3300049593 Bacteria 72357
716 Ga0501077_0052930 3300049593 Bacteria 2577
717 Ga0501079_0105952 3300049741 Bacteria 2182
718 Ga0501080_0003545 3300049742 Bacteria 13752
719 Ga0501080_0066796 3300049742 Bacteria 3344
720 Ga0501080_0099380 3300049742 Bacteria 2700
721 Ga0501083_0180738 3300049744 Bacteria 1377
722 Ga0501035_0016275 3300049822 Bacteria 6861
723 Ga0501035_0040539 3300049822 Bacteria 4207
724 Ga0501035_0047769 3300049822 Bacteria 3841
725 Ga0501035_0120690 3300049822 Bacteria 2292
726 Ga0501035_0133541 3300049822 Bacteria 2162
727 Ga0501035_0369271 3300049822 Bacteria 1198
728 Ga0501044_0000878 3300049823 Bacteria 36229
729 Ga0501044_0000909 3300049823 Bacteria 35611
730 Ga0501044_0003119 3300049823 Bacteria 18782
731 Ga0501044_0013327 3300049823 Bacteria 8898
732 Ga0501044_0023625 3300049823 Bacteria 6536
733 Ga0501044_0045140 3300049823 Bacteria 4569
734 Ga0501044_0419977 3300049823 Bacteria 1247
735 nmdc:mga00v17_1417_c2 3300050491 Bacteria 1783
736 nmdc:mga0k408_21017_c1 3300050493 Bacteria 3663
737 nmdc:mga06z11_58424_c1 3300050494 Bacteria 2001
738 nmdc:mga07m45_2901_c1 3300050496 Bacteria 8127
739 nmdc:mga07m45_32145_c1 3300050496 Bacteria 2910
740 nmdc:mga05p37_67713_c1 3300050507 Bacteria 4392
741 nmdc:mga09592_133425_c1 3300050508 Bacteria 2138
742 nmdc:mga0qj67_123304_c1 3300050509 Bacteria 2096
743 nmdc:mga0qj67_37_c1 3300050509 Bacteria 92978
744 nmdc:mga0qj67_43465_c1 3300050509 Bacteria 3538
745 nmdc:mga08y16_267194_c1 3300050511 Bacteria 1766
746 nmdc:mga08y16_282679_c1 3300050511 Bacteria 1711
747 nmdc:mga08y16_290251_c1 3300050511 Bacteria 1686
748 nmdc:mga0rr50_530496_c1 3300050513 Bacteria 1002
749 nmdc:mga0rr50_65508_c1 3300050513 Bacteria 2752
750 nmdc:mga08x19_50883_c1 3300050514 Bacteria 2659
751 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
752 nmdc:mga0a205_22285_c2 3300050515 Bacteria 5408
753 nmdc:mga0a205_370820_c1 3300050515 Bacteria 1297
754 nmdc:mga0a205_399441_c1 3300050515 Bacteria 1238
755 Ga0495601_0002074 3300053077 Bacteria 11250
756 Ga0495601_0013016 3300053077 Bacteria 4998
757 Ga0495601_0021475 3300053077 Bacteria 3954
758 Ga0495601_0028607 3300053077 Bacteria 3452
759 Ga0495601_0029696 3300053077 Bacteria 3393
760 Ga0495612_0000056 3300053078 Bacteria 50144
761 Ga0495612_0107197 3300053078 Bacteria 1193
762 Ga0495655_0013964 3300053083 Bacteria 1674
763 Ga0495595_0001109 3300053084 Bacteria 10439
764 Ga0495595_0167969 3300053084 Bacteria 1085
765 Ga0495619_0002023 3300053085 Bacteria 13480
766 Ga0495619_0037801 3300053085 Bacteria 3148
767 Ga0495619_0135813 3300053085 Bacteria 1692
768 Ga0500651_0236583 3300053093 Bacteria 1066
769 Ga0500566_0020100 3300053094 Bacteria 3923
770 Ga0500641_0009037 3300053096 Bacteria 3574
771 Ga0500555_007355 3300053103 Bacteria 3128
772 Ga0500556_0002668 3300053104 Bacteria 5560
773 Ga0500562_000897 3300053108 Bacteria 7240
774 Ga0500562_006617 3300053108 Bacteria 2920
775 Ga0500569_001333 3300053109 Bacteria 4624
776 Ga0500572_001806 3300053111 Bacteria 5478
777 Ga0500593_000044 3300053117 Bacteria 45032
778 Ga0500595_007231 3300053119 Bacteria 4620
779 Ga0500595_031275 3300053119 Bacteria 1787
780 Ga0500608_000842 3300053122 Bacteria 11112
781 Ga0500614_002256 3300053123 Bacteria 4345
782 Ga0500642_0073828 3300053130 Bacteria 1556
783 Ga0500652_079690 3300053131 Bacteria 1363
784 Ga0500559_0000018 3300053136 Bacteria 140924
785 Ga0500559_0022529 3300053136 Bacteria 2671
786 Ga0500559_0048026 3300053136 Bacteria 1876
787 Ga0500564_088486 3300053138 Bacteria 1381
788 Ga0500568_0000004 3300053139 Bacteria 621666
789 Ga0500590_006787 3300053148 Bacteria 5603
790 Ga0500616_0061973 3300053153 Bacteria 1934
791 Ga0500616_0062741 3300053153 Bacteria 1919
792 Ga0500616_0076722 3300053153 Bacteria 1689
793 Ga0500637_0018468 3300053178 Bacteria 3747
794 Ga0500625_021470 3300053729 Bacteria 3044
795 Ga0500645_003850 3300053730 Bacteria 5943
796 Ga0500645_004813 3300053730 Bacteria 5098
797 Ga0500596_000126 3300053735 Bacteria 11116
798 Ga0501084_0030700 3300054114 Bacteria 4493
799 Ga0501084_0333050 3300054114 Bacteria 1282
800 Ga0501082_0000010 3300060353 Bacteria 122899
801 Ga0501082_0025840 3300060353 Bacteria 5062
802 Ga0501082_0078903 3300060353 Bacteria 2840
803 Ga0501082_0252343 3300060353 Bacteria 1535
804 Ga0501082_0255467 3300060353 Bacteria 1525
805 Ga0501082_0501680 3300060353 Bacteria 1061
806 Ga0501082_0564916 3300060353 Bacteria 995
807 Ga0530510_0017181 3300061734 Bacteria 5125
808 Ga0530510_0278041 3300061734 Bacteria 1250
809 2513591971 2513237087 Bacteria 5817514
810 2644000603 2643221598 Bacteria 4578346
811 2644088442 2643221614 Bacteria 4260023
812 2644290707 2643221651 Bacteria 4798932
813 2644343678 2643221661 Bacteria 4267604
814 2644368844 2643221666 Bacteria 4265935
815 2739309828 2738543024 Bacteria 5603683
816 2828306277 2828305725 Bacteria 4916900
817 2842700104 2842698319 Bacteria 5190321
818 2889793154 2889790730 Bacteria 5689708
819 2889917614 2889914905 Bacteria 5702301
820 2894818500 2894817345 Bacteria 4892941
821 3005483508 3005474847 Bacteria 9259049
822 Ga0496109_0072420
823 JGI25406J46586_10013258
824 Ga0055530_10005059
825 Ga0055531_10004151
826 Ga0065165_1002581
827 Ga0070658_10013925
828 Ga0070658_10028776
829 Ga0070676_10030532
830 Ga0070676_10105361
831 Ga0070690_100003947
832 Ga0070670_100000044
833 Ga0070670_100095221
834 Ga0070670_100325084
835 Ga0070677_10022151
836 Ga0068869_100007205
837 Ga0070666_10034231
838 Ga0070666_10090300
839 Ga0070666_10230191
840 Ga0070680_100006085
841 Ga0070680_100161079
842 Ga0070682_100031416
843 Ga0068868_100089101
844 Ga0068868_100132083
845 Ga0070660_100035420
846 Ga0070660_100113000
847 Ga0070660_100217064
848 Ga0070689_100006271
849 Ga0070691_10010903
850 Ga0070661_100001446
851 Ga0070668_100000098
852 Ga0070668_100002191
853 Ga0070668_100015032
854 Ga0070669_100004579
855 Ga0070669_100155405
856 Ga0070675_100257155
857 Ga0070671_100000497
858 Ga0070671_100012906
859 Ga0070671_100017745
860 Ga0070671_100036146
861 Ga0070671_100054333
862 Ga0070674_100002246
863 Ga0070674_100110818
864 Ga0070673_100001599
865 Ga0070673_100026478
866 Ga0070673_100089597
867 Ga0070688_100007704
868 Ga0070659_100002646
869 Ga0070659_100010511
870 Ga0070659_100019787
871 Ga0070659_100055064
872 Ga0070667_100003729
873 Ga0070667_100004554
874 Ga0070667_100008872
875 Ga0070667_100016357
876 Ga0070667_100034910
877 Ga0070667_100036831
878 Ga0070709_10003085
879 Ga0070709_10138429
880 Ga0070714_100059095
881 Ga0070714_100252853
882 Ga0070713_100034420
883 Ga0070710_10004649
884 Ga0070710_10054482
885 Ga0070710_10106608
886 Ga0070711_100132115
887 Ga0070711_100141020
888 Ga0070705_100064068
889 Ga0070694_100168184
890 Ga0070663_100019491
891 Ga0070662_100081004
892 Ga0070662_100145530
893 Ga0070681_10012011
894 Ga0070681_10017074
895 Ga0070681_10104661
896 Ga0068867_100008051
897 Ga0068867_100023806
898 Ga0070685_10057576
899 Ga0070698_100073412
900 Ga0070679_100006711
901 Ga0070679_100016884
902 Ga0070679_100032803
903 Ga0070679_100073782
904 Ga0070697_100017315
905 Ga0068853_100004404
906 Ga0068853_100061818
907 Ga0070686_100070111
908 Ga0070686_100107982
909 Ga0070696_100004697
910 Ga0070665_100000762
911 Ga0070665_100000831
912 Ga0070665_100002025
913 Ga0070665_100256952
914 Ga0070665_100482311
915 Ga0070704_100227710
916 Ga0068855_100040248
917 Ga0068855_100042296
918 Ga0068855_100074441
919 Ga0068855_100172155
920 Ga0068855_100205087
921 Ga0068855_100317984
922 Ga0068857_100101957
923 Ga0068857_100184468
924 Ga0068854_100007798
925 Ga0068854_100122136
926 Ga0068856_100024803
927 Ga0068856_100256483
928 Ga0068852_100009678
929 Ga0068852_100015002
930 Ga0068852_100067226
931 Ga0068859_100000231
932 Ga0068859_100007203
933 Ga0068864_100000060
934 Ga0068864_100000061
935 Ga0068864_100015964
936 Ga0068864_100024083
937 Ga0068864_100066194
938 Ga0068861_100017580
939 Ga0068861_100422864
940 Ga0068851_10001676
941 Ga0068863_100000023
942 Ga0068863_100000810
943 Ga0068863_100006931
944 Ga0068863_100377190
945 Ga0068858_100000184
946 Ga0068858_100003504
947 Ga0068858_100004308
948 Ga0068858_100023690
949 Ga0068858_100136549
950 Ga0068860_100000100
951 Ga0068860_100000122
952 Ga0068860_100004300
953 Ga0068862_100006370
954 Ga0068862_100097668
955 Ga0068862_100287207
956 Ga0081455_10122481
957 Ga0081455_10182224
958 Ga0081538_10019682
959 Ga0081540_1000005
960 Ga0081539_10001341
961 Ga0070717_10010974
962 Ga0070717_10114965
963 Ga0075365_10012223
964 Ga0075365_10105027
965 Ga0075368_10013467
966 Ga0075363_100102279
967 Ga0075364_10000160
968 Ga0070715_10005056
969 Ga0070716_100032077
970 Ga0070712_100033651
971 Ga0070712_100046978
972 Ga0070712_100124392
973 Ga0075367_10043383
974 Ga0075366_10001106
975 Ga0097621_100135651
976 Ga0075370_10054187
977 Ga0068871_100131098
978 Ga0068871_100153079
979 Ga0075430_100001664
980 Ga0075430_100036710
981 Ga0075430_100045419
982 Ga0075430_100060215
983 Ga0075431_100206111
984 Ga0075433_10036706
985 Ga0075434_100054347
986 Ga0075429_100002435
987 Ga0068865_100002419
988 Ga0068865_100137080
989 Ga0068865_100300974
990 Ga0075436_100010291
991 Ga0075436_100044482
992 Ga0097620_100000231
993 Ga0097620_100007203
994 Ga0075435_100192276
995 Ga0099795_10013325
996 Ga0105240_10002285
997 Ga0105240_10027302
998 Ga0105240_10161862
999 Ga0105240_10197701
1000 Ga0105240_10217886
1001 Ga0111539_10019416
1002 Ga0111539_10176877
1003 Ga0111539_10321187
1004 Ga0105245_10050003
1005 Ga0105247_10074349
1006 Ga0105247_10136678
1007 Ga0114129_10055349
1008 Ga0105241_10032577
1009 Ga0105248_10000279
1010 Ga0105248_10015107
1011 Ga0105248_10016683
1012 Ga0105248_10016737
1013 Ga0105248_10200674
1014 Ga0105237_10369440
1015 Ga0105238_10027382
1016 Ga0105238_10048775
1017 Ga0105238_10132158
1018 Ga0105249_10014102
1019 Ga0105249_10236807
1020 Ga0099796_10001765
1021 Ga0099796_10004606
1022 Ga0105239_10013959
1023 Ga0105239_10065192
1024 Ga0105239_10080254
1025 Ga0105239_10122138
1026 Ga0157373_10031787
1027 Ga0157371_10014768
1028 Ga0157371_10115583
1029 Ga0157370_10003380
1030 Ga0157370_10029718
1031 Ga0157370_10084836
1032 Ga0157370_10160586
1033 Ga0157369_10108496
1034 Ga0163162_10088453
1035 Ga0163162_10226846
1036 Ga0163162_10338267
1037 Ga0157372_10027766
1038 Ga0157372_10032887
1039 Ga0157375_10098846
1040 Ga0163163_10043821
1041 Ga0163163_10133829
1042 Ga0163163_10304061
1043 Ga0157380_10229057
1044 Ga0157380_10238135
1045 Ga0157380_10388431
1046 Ga0157379_10012083
1047 Ga0157379_10111262
1048 Ga0163161_10120616
1049 Ga0213874_10013464
1050 Ga0213876_10019673
1051 Ga0209026_1005312
1052 Ga0209026_1009377
1053 Ga0209148_1001435
1054 Ga0209148_1002626
1055 Ga0209758_1000430
1056 Ga0209758_1001067
1057 Ga0209050_1000098
1058 Ga0209257_1000221
1059 Ga0209257_1004498
1060 Ga0207656_10011311
1061 Ga0207682_10003834
1062 Ga0207680_10030166
1063 Ga0207680_10030196
1064 Ga0207647_10241102
1065 Ga0207645_10004551
1066 Ga0207645_10037006
1067 Ga0207645_10101160
1068 Ga0207643_10121081
1069 Ga0207705_10003181
1070 Ga0207705_10003909
1071 Ga0207654_10015995
1072 Ga0207654_10177629
1073 Ga0207707_10025158
1074 Ga0207707_10030967
1075 Ga0207707_10083476
1076 Ga0207707_10321714
1077 Ga0207695_10002540
1078 Ga0207695_10004869
1079 Ga0207695_10026041
1080 Ga0207695_10096452
1081 Ga0207695_10337110
1082 Ga0207671_10438277
1083 Ga0207693_10000787
1084 Ga0207693_10014625
1085 Ga0207693_10059645
1086 Ga0207693_10085389
1087 Ga0207693_10088252
1088 Ga0207663_10154644
1089 Ga0207660_10014784
1090 Ga0207660_10028003
1091 Ga0207662_10102755
1092 Ga0207657_10003993
1093 Ga0207657_10074018
1094 Ga0207657_10083000
1095 Ga0207657_10094864
1096 Ga0207649_10024458
1097 Ga0207652_10004635
1098 Ga0207652_10025068
1099 Ga0207652_10045774
1100 Ga0207652_10307230
1101 Ga0207681_10001188
1102 Ga0207681_10095626
1103 Ga0207694_10034155
1104 Ga0207694_10067466
1105 Ga0207694_10130110
1106 Ga0207694_10193380
1107 Ga0207650_10000065
1108 Ga0207650_10064096
1109 Ga0207650_10073794
1110 Ga0207650_10193941
1111 Ga0207687_10089476
1112 Ga0207687_10174718
1113 Ga0207700_10006999
1114 Ga0207700_10025273
1115 Ga0207664_10070244
1116 Ga0207664_10139282
1117 Ga0207644_10002707
1118 Ga0207644_10006071
1119 Ga0207644_10182604
1120 Ga0207690_10001133
1121 Ga0207690_10036533
1122 Ga0207690_10050959
1123 Ga0207706_10083773
1124 Ga0207706_10091402
1125 Ga0207706_10123983
1126 Ga0207706_10126882
1127 Ga0207709_10226556
1128 Ga0207670_10004720
1129 Ga0207670_10006011
1130 Ga0207670_10124316
1131 Ga0207669_10001250
1132 Ga0207704_10008976
1133 Ga0207665_10000117
1134 Ga0207691_10004922
1135 Ga0207711_10000684
1136 Ga0207711_10005226
1137 Ga0207711_10009716
1138 Ga0207711_10095145
1139 Ga0207689_10107370
1140 Ga0207679_10396633
1141 Ga0207667_10033644
1142 Ga0207667_10038111
1143 Ga0207667_10050024
1144 Ga0207667_10091205
1145 Ga0207667_10149280
1146 Ga0207651_10027327
1147 Ga0207651_10251546
1148 Ga0207712_10012792
1149 Ga0207668_10000018
1150 Ga0207668_10000340
1151 Ga0207668_10002444
1152 Ga0207668_10008059
1153 Ga0207668_10030812
1154 Ga0207640_10029818
1155 Ga0207640_10097395
1156 Ga0207640_10102027
1157 Ga0207640_10105606
1158 Ga0207658_10000168
1159 Ga0207658_10003273
1160 Ga0207658_10011028
1161 Ga0207658_10095180
1162 Ga0207658_10107507
1163 Ga0207677_10092168
1164 Ga0207703_10000273
1165 Ga0207703_10003313
1166 Ga0207703_10007240
1167 Ga0207703_10069866
1168 Ga0207703_10166334
1169 Ga0207703_10483466
1170 Ga0207639_10005874
1171 Ga0207639_10025958
1172 Ga0207678_10007031
1173 Ga0207678_10278501
1174 Ga0207678_10392079
1175 Ga0207708_10220677
1176 Ga0207702_10028812
1177 Ga0207702_10063897
1178 Ga0207702_10226237
1179 Ga0207702_10304951
1180 Ga0207641_10000067
1181 Ga0207641_10001551
1182 Ga0207641_10011364
1183 Ga0207641_10022554
1184 Ga0207641_10326215
1185 Ga0207648_10002948
1186 Ga0207648_10033201
1187 Ga0207676_10000127
1188 Ga0207676_10000501
1189 Ga0207676_10011585
1190 Ga0207676_10011837
1191 Ga0207674_10029426
1192 Ga0207674_10169699
1193 Ga0207674_10211175
1194 Ga0207675_100510238
1195 Ga0207683_10037355
1196 Ga0207698_10070871
1197 Ga0207698_10301594
1198 Ga0209981_1000385
1199 Ga0209179_1000737
1200 Ga0209999_1006024
1201 Ga0209813_10001517
1202 Ga0207428_10130483
1203 Ga0268266_10000003
1204 Ga0268266_10007459
1205 Ga0268266_10008942
1206 Ga0268266_10051971
1207 Ga0268266_10060923
1208 Ga0268265_10001199
1209 Ga0268265_10002874
1210 Ga0268265_10088418
1211 Ga0268265_10157050
1212 Ga0268265_10280705
1213 Ga0268264_10000002
1214 Ga0268264_10000172
1215 Ga0268264_10140577
1216 Ga0307517_10001099
1217 Ga0307517_10017425
1218 Ga0265338_10013082
1219 Ga0265338_10033080
1220 Ga0307511_10042056
1221 Ga0265332_10025083
1222 Ga0265325_10001782
1223 Ga0265325_10010617
1224 Ga0265325_10123382
1225 Ga0265340_10017200
1226 Ga0265340_10017957
1227 Ga0265339_10000101
1228 Ga0265327_10110094
1229 Ga0307513_10003813
1230 Ga0307513_10007922
1231 Ga0307513_10015171
1232 Ga0307513_10138070
1233 Ga0265313_10000548
1234 Ga0265313_10063649
1235 Ga0316579_10000778
1236 Ga0307516_10000020
1237 Ga0307416_100288231
1238 Ga0307510_10013355
1239 Ga0373926_0025167
1240 Ga0373929_0006916
1241 Ga0373944_0002067
1242 Ga0373944_0013160
1243 Ga0373952_0031570
1244 Ga0373952_0032546
1245 Ga0373923_0095981
1246 Ga0373936_0020232
1247 Ga0373945_0032897
1248 Ga0373954_0008692
1249 Ga0373954_0018837
1250 Ga0373954_0072032
1251 Ga0373957_0042446
1252 Ga0373943_0001239
1253 Ga0373943_0036272
1254 Ga0373946_0000841
1255 Ga0373946_0034936
1256 Ga0373946_0108442
1257 Ga0373955_0002732
1258 Ga0373924_0016745
1259 Ga0373931_0007577
1260 Ga0373931_0015115
1261 Ga0373935_0014244
1262 Ga0373935_0026355
1263 Ga0373935_0065547
1264 Ga0373935_0211620
1265 Ga0373927_0001609
1266 Ga0373927_0002779
1267 Ga0373927_0012344
1268 Ga0373927_0024145
1269 Ga0373927_0202531
1270 Ga0373933_0001709
1271 Ga0373933_0028734
1272 Ga0373947_0001204
1273 Ga0373947_0084188
1274 Ga0373937_0000959
1275 Ga0373937_0009056
1276 Ga0373937_0145612
1277 Ga0373937_0408257
1278 Ga0373937_0431506
1279 Ga0373937_0526406
1280 Ga0373925_0000277
1281 Ga0373925_0007493
1282 Ga0373925_0011790
1283 Ga0373925_0032343
1284 Ga0373925_0126825
1285 Ga0395899_0000847
1286 Ga0395899_0272677
1287 Ga0395899_0296182
1288 Ga0395900_0000016
1289 Ga0395898_0025733
1290 Ga0395898_0115706
1291 Ga0395905_0008634
1292 Ga0395905_0034525
1293 Ga0395905_0206247
1294 Ga0436364_1039680
1295 Ga0395901_0000028
1296 Ga0395901_0067598
1297 Ga0400483_185390
1298 Ga0436365_0392568
1299 Ga0436365_0513635
1300 Ga0436365_0996971
1301 Ga0436365_1199935
1302 Ga0436365_1750823
1303 Ga0436361_0115059
1304 Ga0436363_0093454
1305 Ga0439448_0007095
1306 Ga0439459_0033545
1307 Ga0450893_0016054
1308 Ga0451577_0245810
1309 Ga0439440_0025807
1310 Ga0466963_0004016
1311 Ga0466963_0021477
1312 Ga0466963_0093046
1313 Ga0466963_0118151
1314 Ga0453684_0296846
1315 Ga0466957_0008453
1316 Ga0451576_0000040
1317 Ga0466958_0068378
1318 Ga0466967_0000138
1319 Ga0466967_0059354
1320 Ga0495627_000159
1321 Ga0495592_0022037
1322 Ga0495629_0003800
1323 Ga0495629_0056511
1324 Ga0495629_0105936
1325 Ga0495629_0171091
1326 Ga0495638_0148328
1327 Ga0495651_0002695
1328 Ga0495651_0024559
1329 Ga0495653_0001872
1330 Ga0495653_0110753
1331 Ga0495639_0122245
1332 Ga0495662_0009056
1333 Ga0495664_0000631
1334 Ga0495664_0078913
1335 Ga0495664_0112334
1336 Ga0495594_0159559
1337 Ga0495583_0028737
1338 Ga0495608_0007164
1339 Ga0495608_0026684
1340 Ga0495618_0001463
1341 Ga0495620_0010489
1342 Ga0495628_0007565
1343 Ga0495628_0285800
1344 Ga0495630_0013814
1345 Ga0495630_0034773
1346 Ga0495630_0128850
1347 Ga0495630_0182916
1348 Ga0495643_0126022
1349 Ga0495663_0033621
1350 Ga0495642_0001670
1351 Ga0495642_0046681
1352 Ga0495652_0012913
1353 Ga0495652_0049311
1354 Ga0495665_0007546
1355 Ga0495665_0057883
1356 Ga0495640_0000714
1357 Ga0495640_0003726
1358 Ga0495587_0027422
1359 Ga0495587_0060555
1360 Ga0495598_0008478
1361 Ga0495645_0000575
1362 Ga0495645_0046048
1363 Ga0495622_0020935
1364 Ga0495667_0002333
1365 Ga0495667_0076143
1366 Ga0495656_0026349
1367 Ga0495668_0002197
1368 Ga0495668_0027431
1369 Ga0495668_0049763
1370 Ga0495634_0001265
1371 Ga0495634_0003291
1372 Ga0495634_0009075
1373 Ga0495634_0160514
1374 Ga0495611_0007425
1375 Ga0495625_0088184
1376 Ga0495635_0000771
1377 Ga0495635_0000918
1378 Ga0495635_0118280
1379 Ga0495635_0153149
1380 Ga0495588_0211367
1381 Ga0495657_0027157
1382 Ga0495657_0187290
1383 Ga0495623_0003265
1384 Ga0495623_0012214
1385 Ga0495658_0009500
1386 Ga0495658_0121214
1387 Ga0495669_0000005
1388 Ga0495669_0000356
1389 Ga0495669_0010448
1390 Ga0495669_0029323
1391 Ga0495613_0042399
1392 Ga0495613_0053034
1393 Ga0495613_0091514
1394 Ga0495624_0012655
1395 Ga0495600_0001241
1396 Ga0495604_0000130
1397 Ga0495604_0037116
1398 Ga0495674_0003371
1399 Ga0495674_0026761
1400 Ga0495672_0036212
1401 Ga0495672_0063253
1402 Ga0495676_0137124
1403 Ga0495680_0000701
1404 Ga0495680_0160075
1405 Ga0495687_041745
1406 Ga0495675_0023318
1407 Ga0495675_0054090
1408 Ga0495677_0002371
1409 Ga0495685_031603
1410 Ga0495684_0018296
1411 Ga0495686_0000134
1412 Ga0495686_0032777
1413 Ga0495593_0013246
1414 Ga0495593_0030305
1415 Ga0495602_0002441
1416 Ga0495602_0024309
1417 Ga0495602_0225080
1418 Ga0496100_0280250
1419 Ga0496101_0002031
1420 Ga0496101_0038096
1421 Ga0496101_0138270
1422 Ga0496102_0016745
1423 Ga0496102_0032897
1424 Ga0496102_0044054
1425 Ga0496102_0088304
1426 Ga0496103_0113617
1427 Ga0496104_0001419
1428 Ga0496104_0001499
1429 Ga0496104_0017387
1430 Ga0496104_0018342
1431 Ga0496104_0173445
1432 Ga0496104_0337094
1433 Ga0496105_0010619
1434 Ga0496105_0234953
1435 Ga0496105_0330342
1436 Ga0496105_0378385
1437 Ga0496106_0037312
1438 Ga0496106_0076746
1439 Ga0496106_0138851
1440 Ga0496106_0235231
1441 Ga0496107_0040633
1442 Ga0496107_0076366
1443 Ga0496107_0080448
1444 Ga0496107_0211959
1445 Ga0496107_0377632
1446 Ga0496108_0021301
1447 Ga0496108_0148022
1448 Ga0496108_0246113
1449 Ga0496109_0006507
1450 Ga0496109_0071276
1451 Ga0496109_0204285
1452 Ga0496109_0249034
1453 Ga0496109_0392421
1454 Ga0496110_0140811
1455 Ga0496110_0515042
1456 Ga0496111_0303478
1457 Ga0496112_0041029
1458 Ga0496112_0053208
1459 Ga0496112_0063830
1460 Ga0496112_0081641
1461 Ga0496112_0195406
1462 Ga0496114_0011438
1463 Ga0496114_0378072
1464 Ga0496115_0015358
1465 Ga0496115_0052116
1466 Ga0496115_0117746
1467 Ga0496115_0119661
1468 Ga0496115_0191835
1469 Ga0496117_0008365
1470 Ga0496118_0017509
1471 Ga0496119_0001362
1472 Ga0496119_0005397
1473 Ga0496121_0000053
1474 Ga0496121_0049046
1475 Ga0496122_0008006
1476 Ga0496123_0001238
1477 Ga0501031_0003183
1478 Ga0501031_0004683
1479 Ga0501031_0045743
1480 Ga0501032_0000278
1481 Ga0501032_0005549
1482 Ga0501032_0009956
1483 Ga0501033_0011636
1484 Ga0501033_0047650
1485 Ga0501034_0038681
1486 Ga0501034_0127301
1487 Ga0501034_0283865
1488 Ga0501034_0284199
1489 Ga0501034_0353913
1490 Ga0501034_0362196
1491 Ga0501034_0449579
1492 Ga0501036_0020497
1493 Ga0501036_0318641
1494 Ga0501037_0005407
1495 Ga0501037_0016422
1496 Ga0501037_0046733
1497 Ga0501037_0084701
1498 Ga0501037_0177063
1499 Ga0501038_0002487
1500 Ga0501038_0017203
1501 Ga0501038_0028216
1502 Ga0501038_0297076
1503 Ga0501039_0134505
1504 Ga0501039_0376353
1505 Ga0501043_0003959
1506 Ga0501043_0007512
1507 Ga0501043_0043780
1508 Ga0501047_0012392
1509 Ga0501047_0035166
1510 Ga0501047_0035960
1511 Ga0501047_0094898
1512 Ga0501047_0112023
1513 Ga0501047_0309809
1514 Ga0501067_0000691
1515 Ga0501067_0029083
1516 Ga0501068_0002506
1517 Ga0501068_0038218
1518 Ga0501070_0059597
1519 Ga0501070_0152036
1520 Ga0501071_0025739
1521 Ga0501071_0152743
1522 Ga0501071_0295264
1523 Ga0501071_0412368
1524 Ga0501072_0009547
1525 Ga0501072_0012316
1526 Ga0501072_0016364
1527 Ga0501072_0074329
1528 Ga0501072_0311596
1529 Ga0501073_0000008
1530 Ga0501073_0016295
1531 Ga0501074_0049875
1532 Ga0501074_0172885
1533 Ga0501075_0004641
1534 Ga0501075_0113816
1535 Ga0501076_0082886
1536 Ga0501077_0000029
1537 Ga0501077_0052930
1538 Ga0501079_0105952
1539 Ga0501080_0003545
1540 Ga0501080_0066796
1541 Ga0501080_0099380
1542 Ga0501083_0180738
1543 Ga0501035_0016275
1544 Ga0501035_0040539
1545 Ga0501035_0047769
1546 Ga0501035_0120690
1547 Ga0501035_0133541
1548 Ga0501035_0369271
1549 Ga0501044_0000878
1550 Ga0501044_0000909
1551 Ga0501044_0003119
1552 Ga0501044_0013327
1553 Ga0501044_0023625
1554 Ga0501044_0045140
1555 Ga0501044_0419977
1556 nmdc:mga00v17_1417_c2
1557 nmdc:mga0k408_21017_c1
1558 nmdc:mga06z11_58424_c1
1559 nmdc:mga07m45_2901_c1
1560 nmdc:mga07m45_32145_c1
1561 nmdc:mga05p37_67713_c1
1562 nmdc:mga09592_133425_c1
1563 nmdc:mga0qj67_123304_c1
1564 nmdc:mga0qj67_37_c1
1565 nmdc:mga0qj67_43465_c1
1566 nmdc:mga08y16_267194_c1
1567 nmdc:mga08y16_282679_c1
1568 nmdc:mga08y16_290251_c1
1569 nmdc:mga0rr50_530496_c1
1570 nmdc:mga0rr50_65508_c1
1571 nmdc:mga08x19_50883_c1
1572 nmdc:mga08x19_6_c1
1573 nmdc:mga0a205_22285_c2
1574 nmdc:mga0a205_370820_c1
1575 nmdc:mga0a205_399441_c1
1576 Ga0495601_0002074
1577 Ga0495601_0013016
1578 Ga0495601_0021475
1579 Ga0495601_0028607
1580 Ga0495601_0029696
1581 Ga0495612_0000056
1582 Ga0495612_0107197
1583 Ga0495655_0013964
1584 Ga0495595_0001109
1585 Ga0495595_0167969
1586 Ga0495619_0002023
1587 Ga0495619_0037801
1588 Ga0495619_0135813
1589 Ga0500651_0236583
1590 Ga0500566_0020100
1591 Ga0500641_0009037
1592 Ga0500555_007355
1593 Ga0500556_0002668
1594 Ga0500562_000897
1595 Ga0500562_006617
1596 Ga0500569_001333
1597 Ga0500572_001806
1598 Ga0500593_000044
1599 Ga0500595_007231
1600 Ga0500595_031275
1601 Ga0500608_000842
1602 Ga0500614_002256
1603 Ga0500642_0073828
1604 Ga0500652_079690
1605 Ga0500559_0000018
1606 Ga0500559_0022529
1607 Ga0500559_0048026
1608 Ga0500564_088486
1609 Ga0500568_0000004
1610 Ga0500590_006787
1611 Ga0500616_0061973
1612 Ga0500616_0062741
1613 Ga0500616_0076722
1614 Ga0500637_0018468
1615 Ga0500625_021470
1616 Ga0500645_003850
1617 Ga0500645_004813
1618 Ga0500596_000126
1619 Ga0501084_0030700
1620 Ga0501084_0333050
1621 Ga0501082_0000010
1622 Ga0501082_0025840
1623 Ga0501082_0078903
1624 Ga0501082_0252343
1625 Ga0501082_0255467
1626 Ga0501082_0501680
1627 Ga0501082_0564916
1628 Ga0530510_0017181
1629 Ga0530510_0278041
1630 2513591971
1631 2644000603
1632 2644088442
1633 2644290707
1634 2644343678
1635 2644368844
1636 2739309828
1637 2828306277
1638 2842700104
1639 2889793154
1640 2889917614
1641 2894818500
1642 3005483508

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

43

343

0.98

PF01039

Carboxyl_trans

Carboxyl transferase domain

76

295

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9431 4 313
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9394 3 310
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9383 5 313
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9377 2 311
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9279 4 313
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9532 4 313 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9385 4 313 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9155 53 313 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9053 53 313 3.90.226.10
5iniB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8105 53 296 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A4Q5Z6L7-F1-model_v4 deleted 0.9836 212 310
AF-A0A536GMN9-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9742 210 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A560D570-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9738 1 314 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A562KXJ5-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9737 1 316 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A2E1VRP1-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9737 4 314 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Map