F482273

General Info

Members Datasets Scaffolds Average Seq Length
821 423 1642 101

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0040636|Ga0501032_0040636_633_974
Length 113
Sequence LLGDSIKEEVNSLVSLSHYLVLGAVLFAIGIVGIFLNRKNVIIILMSIELMLLAVNMNFVAFSHYLQDISGQIFVFFILTVAAAESAIGLAILVVLFRNQQTINVDDLDKLKG

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
112 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
215 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
254 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
255 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
259 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
260 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
270 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
280 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
281 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
282 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
283 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
284 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
285 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
308 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
341 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
342 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
343 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
363 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
364 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
365 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
366 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
369 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
370 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
371 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
372 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
383 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
392 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
394 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 2547132512 Azospira oryzae 6a3 Isolate Unclassified
407 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
408 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
409 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
410 2738541297 Duganella sp. GV083 Isolate Unclassified
411 2738541357 Duganella sp. GV053 Isolate Unclassified
412 2738543003 Duganella sp. GV066 Isolate Unclassified
413 2738543026 Duganella sp. GV089 Isolate Unclassified
414 2738543029 Duganella sp. GV039 Isolate Unclassified
415 2821131069 Duganella sp. 1224 Isolate Unclassified
416 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
417 2857564685 Duganella sp. R-74599 Isolate Unclassified
418 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
419 2885266251 Ralstonia sp. SET104 Isolate Nodule
420 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
421 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
422 2928058823 Ralstonia sp. 1138 Isolate Unclassified
423 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.15
Metatranscriptomes 3.65
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.6
Nodule 0.37
Rhizoplane 3.41
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0040636 3300049569 Bacteria 3161
2 JGI24741J21665_1000152 3300001915 Bacteria 19659
3 JGI24740J21852_10000682 3300001979 Bacteria 14718
4 JGI24740J21852_10005259 3300001979 Bacteria 5494
5 JGI25156J39149_1005831 3300002705 Bacteria 3479
6 JGI25156J39149_1009597 3300002705 Bacteria 2338
7 JGI25154J39366_1001844 3300002738 Bacteria 6472
8 JGI25157J39369_1008788 3300002741 Bacteria 1388
9 Ga0006556J51387_1039703 3300003479 Bacteria 3334
10 Ga0055538_1004147 3300003751 Bacteria 1693
11 Ga0055538_1007419 3300003751 Bacteria 990
12 Ga0055539_1000095 3300003752 Bacteria 102639
13 Ga0055539_1027922 3300003752 Bacteria 649
14 Ga0055533_1004171 3300003756 Bacteria 2679
15 Ga0055533_1011122 3300003756 Bacteria 990
16 Ga0055532_1000058 3300003758 Bacteria 153303
17 Ga0055525_1000379 3300003759 Bacteria 29078
18 Ga0055525_1016883 3300003759 Bacteria 619
19 Ga0055527_1001095 3300003760 Bacteria 6353
20 Ga0055535_1000041 3300003761 Bacteria 153303
21 Ga0055542_1002640 3300003762 Bacteria 5614
22 Ga0055542_1021709 3300003762 Bacteria 922
23 Ga0055529_1000077 3300003763 Bacteria 153303
24 Ga0055526_1021364 3300003771 Bacteria 2254
25 Ga0055537_1007379 3300003773 Bacteria 2656
26 Ga0055537_1039771 3300003773 Bacteria 566
27 Ga0055524_1006928 3300003775 Bacteria 4874
28 Ga0055524_1036225 3300003775 Bacteria 1330
29 Ga0055536_1000020 3300003781 Bacteria 199649
30 Ga0055540_1037782 3300003792 Bacteria 1062
31 Ga0055541_1000265 3300003841 Bacteria 18362
32 Ga0055541_1009075 3300003841 Bacteria 1554
33 Ga0065712_10016198 3300005290 Bacteria 1718
34 Ga0065712_10681683 3300005290 Bacteria 554
35 Ga0070676_11272613 3300005328 Bacteria 561
36 Ga0070690_101517588 3300005330 Bacteria 542
37 Ga0070670_101086542 3300005331 Bacteria 729
38 Ga0070666_10960526 3300005335 Bacteria 633
39 Ga0070682_100301124 3300005337 Bacteria 1177
40 Ga0068868_100033436 3300005338 Bacteria 3963
41 Ga0070660_100280239 3300005339 Bacteria 1364
42 Ga0070660_100475699 3300005339 Bacteria 1038
43 Ga0070660_100849106 3300005339 Bacteria 769
44 Ga0070660_100993807 3300005339 Bacteria 709
45 Ga0070689_100383370 3300005340 Bacteria 1185
46 Ga0070689_101465307 3300005340 Bacteria 618
47 Ga0070691_10801496 3300005341 Bacteria 574
48 Ga0070691_11015504 3300005341 Bacteria 518
49 Ga0070687_100311980 3300005343 Bacteria 1002
50 Ga0070687_100512500 3300005343 Bacteria 809
51 Ga0070687_100724582 3300005343 Bacteria 697
52 Ga0070661_100000193 3300005344 Bacteria 50382
53 Ga0070692_10724106 3300005345 Bacteria 672
54 Ga0070668_100177100 3300005347 Bacteria 1740
55 Ga0070668_100709277 3300005347 Bacteria 888
56 Ga0070668_100991062 3300005347 Bacteria 755
57 Ga0070669_100551466 3300005353 Bacteria 961
58 Ga0070669_100887557 3300005353 Bacteria 761
59 Ga0070675_100120349 3300005354 Bacteria 2230
60 Ga0070675_102130979 3300005354 Bacteria 517
61 Ga0070671_101104056 3300005355 Bacteria 697
62 Ga0070674_100042844 3300005356 Bacteria 3077
63 Ga0070674_100336562 3300005356 Bacteria 1214
64 Ga0070674_100772253 3300005356 Bacteria 827
65 Ga0070673_100856545 3300005364 Bacteria 841
66 Ga0070688_100064162 3300005365 Bacteria 2330
67 Ga0070659_100001577 3300005366 Bacteria 16412
68 Ga0070659_100048222 3300005366 Bacteria 3345
69 Ga0070659_100208597 3300005366 Bacteria 1610
70 Ga0070659_101850324 3300005366 Bacteria 541
71 Ga0070659_102144090 3300005366 Bacteria 502
72 Ga0070667_100012161 3300005367 Bacteria 7123
73 Ga0070667_100161863 3300005367 Bacteria 1971
74 Ga0070667_100179792 3300005367 Bacteria 1870
75 Ga0070667_100728202 3300005367 Bacteria 919
76 Ga0070714_100076400 3300005435 Bacteria 2908
77 Ga0070701_10004017 3300005438 Bacteria 5895
78 Ga0070701_10293380 3300005438 Bacteria 997
79 Ga0070700_100531126 3300005441 Bacteria 910
80 Ga0070700_100546590 3300005441 Bacteria 899
81 Ga0070700_100665547 3300005441 Bacteria 824
82 Ga0070700_100676725 3300005441 Bacteria 817
83 Ga0070700_102008294 3300005441 Bacteria 502
84 Ga0070694_101056482 3300005444 Bacteria 676
85 Ga0070708_100497048 3300005445 Bacteria 1151
86 Ga0070663_100000025 3300005455 Bacteria 101896
87 Ga0070663_100314264 3300005455 Bacteria 1258
88 Ga0070663_100552618 3300005455 Bacteria 963
89 Ga0070663_100572439 3300005455 Bacteria 947
90 Ga0070663_100739738 3300005455 Bacteria 839
91 Ga0070663_101461376 3300005455 Bacteria 607
92 Ga0070663_101472627 3300005455 Bacteria 605
93 Ga0070678_101474070 3300005456 Bacteria 637
94 Ga0070662_101147189 3300005457 Bacteria 667
95 Ga0068867_100031005 3300005459 Bacteria 3858
96 Ga0070706_100789299 3300005467 Bacteria 879
97 Ga0070707_100328584 3300005468 Bacteria 1486
98 Ga0070698_100359923 3300005471 Bacteria 1387
99 Ga0070699_100260664 3300005518 Bacteria 1550
100 Ga0070699_101377901 3300005518 Bacteria 647
101 Ga0070679_100269815 3300005530 Bacteria 1656
102 Ga0070679_101092838 3300005530 Bacteria 742
103 Ga0070697_100061456 3300005536 Bacteria 3064
104 Ga0070697_101024946 3300005536 Bacteria 734
105 Ga0068853_100004519 3300005539 Bacteria 10792
106 Ga0068853_100309228 3300005539 Bacteria 1463
107 Ga0068853_100371845 3300005539 Bacteria 1333
108 Ga0068853_100505651 3300005539 Bacteria 1141
109 Ga0068853_101653468 3300005539 Bacteria 621
110 Ga0068853_102198533 3300005539 Bacteria 535
111 Ga0070672_100517947 3300005543 Bacteria 1033
112 Ga0070672_100705425 3300005543 Bacteria 884
113 Ga0070672_100840461 3300005543 Bacteria 809
114 Ga0070686_100078123 3300005544 Bacteria 2185
115 Ga0070695_100649680 3300005545 Bacteria 833
116 Ga0070695_100875064 3300005545 Bacteria 724
117 Ga0070696_100111400 3300005546 Bacteria 1971
118 Ga0070696_100211730 3300005546 Bacteria 1451
119 Ga0070696_100602539 3300005546 Bacteria 886
120 Ga0070693_100176433 3300005547 Bacteria 1372
121 Ga0070693_100352397 3300005547 Bacteria 1008
122 Ga0070693_101422821 3300005547 Bacteria 540
123 Ga0070665_100047359 3300005548 Bacteria 4316
124 Ga0070665_100141520 3300005548 Bacteria 2409
125 Ga0070665_100227409 3300005548 Bacteria 1865
126 Ga0070665_100837909 3300005548 Bacteria 933
127 Ga0070704_100091278 3300005549 Bacteria 2271
128 Ga0070704_100137956 3300005549 Bacteria 1900
129 Ga0070704_100317132 3300005549 Bacteria 1305
130 Ga0068855_101139151 3300005563 Bacteria 814
131 Ga0068855_101470981 3300005563 Bacteria 700
132 Ga0068855_102374986 3300005563 Bacteria 529
133 Ga0068855_102589198 3300005563 Bacteria 503
134 Ga0070664_100000020 3300005564 Bacteria 119858
135 Ga0070664_100885042 3300005564 Bacteria 837
136 Ga0070664_101093534 3300005564 Bacteria 751
137 Ga0068857_100023305 3300005577 Bacteria 5448
138 Ga0068857_100283951 3300005577 Bacteria 1523
139 Ga0068857_101275969 3300005577 Bacteria 712
140 Ga0068854_100000251 3300005578 Bacteria 36522
141 Ga0068854_100186830 3300005578 Bacteria 1622
142 Ga0068856_100000094 3300005614 Bacteria 84534
143 Ga0068856_100433455 3300005614 Bacteria 1335
144 Ga0068856_100493966 3300005614 Bacteria 1245
145 Ga0070702_100566912 3300005615 Bacteria 846
146 Ga0070702_100594089 3300005615 Bacteria 829
147 Ga0070702_100709355 3300005615 Bacteria 768
148 Ga0070702_100810227 3300005615 Bacteria 725
149 Ga0068852_100104238 3300005616 Bacteria 2567
150 Ga0068852_101219035 3300005616 Bacteria 774
151 Ga0068859_100004143 3300005617 Bacteria 14805
152 Ga0068859_100324427 3300005617 Bacteria 1634
153 Ga0068859_100424122 3300005617 Bacteria 1426
154 Ga0068859_102320549 3300005617 Bacteria 592
155 Ga0068859_102584413 3300005617 Bacteria 559
156 Ga0068866_10300843 3300005718 Bacteria 1002
157 Ga0068866_10599164 3300005718 Bacteria 744
158 Ga0068861_100349928 3300005719 Bacteria 1296
159 Ga0068861_101818528 3300005719 Bacteria 605
160 Ga0068861_102539056 3300005719 Bacteria 516
161 Ga0068851_10481722 3300005834 Bacteria 742
162 Ga0068870_10252500 3300005840 Bacteria 1094
163 Ga0068870_10321309 3300005840 Bacteria 983
164 Ga0068863_100242753 3300005841 Bacteria 1739
165 Ga0068858_100017294 3300005842 Bacteria 6764
166 Ga0068858_100138949 3300005842 Bacteria 2280
167 Ga0068858_100146546 3300005842 Bacteria 2217
168 Ga0068858_100232044 3300005842 Bacteria 1750
169 Ga0068860_100108335 3300005843 Bacteria 2655
170 Ga0068860_100299294 3300005843 Bacteria 1575
171 Ga0068860_100627273 3300005843 Bacteria 1082
172 Ga0068860_100797402 3300005843 Bacteria 958
173 Ga0068860_101301383 3300005843 Bacteria 748
174 Ga0068860_101383753 3300005843 Bacteria 725
175 Ga0068862_100192967 3300005844 Bacteria 1834
176 Ga0068862_100908855 3300005844 Bacteria 866
177 Ga0070712_100082642 3300006175 Bacteria 2330
178 Ga0075367_10314208 3300006178 Bacteria 987
179 Ga0075367_10533413 3300006178 Bacteria 745
180 Ga0075369_10241995 3300006186 Bacteria 837
181 Ga0075366_10045156 3300006195 Bacteria 2611
182 Ga0075366_10166536 3300006195 Bacteria 1337
183 Ga0075366_10213676 3300006195 Bacteria 1174
184 Ga0075366_10242038 3300006195 Bacteria 1100
185 Ga0075366_10439493 3300006195 Bacteria 804
186 Ga0075366_10752613 3300006195 Bacteria 606
187 Ga0097621_100020693 3300006237 Bacteria 5073
188 Ga0097621_100307001 3300006237 Bacteria 1403
189 Ga0075370_10009133 3300006353 Bacteria 5132
190 Ga0075370_10814016 3300006353 Bacteria 570
191 Ga0068871_100030701 3300006358 Bacteria 4234
192 Ga0068871_101518672 3300006358 Bacteria 633
193 Ga0068865_100077772 3300006881 Bacteria 2372
194 Ga0068865_100208989 3300006881 Bacteria 1519
195 Ga0075436_100030807 3300006914 Bacteria 3691
196 Ga0097620_100004143 3300006931 Bacteria 14805
197 Ga0097620_100324423 3300006931 Bacteria 1634
198 Ga0097620_100424081 3300006931 Bacteria 1426
199 Ga0097620_102320710 3300006931 Bacteria 592
200 Ga0097620_102584873 3300006931 Bacteria 559
201 Ga0099826_10000004 3300006948 Bacteria 802669
202 Ga0075435_100298910 3300007076 Bacteria 1377
203 Ga0105251_10061983 3300009011 Bacteria 1757
204 Ga0105244_10359606 3300009036 Bacteria 671
205 Ga0105240_10022527 3300009093 Bacteria 8348
206 Ga0105240_10027802 3300009093 Bacteria 7400
207 Ga0105240_10155943 3300009093 Bacteria 2715
208 Ga0105240_10349152 3300009093 Bacteria 1679
209 Ga0105240_10771454 3300009093 Bacteria 1044
210 Ga0111539_10103738 3300009094 Bacteria 3337
211 Ga0111539_10424204 3300009094 Bacteria 1549
212 Ga0111539_11391977 3300009094 Bacteria 814
213 Ga0111539_11656127 3300009094 Bacteria 742
214 Ga0105245_10009298 3300009098 Bacteria 8569
215 Ga0105245_10206271 3300009098 Bacteria 1890
216 Ga0105245_10892882 3300009098 Bacteria 930
217 Ga0105245_11622096 3300009098 Bacteria 699
218 Ga0105245_11850084 3300009098 Bacteria 657
219 Ga0105247_10021354 3300009101 Bacteria 3896
220 Ga0105243_10270576 3300009148 Bacteria 1525
221 Ga0105243_10408808 3300009148 Bacteria 1263
222 Ga0105243_10415469 3300009148 Bacteria 1253
223 Ga0105243_11298636 3300009148 Bacteria 745
224 Ga0105243_11937726 3300009148 Bacteria 623
225 Ga0105243_12583641 3300009148 Bacteria 547
226 Ga0105243_12811942 3300009148 Bacteria 527
227 Ga0105241_10048828 3300009174 Bacteria 3221
228 Ga0105241_10121297 3300009174 Bacteria 2105
229 Ga0105241_10392849 3300009174 Bacteria 1215
230 Ga0105241_10457142 3300009174 Bacteria 1130
231 Ga0105241_10858168 3300009174 Bacteria 840
232 Ga0105241_11236893 3300009174 Bacteria 709
233 Ga0105241_12183422 3300009174 Bacteria 549
234 Ga0105242_10234236 3300009176 Bacteria 1647
235 Ga0105242_10235481 3300009176 Bacteria 1643
236 Ga0105242_13266868 3300009176 Bacteria 504
237 Ga0105248_10002218 3300009177 Bacteria 21485
238 Ga0105248_10448199 3300009177 Bacteria 1454
239 Ga0105248_10765760 3300009177 Bacteria 1089
240 Ga0105248_11462106 3300009177 Bacteria 773
241 Ga0105237_10000548 3300009545 Bacteria 52739
242 Ga0105237_10012855 3300009545 Bacteria 8800
243 Ga0105237_10499583 3300009545 Bacteria 1223
244 Ga0105237_11370077 3300009545 Bacteria 714
245 Ga0105237_12444881 3300009545 Bacteria 533
246 Ga0105237_12555269 3300009545 Bacteria 521
247 Ga0105238_10002440 3300009551 Bacteria 18658
248 Ga0105238_10178772 3300009551 Bacteria 2098
249 Ga0105238_10346624 3300009551 Bacteria 1474
250 Ga0105238_10503631 3300009551 Bacteria 1212
251 Ga0105238_12922857 3300009551 Bacteria 514
252 Ga0105249_10396859 3300009553 Bacteria 1409
253 Ga0105249_12392275 3300009553 Bacteria 601
254 Ga0105239_10004988 3300010375 Bacteria 15674
255 Ga0105239_10028073 3300010375 Bacteria 6192
256 Ga0105239_10888913 3300010375 Bacteria 1022
257 Ga0105239_11403163 3300010375 Bacteria 806
258 Ga0105239_11687347 3300010375 Bacteria 733
259 Ga0105246_10154272 3300011119 Bacteria 1742
260 Ga0105246_10232409 3300011119 Bacteria 1453
261 Ga0105246_10684547 3300011119 Bacteria 897
262 Ga0157335_1027327 3300012492 Bacteria 579
263 Ga0157315_1014802 3300012508 Bacteria 752
264 Ga0157373_10015843 3300013100 Bacteria 5503
265 Ga0157373_10184308 3300013100 Bacteria 1470
266 Ga0157373_10357414 3300013100 Bacteria 1042
267 Ga0157373_10683726 3300013100 Bacteria 751
268 Ga0157373_11165054 3300013100 Bacteria 580
269 Ga0157371_10000082 3300013102 Bacteria 149981
270 Ga0157371_10746937 3300013102 Bacteria 734
271 Ga0157370_10000423 3300013104 Bacteria 53080
272 Ga0157370_10007010 3300013104 Bacteria 12309
273 Ga0157369_10040287 3300013105 Bacteria 5100
274 Ga0157374_10000493 3300013296 Bacteria 35816
275 Ga0157374_10075475 3300013296 Bacteria 3185
276 Ga0157374_10649569 3300013296 Bacteria 1067
277 Ga0157374_10675090 3300013296 Bacteria 1045
278 Ga0157374_10689354 3300013296 Bacteria 1034
279 Ga0157378_10088875 3300013297 Bacteria 2804
280 Ga0157378_10121654 3300013297 Bacteria 2406
281 Ga0157378_10125921 3300013297 Bacteria 2366
282 Ga0157378_10178140 3300013297 Bacteria 1998
283 Ga0157378_10699865 3300013297 Bacteria 1033
284 Ga0157378_11296523 3300013297 Bacteria 769
285 Ga0157378_12670951 3300013297 Bacteria 552
286 Ga0163162_10535822 3300013306 Bacteria 1300
287 Ga0163162_10807802 3300013306 Bacteria 1055
288 Ga0163162_12008312 3300013306 Bacteria 663
289 Ga0163162_12252460 3300013306 Bacteria 626
290 Ga0157372_10001447 3300013307 Bacteria 25689
291 Ga0157372_11361023 3300013307 Bacteria 819
292 Ga0157375_10089299 3300013308 Bacteria 3138
293 Ga0163163_10298236 3300014325 Bacteria 1664
294 Ga0163163_12799133 3300014325 Bacteria 544
295 Ga0157380_10239314 3300014326 Bacteria 1635
296 Ga0157380_10747471 3300014326 Bacteria 989
297 Ga0157380_12200807 3300014326 Bacteria 615
298 Ga0157377_11040988 3300014745 Bacteria 623
299 Ga0157377_11201276 3300014745 Bacteria 587
300 Ga0157377_11576684 3300014745 Bacteria 525
301 Ga0157379_10115193 3300014968 Bacteria 2417
302 Ga0157379_11302866 3300014968 Bacteria 701
303 Ga0157379_11392672 3300014968 Bacteria 679
304 Ga0157376_10065502 3300014969 Bacteria 3068
305 Ga0157376_11018048 3300014969 Bacteria 851
306 Ga0157376_11072771 3300014969 Bacteria 830
307 Ga0157376_11535964 3300014969 Bacteria 699
308 Ga0157376_12149917 3300014969 Bacteria 597
309 Ga0182006_1001223 3300015261 Bacteria 16011
310 Ga0182006_1084575 3300015261 Bacteria 1151
311 Ga0182007_10139649 3300015262 Bacteria 819
312 Ga0182005_1051097 3300015265 Bacteria 1124
313 Ga0163161_10223739 3300017792 Bacteria 1458
314 Ga0163161_10993002 3300017792 Bacteria 716
315 Ga0163161_11168939 3300017792 Bacteria 664
316 Ga0197907_10464694 3300020069 Bacteria 1436
317 Ga0206356_10209806 3300020070 Bacteria 1029
318 Ga0206351_10301891 3300020077 Bacteria 1068
319 Ga0206350_11251963 3300020080 Bacteria 663
320 Ga0206354_10128724 3300020081 Bacteria 819
321 Ga0206353_11396399 3300020082 Bacteria 882
322 Ga0154015_1262301 3300020610 Bacteria 32661
323 Ga0154015_1429522 3300020610 Bacteria 679
324 Ga0224712_10000145 3300022467 Bacteria 11882
325 Ga0209784_100055 3300025224 Bacteria 177507
326 Ga0209784_100213 3300025224 Bacteria 39886
327 Ga0209784_100714 3300025224 Bacteria 8818
328 Ga0209566_100002 3300025225 Bacteria 2614868
329 Ga0209566_100386 3300025225 Bacteria 35703
330 Ga0209566_100695 3300025225 Bacteria 19492
331 Ga0209674_100090 3300025226 Bacteria 175563
332 Ga0209674_100213 3300025226 Bacteria 55913
333 Ga0209672_100126 3300025228 Bacteria 79084
334 Ga0209672_100690 3300025228 Bacteria 16916
335 Ga0209147_100002 3300025229 Bacteria 2158988
336 Ga0209563_100095 3300025230 Bacteria 165592
337 Ga0209563_116947 3300025230 Bacteria 884
338 Ga0207427_100380 3300025231 Bacteria 26848
339 Ga0209258_100002 3300025242 Bacteria 2158988
340 Ga0209646_1000019 3300025246 Bacteria 475248
341 Ga0209026_1004707 3300025250 Bacteria 3941
342 Ga0209677_100069 3300025253 Bacteria 144999
343 Ga0209677_102741 3300025253 Bacteria 6308
344 Ga0209148_1000330 3300025254 Bacteria 65396
345 Ga0209148_1001723 3300025254 Bacteria 9578
346 Ga0209759_1002810 3300025256 Bacteria 7351
347 Ga0209759_1007390 3300025256 Bacteria 3536
348 Ga0209565_1000103 3300025263 Bacteria 127199
349 Ga0209565_1009258 3300025263 Bacteria 2516
350 Ga0209455_1000009 3300025272 Bacteria 1042273
351 Ga0209673_1030242 3300025273 Bacteria 1709
352 Ga0209675_1001091 3300025291 Bacteria 16693
353 Ga0209675_1001094 3300025291 Bacteria 16654
354 Ga0209676_1000066 3300025292 Bacteria 317897
355 Ga0209025_1001357 3300025294 Bacteria 32874
356 Ga0209025_1002856 3300025294 Bacteria 17327
357 Ga0209025_1033381 3300025294 Bacteria 2379
358 Ga0209564_1002778 3300025295 Bacteria 13094
359 Ga0209758_1012665 3300025297 Bacteria 4690
360 Ga0209050_1083757 3300025298 Bacteria 670
361 Ga0209256_1001633 3300025299 Bacteria 21846
362 Ga0209256_1003124 3300025299 Bacteria 12084
363 Ga0209051_1007477 3300025303 Bacteria 5963
364 Ga0207642_10387481 3300025899 Bacteria 833
365 Ga0207688_10365452 3300025901 Bacteria 891
366 Ga0207647_10053616 3300025904 Bacteria 2484
367 Ga0207645_11055013 3300025907 Bacteria 549
368 Ga0207643_10818365 3300025908 Bacteria 604
369 Ga0207654_10038625 3300025911 Bacteria 2680
370 Ga0207654_10134864 3300025911 Bacteria 1567
371 Ga0207654_10518309 3300025911 Bacteria 844
372 Ga0207707_10298049 3300025912 Bacteria 1394
373 Ga0207695_10000464 3300025913 Bacteria 87951
374 Ga0207695_10386349 3300025913 Bacteria 1285
375 Ga0207695_10628370 3300025913 Bacteria 955
376 Ga0207671_10017015 3300025914 Bacteria 5626
377 Ga0207671_10070054 3300025914 Bacteria 2613
378 Ga0207671_10223696 3300025914 Bacteria 1475
379 Ga0207671_10372449 3300025914 Bacteria 1134
380 Ga0207693_10146345 3300025915 Bacteria 1858
381 Ga0207660_10436470 3300025917 Bacteria 1058
382 Ga0207662_10468555 3300025918 Bacteria 864
383 Ga0207657_10143253 3300025919 Bacteria 1951
384 Ga0207657_10166266 3300025919 Bacteria 1789
385 Ga0207649_10000065 3300025920 Bacteria 94778
386 Ga0207649_10358884 3300025920 Bacteria 1081
387 Ga0207652_10103276 3300025921 Bacteria 2520
388 Ga0207652_10307136 3300025921 Bacteria 1432
389 Ga0207652_10550916 3300025921 Bacteria 1036
390 Ga0207646_10141462 3300025922 Bacteria 2167
391 Ga0207694_10072877 3300025924 Bacteria 2686
392 Ga0207694_10303494 3300025924 Bacteria 1315
393 Ga0207694_11006571 3300025924 Bacteria 705
394 Ga0207694_11210418 3300025924 Bacteria 639
395 Ga0207694_11589237 3300025924 Bacteria 551
396 Ga0207650_10478389 3300025925 Bacteria 1039
397 Ga0207659_10095357 3300025926 Bacteria 2231
398 Ga0207687_10010408 3300025927 Bacteria 6077
399 Ga0207687_10144135 3300025927 Bacteria 1810
400 Ga0207687_10440401 3300025927 Bacteria 1079
401 Ga0207644_10688900 3300025931 Bacteria 852
402 Ga0207644_10753183 3300025931 Bacteria 814
403 Ga0207690_10001437 3300025932 Bacteria 14907
404 Ga0207690_10036383 3300025932 Bacteria 3187
405 Ga0207690_10046550 3300025932 Bacteria 2874
406 Ga0207706_11008458 3300025933 Bacteria 699
407 Ga0207686_10105954 3300025934 Bacteria 1886
408 Ga0207709_10268559 3300025935 Bacteria 1254
409 Ga0207709_11791454 3300025935 Bacteria 511
410 Ga0207670_10150638 3300025936 Bacteria 1726
411 Ga0207670_10436496 3300025936 Bacteria 1053
412 Ga0207670_10651146 3300025936 Bacteria 869
413 Ga0207669_10282967 3300025937 Bacteria 1252
414 Ga0207669_11328296 3300025937 Bacteria 611
415 Ga0207704_10133644 3300025938 Bacteria 1723
416 Ga0207704_10257559 3300025938 Bacteria 1314
417 Ga0207691_10124826 3300025940 Bacteria 2278
418 Ga0207691_10243693 3300025940 Bacteria 1553
419 Ga0207691_10768822 3300025940 Bacteria 810
420 Ga0207691_11031965 3300025940 Bacteria 686
421 Ga0207711_10011049 3300025941 Bacteria 7504
422 Ga0207689_10001526 3300025942 Bacteria 22022
423 Ga0207689_10083875 3300025942 Bacteria 2620
424 Ga0207679_10000028 3300025945 Bacteria 187787
425 Ga0207679_10892961 3300025945 Bacteria 813
426 Ga0207651_10463936 3300025960 Bacteria 1089
427 Ga0207712_11835665 3300025961 Bacteria 543
428 Ga0207668_10283686 3300025972 Bacteria 1359
429 Ga0207640_10000250 3300025981 Bacteria 36539
430 Ga0207640_10148107 3300025981 Bacteria 1721
431 Ga0207640_10464832 3300025981 Bacteria 1046
432 Ga0207658_10007151 3300025986 Bacteria 7605
433 Ga0207658_10268024 3300025986 Bacteria 1458
434 Ga0207677_10029824 3300026023 Bacteria 3473
435 Ga0207677_10342155 3300026023 Bacteria 1250
436 Ga0207677_10474765 3300026023 Bacteria 1076
437 Ga0207677_10558464 3300026023 Bacteria 999
438 Ga0207703_10126110 3300026035 Bacteria 2204
439 Ga0207703_10176633 3300026035 Bacteria 1882
440 Ga0207703_10205131 3300026035 Bacteria 1754
441 Ga0207703_10885194 3300026035 Bacteria 855
442 Ga0207639_10510382 3300026041 Bacteria 1100
443 Ga0207678_10000376 3300026067 Bacteria 40752
444 Ga0207678_10247902 3300026067 Bacteria 1525
445 Ga0207678_10318762 3300026067 Bacteria 1337
446 Ga0207678_10499661 3300026067 Bacteria 1060
447 Ga0207678_11414077 3300026067 Bacteria 615
448 Ga0207708_10273384 3300026075 Bacteria 1367
449 Ga0207708_10547994 3300026075 Bacteria 975
450 Ga0207708_11431851 3300026075 Bacteria 607
451 Ga0207702_10000046 3300026078 Bacteria 144265
452 Ga0207702_10452537 3300026078 Bacteria 1246
453 Ga0207641_10016613 3300026088 Bacteria 6026
454 Ga0207641_10221425 3300026088 Bacteria 1755
455 Ga0207648_10172810 3300026089 Bacteria 1910
456 Ga0207648_11799275 3300026089 Bacteria 574
457 Ga0207676_10203796 3300026095 Bacteria 1750
458 Ga0207674_10025675 3300026116 Bacteria 6274
459 Ga0207674_10046269 3300026116 Bacteria 4468
460 Ga0207674_11214591 3300026116 Bacteria 723
461 Ga0207675_100253113 3300026118 Bacteria 1705
462 Ga0207675_100370235 3300026118 Bacteria 1407
463 Ga0207683_10219502 3300026121 Bacteria 1732
464 Ga0207698_10048794 3300026142 Bacteria 3217
465 Ga0207698_10932457 3300026142 Bacteria 877
466 Ga0209984_1029863 3300027424 Bacteria 768
467 Ga0209282_1000015 3300027666 Bacteria 206531
468 Ga0209971_1016062 3300027682 Bacteria 1775
469 Ga0207428_10155634 3300027907 Bacteria 1738
470 Ga0268266_10089699 3300028379 Bacteria 2693
471 Ga0268266_10129900 3300028379 Bacteria 2252
472 Ga0268266_10229893 3300028379 Bacteria 1708
473 Ga0268266_10450789 3300028379 Bacteria 1223
474 Ga0268265_10315103 3300028380 Bacteria 1414
475 Ga0268265_10775702 3300028380 Bacteria 932
476 Ga0268264_10065291 3300028381 Bacteria 3066
477 Ga0268264_10100331 3300028381 Bacteria 2514
478 Ga0268264_10760381 3300028381 Bacteria 966
479 Ga0268264_11032797 3300028381 Bacteria 829
480 Ga0265318_10001257 3300028577 Bacteria 15341
481 Ga0307515_10046228 3300028794 Bacteria 6661
482 Ga0307515_10262900 3300028794 Bacteria 1459
483 Ga0265328_10000001 3300031239 Bacteria 371500
484 Ga0265328_10022673 3300031239 Bacteria 2387
485 Ga0265320_10099794 3300031240 Bacteria 1338
486 Ga0265325_10332937 3300031241 Bacteria 673
487 Ga0265340_10279657 3300031247 Bacteria 741
488 Ga0265331_10059937 3300031250 Bacteria 1799
489 Ga0265327_10000235 3300031251 Bacteria 111362
490 Ga0265327_10016776 3300031251 Bacteria 4629
491 Ga0265316_10069121 3300031344 Bacteria 2726
492 Ga0265316_10391567 3300031344 Bacteria 1002
493 Ga0265316_10522256 3300031344 Bacteria 847
494 Ga0265316_10863014 3300031344 Bacteria 633
495 Ga0307513_10726348 3300031456 Bacteria 699
496 Ga0307509_10000006 3300031507 Bacteria 421538
497 Ga0307509_10536956 3300031507 Bacteria 849
498 Ga0307509_10600405 3300031507 Bacteria 773
499 Ga0307408_100047223 3300031548 Bacteria 3082
500 Ga0307408_100096742 3300031548 Bacteria 2241
501 Ga0307408_100182250 3300031548 Bacteria 1685
502 Ga0307408_100337892 3300031548 Bacteria 1274
503 Ga0307408_100371790 3300031548 Bacteria 1219
504 Ga0307408_100503811 3300031548 Bacteria 1060
505 Ga0265313_10000482 3300031595 Bacteria 41863
506 Ga0265313_10016122 3300031595 Bacteria 4312
507 Ga0307508_10030541 3300031616 Bacteria 4871
508 Ga0316575_10313381 3300031665 Bacteria 665
509 Ga0316579_10021079 3300031691 Bacteria 2899
510 Ga0316579_10433272 3300031691 Bacteria 636
511 Ga0265314_10019786 3300031711 Bacteria 5205
512 Ga0265314_10331643 3300031711 Bacteria 843
513 Ga0265342_10306756 3300031712 Bacteria 835
514 Ga0316576_10132191 3300031727 Bacteria 1877
515 Ga0316578_10003673 3300031728 Bacteria 7079
516 Ga0316578_10460919 3300031728 Bacteria 751
517 Ga0307516_10935563 3300031730 Bacteria 535
518 Ga0307405_10015558 3300031731 Bacteria 4125
519 Ga0307405_10043771 3300031731 Bacteria 2734
520 Ga0307405_11697123 3300031731 Bacteria 559
521 Ga0316577_10003197 3300031733 Bacteria 8237
522 Ga0316577_10066378 3300031733 Bacteria 2015
523 Ga0307413_11029252 3300031824 Bacteria 707
524 Ga0307410_10002755 3300031852 Bacteria 8598
525 Ga0307410_10390469 3300031852 Bacteria 1122
526 Ga0307410_10497892 3300031852 Bacteria 1002
527 Ga0307406_10027397 3300031901 Bacteria 3433
528 Ga0307406_11089325 3300031901 Bacteria 689
529 Ga0307406_11649236 3300031901 Bacteria 567
530 Ga0307407_10347356 3300031903 Bacteria 1049
531 Ga0307412_10011261 3300031911 Bacteria 5174
532 Ga0307412_10101112 3300031911 Bacteria 2039
533 Ga0307412_10554742 3300031911 Bacteria 966
534 Ga0307412_10575971 3300031911 Bacteria 949
535 Ga0307412_10823855 3300031911 Bacteria 807
536 Ga0307409_100003730 3300031995 Bacteria 8367
537 Ga0307409_100028119 3300031995 Bacteria 3999
538 Ga0307409_100750979 3300031995 Bacteria 979
539 Ga0307409_101754937 3300031995 Bacteria 650
540 Ga0307416_100001678 3300032002 Bacteria 12247
541 Ga0307416_100051722 3300032002 Bacteria 3283
542 Ga0307416_100073914 3300032002 Bacteria 2845
543 Ga0307416_100412554 3300032002 Bacteria 1392
544 Ga0307416_100961210 3300032002 Bacteria 956
545 Ga0307411_10018945 3300032005 Bacteria 3962
546 Ga0307411_10247111 3300032005 Bacteria 1401
547 Ga0307411_10259147 3300032005 Bacteria 1372
548 Ga0307411_10283443 3300032005 Bacteria 1320
549 Ga0307411_11525860 3300032005 Bacteria 615
550 Ga0307411_11808285 3300032005 Bacteria 567
551 Ga0307415_100002191 3300032126 Bacteria 9675
552 Ga0307415_100003681 3300032126 Bacteria 7845
553 Ga0307415_102567512 3300032126 Bacteria 502
554 Ga0316583_10094013 3300032133 Bacteria 1045
555 Ga0316585_10064679 3300032137 Bacteria 1184
556 Ga0316580_10001189 3300032139 Bacteria 6631
557 Ga0316593_10000841 3300032168 Bacteria 6213
558 Ga0316593_10014809 3300032168 Bacteria 2335
559 Ga0316593_10113944 3300032168 Bacteria 967
560 Ga0316596_1002972 3300033541 Bacteria 3680
561 Ga0316596_1147587 3300033541 Bacteria 645
562 Ga0373934_0001684 3300035086 Bacteria 8120
563 Ga0373952_0054415 3300035092 Bacteria 962
564 Ga0373956_0000615 3300035119 Bacteria 14591
565 Ga0373957_0060102 3300035120 Bacteria 1471
566 Ga0373946_0198923 3300035171 Bacteria 959
567 Ga0373961_0262207 3300035241 Bacteria 628
568 Ga0373962_0017274 3300035242 Bacteria 1869
569 Ga0316574_0007145 3300035398 Bacteria 6103
570 Ga0373931_0571738 3300035691 Bacteria 736
571 Ga0373931_0941184 3300035691 Bacteria 582
572 Ga0373927_0611853 3300035695 Bacteria 720
573 Ga0373933_0001188 3300035724 Bacteria 15438
574 Ga0373937_0037625 3300036401 Bacteria 4409
575 Ga0316582_0048337 3300036647 Bacteria 2689
576 Ga0316584_0009967 3300036712 Bacteria 6619
577 Ga0316584_0030340 3300036712 Bacteria 3994
578 Ga0373925_1237187 3300037068 Bacteria 613
579 Ga0395899_0262448 3300037312 Bacteria 1181
580 Ga0395900_0098953 3300037418 Bacteria 2996
581 Ga0395900_0278896 3300037418 Bacteria 1664
582 Ga0395900_0629401 3300037418 Bacteria 1011
583 Ga0395898_0808129 3300037466 Bacteria 878
584 Ga0395905_0004037 3300037471 Bacteria 15407
585 Ga0395905_0048304 3300037471 Bacteria 3988
586 Ga0395901_0011265 3300038443 Bacteria 9060
587 Ga0395901_0739167 3300038443 Bacteria 978
588 Ga0395901_1010479 3300038443 Bacteria 807
589 Ga0436360_0391140 3300039438 Bacteria 957
590 Ga0436361_1095639 3300039447 Bacteria 1343
591 Ga0451789_0341123 3300041443 Bacteria 537
592 Ga0451841_0113566 3300041498 Bacteria 666
593 Ga0451843_0038411 3300041509 Bacteria 514
594 Ga0451843_1449225 3300041509 Bacteria 793
595 Ga0451855_0517695 3300041511 Bacteria 954
596 Ga0439454_105206 3300042011 Bacteria 534
597 Ga0439458_0142971 3300042157 Bacteria 638
598 Ga0439459_0215021 3300042438 Bacteria 530
599 Ga0451577_0025902 3300042876 Bacteria 5317
600 Ga0451577_0120151 3300042876 Bacteria 2354
601 Ga0451577_0143177 3300042876 Bacteria 2149
602 Ga0451577_0491026 3300042876 Bacteria 1115
603 Ga0453683_1021694 3300044673 Bacteria 549
604 Ga0453684_0002102 3300044712 Bacteria 50310
605 Ga0453684_0003300 3300044712 Bacteria 36795
606 Ga0453684_0006085 3300044712 Bacteria 23282
607 Ga0453684_0560017 3300044712 Bacteria 1258
608 Ga0453684_0598549 3300044712 Bacteria 1209
609 Ga0453684_0745325 3300044712 Bacteria 1061
610 Ga0453684_0777818 3300044712 Bacteria 1034
611 Ga0451576_0002470 3300045051 Bacteria 27511
612 Ga0451576_0082681 3300045051 Bacteria 3340
613 Ga0451576_0683500 3300045051 Bacteria 1078
614 Ga0451576_1603875 3300045051 Bacteria 675
615 Ga0495591_163069 3300046458 Bacteria 533
616 Ga0495638_0001797 3300046460 Bacteria 18668
617 Ga0495651_0002995 3300046462 Bacteria 13035
618 Ga0495605_0033114 3300046474 Bacteria 2626
619 Ga0495605_0052559 3300046474 Bacteria 1979
620 Ga0495584_0053684 3300046491 Bacteria 2028
621 Ga0495596_0018384 3300046500 Bacteria 2881
622 Ga0495607_0064557 3300046501 Bacteria 2067
623 Ga0495607_0135161 3300046501 Bacteria 1278
624 Ga0495608_0202845 3300046511 Bacteria 1249
625 Ga0495610_0025039 3300046512 Bacteria 3212
626 Ga0495616_0028541 3300046513 Bacteria 2954
627 Ga0495631_0010437 3300046518 Bacteria 4594
628 Ga0495643_0490299 3300046522 Bacteria 530
629 Ga0495644_0230437 3300046523 Bacteria 717
630 Ga0495663_0387010 3300046525 Bacteria 513
631 Ga0495598_0299586 3300046537 Bacteria 608
632 Ga0495609_0024107 3300046538 Bacteria 2793
633 Ga0495609_0113417 3300046538 Bacteria 1169
634 Ga0495597_0156006 3300046542 Bacteria 934
635 Ga0495611_0022876 3300046648 Bacteria 2707
636 Ga0495625_0066431 3300046660 Bacteria 2540
637 Ga0495661_0151493 3300046665 Bacteria 1252
638 Ga0495588_0264213 3300046674 Bacteria 907
639 Ga0495657_0342810 3300046675 Bacteria 885
640 Ga0495657_0399939 3300046675 Bacteria 808
641 Ga0495671_0028011 3300046692 Bacteria 2905
642 Ga0495649_0044015 3300046694 Bacteria 2437
643 Ga0495604_0407987 3300047317 Bacteria 894
644 Ga0495672_0049991 3300047320 Bacteria 2472
645 Ga0495672_0051319 3300047320 Bacteria 2430
646 Ga0495680_0360085 3300047322 Bacteria 1011
647 Ga0495593_0685051 3300047673 Bacteria 515
648 Ga0496100_0156446 3300048903 Bacteria 1630
649 Ga0496100_0805931 3300048903 Bacteria 736
650 Ga0496100_1641832 3300048903 Bacteria 508
651 Ga0496101_0065600 3300048904 Bacteria 2647
652 Ga0496101_0108425 3300048904 Bacteria 2088
653 Ga0496101_1033129 3300048904 Bacteria 646
654 Ga0496102_0395388 3300048905 Bacteria 1300
655 Ga0496104_0151061 3300048907 Bacteria 2229
656 Ga0496104_1003720 3300048907 Bacteria 739
657 Ga0496105_0303414 3300048908 Bacteria 1283
658 Ga0496106_0221607 3300048909 Bacteria 1509
659 Ga0496108_0641109 3300048911 Bacteria 924
660 Ga0496108_0972540 3300048911 Bacteria 726
661 Ga0496109_0237498 3300048912 Bacteria 1715
662 Ga0496109_0310644 3300048912 Bacteria 1487
663 Ga0496109_0631824 3300048912 Bacteria 1007
664 Ga0496109_1074102 3300048912 Bacteria 742
665 Ga0496110_0322106 3300048913 Bacteria 1408
666 Ga0496110_1164866 3300048913 Bacteria 679
667 Ga0496111_0734245 3300048914 Bacteria 717
668 Ga0496113_0213023 3300048916 Bacteria 1538
669 Ga0496113_0244565 3300048916 Bacteria 1432
670 Ga0496114_0013659 3300048917 Bacteria 6510
671 Ga0496114_0332435 3300048917 Bacteria 1343
672 Ga0496114_0983420 3300048917 Bacteria 727
673 Ga0496115_0296072 3300048918 Bacteria 1326
674 Ga0496116_0048325 3300048919 Bacteria 2856
675 Ga0496118_0079995 3300048921 Bacteria 2303
676 Ga0496121_0109730 3300048924 Bacteria 2107
677 Ga0496121_0161311 3300048924 Bacteria 1639
678 Ga0496122_0058111 3300048925 Bacteria 2866
679 Ga0496123_0071897 3300048926 Bacteria 2155
680 Ga0496124_0000206 3300048927 Bacteria 116591
681 Ga0496124_0001201 3300048927 Bacteria 40242
682 Ga0496125_0141105 3300048928 Bacteria 1675
683 Ga0496125_0150802 3300048928 Bacteria 1597
684 Ga0496126_0236833 3300048929 Bacteria 1527
685 Ga0501304_028359 3300049160 Bacteria 585
686 Ga0501290_005019 3300049513 Bacteria 1652
687 Ga0501292_005367 3300049515 Bacteria 1786
688 Ga0501294_005096 3300049517 Bacteria 1242
689 Ga0501295_160906 3300049518 Bacteria 558
690 Ga0501031_0004430 3300049568 Bacteria 9105
691 Ga0501031_0110195 3300049568 Bacteria 1797
692 Ga0501031_0615755 3300049568 Bacteria 698
693 Ga0501032_0001741 3300049569 Bacteria 17208
694 Ga0501032_0010188 3300049569 Bacteria 6784
695 Ga0501032_0015048 3300049569 Bacteria 5467
696 Ga0501032_0318473 3300049569 Bacteria 1004
697 Ga0501033_0000364 3300049570 Bacteria 43293
698 Ga0501033_0005262 3300049570 Bacteria 10267
699 Ga0501033_0006818 3300049570 Bacteria 8916
700 Ga0501034_0005376 3300049571 Bacteria 14011
701 Ga0501034_0019811 3300049571 Bacteria 6875
702 Ga0501034_0039568 3300049571 Bacteria 4775
703 Ga0501034_0222923 3300049571 Bacteria 1837
704 Ga0501036_0208777 3300049572 Bacteria 1641
705 Ga0501036_0270537 3300049572 Bacteria 1422
706 Ga0501036_0903900 3300049572 Bacteria 724
707 Ga0501037_0000162 3300049573 Bacteria 62629
708 Ga0501038_0003864 3300049574 Bacteria 13921
709 Ga0501038_0008423 3300049574 Bacteria 9485
710 Ga0501038_0011277 3300049574 Bacteria 8160
711 Ga0501038_0108142 3300049574 Bacteria 2306
712 Ga0501039_0003351 3300049575 Bacteria 11972
713 Ga0501039_0008915 3300049575 Bacteria 7641
714 Ga0501040_0023959 3300049576 Bacteria 4094
715 Ga0501040_0394221 3300049576 Bacteria 994
716 Ga0501042_0000536 3300049578 Bacteria 19889
717 Ga0501043_0003874 3300049579 Bacteria 12289
718 Ga0501043_0015184 3300049579 Bacteria 6030
719 Ga0501043_0021892 3300049579 Bacteria 5013
720 Ga0501043_0228914 3300049579 Bacteria 1436
721 Ga0501043_0671568 3300049579 Bacteria 759
722 Ga0501043_1076067 3300049579 Bacteria 569
723 Ga0501046_0006470 3300049580 Bacteria 10362
724 Ga0501046_0036301 3300049580 Bacteria 3967
725 Ga0501047_0034699 3300049581 Bacteria 4870
726 Ga0501047_0399516 3300049581 Bacteria 1207
727 Ga0501067_0132629 3300049583 Bacteria 1386
728 Ga0501068_0039781 3300049584 Bacteria 2820
729 Ga0501070_0024315 3300049586 Bacteria 5081
730 Ga0501070_0155438 3300049586 Bacteria 1886
731 Ga0501071_1151839 3300049587 Bacteria 599
732 Ga0501072_0924082 3300049588 Bacteria 681
733 Ga0501076_0229878 3300049592 Bacteria 1516
734 Ga0501076_0573202 3300049592 Bacteria 931
735 Ga0501076_0819307 3300049592 Bacteria 768
736 Ga0501198_000011 3300049649 Bacteria 115612
737 Ga0501207_057861 3300049654 Bacteria 704
738 Ga0501222_000022 3300049662 Bacteria 66333
739 Ga0501222_048286 3300049662 Bacteria 619
740 Ga0501228_003345 3300049666 Bacteria 1317
741 Ga0501250_005766 3300049680 Bacteria 1285
742 Ga0501083_0136365 3300049744 Bacteria 1608
743 Ga0501262_012033 3300049759 Bacteria 1102
744 Ga0501269_036219 3300049766 Bacteria 646
745 Ga0501270_118778 3300049767 Bacteria 573
746 Ga0501281_03705 3300049777 Bacteria 1088
747 Ga0501282_005143 3300049778 Bacteria 1398
748 Ga0501035_0005055 3300049822 Bacteria 12496
749 Ga0501035_0103882 3300049822 Bacteria 2492
750 Ga0501035_0131593 3300049822 Bacteria 2180
751 Ga0501035_0443245 3300049822 Bacteria 1075
752 Ga0501035_1437982 3300049822 Bacteria 527
753 Ga0501044_0001481 3300049823 Bacteria 27531
754 Ga0501044_0003222 3300049823 Bacteria 18385
755 Ga0501044_0018325 3300049823 Bacteria 7503
756 Ga0501044_0024640 3300049823 Bacteria 6384
757 Ga0501044_0059334 3300049823 Bacteria 3920
758 Ga0501044_0116851 3300049823 Bacteria 2672
759 Ga0501044_0457246 3300049823 Bacteria 1182
760 Ga0501044_0548151 3300049823 Bacteria 1054
761 Ga0501045_0014729 3300049824 Bacteria 5543
762 Ga0501045_0715750 3300049824 Bacteria 738
763 nmdc:mga03683_178041_c1 3300050489 Bacteria 969
764 nmdc:mga0k408_115321_c1 3300050493 Bacteria 1589
765 nmdc:mga0k408_148325_c1 3300050493 Bacteria 1396
766 nmdc:mga0k408_172752_c1 3300050493 Bacteria 1288
767 nmdc:mga0k408_17631_c1 3300050493 Bacteria 3979
768 nmdc:mga0k408_563343_c1 3300050493 Unclassified 673
769 nmdc:mga06z11_259474_c1 3300050494 Bacteria 1025
770 nmdc:mga07m45_10321_c1 3300050496 Bacteria 4874
771 nmdc:mga07m45_295151_c1 3300050496 Bacteria 943
772 nmdc:mga06r32_1364471_c1 3300050510 Bacteria 651
773 nmdc:mga08y16_1374483_c1 3300050511 Bacteria 670
774 nmdc:mga08y16_1922955_c1 3300050511 Bacteria 542
775 nmdc:mga08y16_299492_c1 3300050511 Bacteria 1658
776 nmdc:mga0rr50_131794_c1 3300050513 Bacteria 2002
777 nmdc:mga08x19_745_c1 3300050514 Bacteria 20774
778 nmdc:mga0a205_1252467_c1 3300050515 Bacteria 589
779 Ga0500646_0057574 3300053090 Bacteria 1136
780 Ga0500658_0085132 3300053134 Bacteria 1359
781 Ga0500568_0041414 3300053139 Bacteria 1850
782 Ga0500568_0054943 3300053139 Bacteria 1555
783 Ga0500604_0000078 3300053151 Bacteria 34635
784 Ga0500616_0000128 3300053153 Bacteria 134307
785 Ga0500616_0006548 3300053153 Bacteria 7605
786 Ga0500622_0000002 3300053156 Bacteria 646442
787 Ga0500645_062236 3300053730 Bacteria 1078
788 Ga0590071_001070 3300059421 Bacteria 7412
789 Ga0590075_150228 3300059424 Bacteria 614
790 Ga0587080_087219 3300059503 Bacteria 649
791 Ga0587083_0068047 3300059505 Bacteria 820
792 Ga0587083_0124428 3300059505 Bacteria 670
793 Ga0587088_125521 3300059508 Bacteria 598
794 Ga0587091_139457 3300059511 Bacteria 606
795 Ga0587094_077547 3300059513 Bacteria 609
796 Ga0587098_055952 3300059604 Bacteria 609
797 Ga0587067_091675 3300059640 Bacteria 689
798 Ga0587068_091984 3300059641 Bacteria 626
799 Ga0587072_087172 3300059643 Bacteria 683
800 Ga0587072_096855 3300059643 Bacteria 657
801 Ga0587076_117715 3300059645 Bacteria 612
802 Ga0587104_016271 3300059650 Bacteria 590
803 Ga0587107_083582 3300059652 Bacteria 605
804 2548846986 2547132512 Bacteria 3416496
805 2597030029 2596583598 Bacteria 5251611
806 2599443886 2599185178 Bacteria 5365746
807 2735817355 2734482258 Unclassified 2930739
808 2738829397 2738541297 Bacteria 6549566
809 2739153193 2738541357 Bacteria 6549408
810 2739195113 2738543003 Bacteria 6549560
811 2739321589 2738543026 Bacteria 6549408
812 2739339855 2738543029 Bacteria 6549249
813 2821131420 2821131069 Bacteria 6108407
814 2834641715 2834641062 Bacteria 5559922
815 2857564911 2857564685 Bacteria 6290584
816 2858692757 2858688981 Bacteria 8184122
817 2885267230 2885266251 Bacteria 4796748
818 2891634785 2891633521 Bacteria 4602265
819 2900582615 2900577576 Bacteria 5438534
820 2928062167 2928058823 Bacteria 5520022
821 8003402802 8003400568 Bacteria 5535898
822 Ga0501032_0040636
823 JGI24741J21665_1000152
824 JGI24740J21852_10000682
825 JGI24740J21852_10005259
826 JGI25156J39149_1005831
827 JGI25156J39149_1009597
828 JGI25154J39366_1001844
829 JGI25157J39369_1008788
830 Ga0006556J51387_1039703
831 Ga0055538_1004147
832 Ga0055538_1007419
833 Ga0055539_1000095
834 Ga0055539_1027922
835 Ga0055533_1004171
836 Ga0055533_1011122
837 Ga0055532_1000058
838 Ga0055525_1000379
839 Ga0055525_1016883
840 Ga0055527_1001095
841 Ga0055535_1000041
842 Ga0055542_1002640
843 Ga0055542_1021709
844 Ga0055529_1000077
845 Ga0055526_1021364
846 Ga0055537_1007379
847 Ga0055537_1039771
848 Ga0055524_1006928
849 Ga0055524_1036225
850 Ga0055536_1000020
851 Ga0055540_1037782
852 Ga0055541_1000265
853 Ga0055541_1009075
854 Ga0065712_10016198
855 Ga0065712_10681683
856 Ga0070676_11272613
857 Ga0070690_101517588
858 Ga0070670_101086542
859 Ga0070666_10960526
860 Ga0070682_100301124
861 Ga0068868_100033436
862 Ga0070660_100280239
863 Ga0070660_100475699
864 Ga0070660_100849106
865 Ga0070660_100993807
866 Ga0070689_100383370
867 Ga0070689_101465307
868 Ga0070691_10801496
869 Ga0070691_11015504
870 Ga0070687_100311980
871 Ga0070687_100512500
872 Ga0070687_100724582
873 Ga0070661_100000193
874 Ga0070692_10724106
875 Ga0070668_100177100
876 Ga0070668_100709277
877 Ga0070668_100991062
878 Ga0070669_100551466
879 Ga0070669_100887557
880 Ga0070675_100120349
881 Ga0070675_102130979
882 Ga0070671_101104056
883 Ga0070674_100042844
884 Ga0070674_100336562
885 Ga0070674_100772253
886 Ga0070673_100856545
887 Ga0070688_100064162
888 Ga0070659_100001577
889 Ga0070659_100048222
890 Ga0070659_100208597
891 Ga0070659_101850324
892 Ga0070659_102144090
893 Ga0070667_100012161
894 Ga0070667_100161863
895 Ga0070667_100179792
896 Ga0070667_100728202
897 Ga0070714_100076400
898 Ga0070701_10004017
899 Ga0070701_10293380
900 Ga0070700_100531126
901 Ga0070700_100546590
902 Ga0070700_100665547
903 Ga0070700_100676725
904 Ga0070700_102008294
905 Ga0070694_101056482
906 Ga0070708_100497048
907 Ga0070663_100000025
908 Ga0070663_100314264
909 Ga0070663_100552618
910 Ga0070663_100572439
911 Ga0070663_100739738
912 Ga0070663_101461376
913 Ga0070663_101472627
914 Ga0070678_101474070
915 Ga0070662_101147189
916 Ga0068867_100031005
917 Ga0070706_100789299
918 Ga0070707_100328584
919 Ga0070698_100359923
920 Ga0070699_100260664
921 Ga0070699_101377901
922 Ga0070679_100269815
923 Ga0070679_101092838
924 Ga0070697_100061456
925 Ga0070697_101024946
926 Ga0068853_100004519
927 Ga0068853_100309228
928 Ga0068853_100371845
929 Ga0068853_100505651
930 Ga0068853_101653468
931 Ga0068853_102198533
932 Ga0070672_100517947
933 Ga0070672_100705425
934 Ga0070672_100840461
935 Ga0070686_100078123
936 Ga0070695_100649680
937 Ga0070695_100875064
938 Ga0070696_100111400
939 Ga0070696_100211730
940 Ga0070696_100602539
941 Ga0070693_100176433
942 Ga0070693_100352397
943 Ga0070693_101422821
944 Ga0070665_100047359
945 Ga0070665_100141520
946 Ga0070665_100227409
947 Ga0070665_100837909
948 Ga0070704_100091278
949 Ga0070704_100137956
950 Ga0070704_100317132
951 Ga0068855_101139151
952 Ga0068855_101470981
953 Ga0068855_102374986
954 Ga0068855_102589198
955 Ga0070664_100000020
956 Ga0070664_100885042
957 Ga0070664_101093534
958 Ga0068857_100023305
959 Ga0068857_100283951
960 Ga0068857_101275969
961 Ga0068854_100000251
962 Ga0068854_100186830
963 Ga0068856_100000094
964 Ga0068856_100433455
965 Ga0068856_100493966
966 Ga0070702_100566912
967 Ga0070702_100594089
968 Ga0070702_100709355
969 Ga0070702_100810227
970 Ga0068852_100104238
971 Ga0068852_101219035
972 Ga0068859_100004143
973 Ga0068859_100324427
974 Ga0068859_100424122
975 Ga0068859_102320549
976 Ga0068859_102584413
977 Ga0068866_10300843
978 Ga0068866_10599164
979 Ga0068861_100349928
980 Ga0068861_101818528
981 Ga0068861_102539056
982 Ga0068851_10481722
983 Ga0068870_10252500
984 Ga0068870_10321309
985 Ga0068863_100242753
986 Ga0068858_100017294
987 Ga0068858_100138949
988 Ga0068858_100146546
989 Ga0068858_100232044
990 Ga0068860_100108335
991 Ga0068860_100299294
992 Ga0068860_100627273
993 Ga0068860_100797402
994 Ga0068860_101301383
995 Ga0068860_101383753
996 Ga0068862_100192967
997 Ga0068862_100908855
998 Ga0070712_100082642
999 Ga0075367_10314208
1000 Ga0075367_10533413
1001 Ga0075369_10241995
1002 Ga0075366_10045156
1003 Ga0075366_10166536
1004 Ga0075366_10213676
1005 Ga0075366_10242038
1006 Ga0075366_10439493
1007 Ga0075366_10752613
1008 Ga0097621_100020693
1009 Ga0097621_100307001
1010 Ga0075370_10009133
1011 Ga0075370_10814016
1012 Ga0068871_100030701
1013 Ga0068871_101518672
1014 Ga0068865_100077772
1015 Ga0068865_100208989
1016 Ga0075436_100030807
1017 Ga0097620_100004143
1018 Ga0097620_100324423
1019 Ga0097620_100424081
1020 Ga0097620_102320710
1021 Ga0097620_102584873
1022 Ga0099826_10000004
1023 Ga0075435_100298910
1024 Ga0105251_10061983
1025 Ga0105244_10359606
1026 Ga0105240_10022527
1027 Ga0105240_10027802
1028 Ga0105240_10155943
1029 Ga0105240_10349152
1030 Ga0105240_10771454
1031 Ga0111539_10103738
1032 Ga0111539_10424204
1033 Ga0111539_11391977
1034 Ga0111539_11656127
1035 Ga0105245_10009298
1036 Ga0105245_10206271
1037 Ga0105245_10892882
1038 Ga0105245_11622096
1039 Ga0105245_11850084
1040 Ga0105247_10021354
1041 Ga0105243_10270576
1042 Ga0105243_10408808
1043 Ga0105243_10415469
1044 Ga0105243_11298636
1045 Ga0105243_11937726
1046 Ga0105243_12583641
1047 Ga0105243_12811942
1048 Ga0105241_10048828
1049 Ga0105241_10121297
1050 Ga0105241_10392849
1051 Ga0105241_10457142
1052 Ga0105241_10858168
1053 Ga0105241_11236893
1054 Ga0105241_12183422
1055 Ga0105242_10234236
1056 Ga0105242_10235481
1057 Ga0105242_13266868
1058 Ga0105248_10002218
1059 Ga0105248_10448199
1060 Ga0105248_10765760
1061 Ga0105248_11462106
1062 Ga0105237_10000548
1063 Ga0105237_10012855
1064 Ga0105237_10499583
1065 Ga0105237_11370077
1066 Ga0105237_12444881
1067 Ga0105237_12555269
1068 Ga0105238_10002440
1069 Ga0105238_10178772
1070 Ga0105238_10346624
1071 Ga0105238_10503631
1072 Ga0105238_12922857
1073 Ga0105249_10396859
1074 Ga0105249_12392275
1075 Ga0105239_10004988
1076 Ga0105239_10028073
1077 Ga0105239_10888913
1078 Ga0105239_11403163
1079 Ga0105239_11687347
1080 Ga0105246_10154272
1081 Ga0105246_10232409
1082 Ga0105246_10684547
1083 Ga0157335_1027327
1084 Ga0157315_1014802
1085 Ga0157373_10015843
1086 Ga0157373_10184308
1087 Ga0157373_10357414
1088 Ga0157373_10683726
1089 Ga0157373_11165054
1090 Ga0157371_10000082
1091 Ga0157371_10746937
1092 Ga0157370_10000423
1093 Ga0157370_10007010
1094 Ga0157369_10040287
1095 Ga0157374_10000493
1096 Ga0157374_10075475
1097 Ga0157374_10649569
1098 Ga0157374_10675090
1099 Ga0157374_10689354
1100 Ga0157378_10088875
1101 Ga0157378_10121654
1102 Ga0157378_10125921
1103 Ga0157378_10178140
1104 Ga0157378_10699865
1105 Ga0157378_11296523
1106 Ga0157378_12670951
1107 Ga0163162_10535822
1108 Ga0163162_10807802
1109 Ga0163162_12008312
1110 Ga0163162_12252460
1111 Ga0157372_10001447
1112 Ga0157372_11361023
1113 Ga0157375_10089299
1114 Ga0163163_10298236
1115 Ga0163163_12799133
1116 Ga0157380_10239314
1117 Ga0157380_10747471
1118 Ga0157380_12200807
1119 Ga0157377_11040988
1120 Ga0157377_11201276
1121 Ga0157377_11576684
1122 Ga0157379_10115193
1123 Ga0157379_11302866
1124 Ga0157379_11392672
1125 Ga0157376_10065502
1126 Ga0157376_11018048
1127 Ga0157376_11072771
1128 Ga0157376_11535964
1129 Ga0157376_12149917
1130 Ga0182006_1001223
1131 Ga0182006_1084575
1132 Ga0182007_10139649
1133 Ga0182005_1051097
1134 Ga0163161_10223739
1135 Ga0163161_10993002
1136 Ga0163161_11168939
1137 Ga0197907_10464694
1138 Ga0206356_10209806
1139 Ga0206351_10301891
1140 Ga0206350_11251963
1141 Ga0206354_10128724
1142 Ga0206353_11396399
1143 Ga0154015_1262301
1144 Ga0154015_1429522
1145 Ga0224712_10000145
1146 Ga0209784_100055
1147 Ga0209784_100213
1148 Ga0209784_100714
1149 Ga0209566_100002
1150 Ga0209566_100386
1151 Ga0209566_100695
1152 Ga0209674_100090
1153 Ga0209674_100213
1154 Ga0209672_100126
1155 Ga0209672_100690
1156 Ga0209147_100002
1157 Ga0209563_100095
1158 Ga0209563_116947
1159 Ga0207427_100380
1160 Ga0209258_100002
1161 Ga0209646_1000019
1162 Ga0209026_1004707
1163 Ga0209677_100069
1164 Ga0209677_102741
1165 Ga0209148_1000330
1166 Ga0209148_1001723
1167 Ga0209759_1002810
1168 Ga0209759_1007390
1169 Ga0209565_1000103
1170 Ga0209565_1009258
1171 Ga0209455_1000009
1172 Ga0209673_1030242
1173 Ga0209675_1001091
1174 Ga0209675_1001094
1175 Ga0209676_1000066
1176 Ga0209025_1001357
1177 Ga0209025_1002856
1178 Ga0209025_1033381
1179 Ga0209564_1002778
1180 Ga0209758_1012665
1181 Ga0209050_1083757
1182 Ga0209256_1001633
1183 Ga0209256_1003124
1184 Ga0209051_1007477
1185 Ga0207642_10387481
1186 Ga0207688_10365452
1187 Ga0207647_10053616
1188 Ga0207645_11055013
1189 Ga0207643_10818365
1190 Ga0207654_10038625
1191 Ga0207654_10134864
1192 Ga0207654_10518309
1193 Ga0207707_10298049
1194 Ga0207695_10000464
1195 Ga0207695_10386349
1196 Ga0207695_10628370
1197 Ga0207671_10017015
1198 Ga0207671_10070054
1199 Ga0207671_10223696
1200 Ga0207671_10372449
1201 Ga0207693_10146345
1202 Ga0207660_10436470
1203 Ga0207662_10468555
1204 Ga0207657_10143253
1205 Ga0207657_10166266
1206 Ga0207649_10000065
1207 Ga0207649_10358884
1208 Ga0207652_10103276
1209 Ga0207652_10307136
1210 Ga0207652_10550916
1211 Ga0207646_10141462
1212 Ga0207694_10072877
1213 Ga0207694_10303494
1214 Ga0207694_11006571
1215 Ga0207694_11210418
1216 Ga0207694_11589237
1217 Ga0207650_10478389
1218 Ga0207659_10095357
1219 Ga0207687_10010408
1220 Ga0207687_10144135
1221 Ga0207687_10440401
1222 Ga0207644_10688900
1223 Ga0207644_10753183
1224 Ga0207690_10001437
1225 Ga0207690_10036383
1226 Ga0207690_10046550
1227 Ga0207706_11008458
1228 Ga0207686_10105954
1229 Ga0207709_10268559
1230 Ga0207709_11791454
1231 Ga0207670_10150638
1232 Ga0207670_10436496
1233 Ga0207670_10651146
1234 Ga0207669_10282967
1235 Ga0207669_11328296
1236 Ga0207704_10133644
1237 Ga0207704_10257559
1238 Ga0207691_10124826
1239 Ga0207691_10243693
1240 Ga0207691_10768822
1241 Ga0207691_11031965
1242 Ga0207711_10011049
1243 Ga0207689_10001526
1244 Ga0207689_10083875
1245 Ga0207679_10000028
1246 Ga0207679_10892961
1247 Ga0207651_10463936
1248 Ga0207712_11835665
1249 Ga0207668_10283686
1250 Ga0207640_10000250
1251 Ga0207640_10148107
1252 Ga0207640_10464832
1253 Ga0207658_10007151
1254 Ga0207658_10268024
1255 Ga0207677_10029824
1256 Ga0207677_10342155
1257 Ga0207677_10474765
1258 Ga0207677_10558464
1259 Ga0207703_10126110
1260 Ga0207703_10176633
1261 Ga0207703_10205131
1262 Ga0207703_10885194
1263 Ga0207639_10510382
1264 Ga0207678_10000376
1265 Ga0207678_10247902
1266 Ga0207678_10318762
1267 Ga0207678_10499661
1268 Ga0207678_11414077
1269 Ga0207708_10273384
1270 Ga0207708_10547994
1271 Ga0207708_11431851
1272 Ga0207702_10000046
1273 Ga0207702_10452537
1274 Ga0207641_10016613
1275 Ga0207641_10221425
1276 Ga0207648_10172810
1277 Ga0207648_11799275
1278 Ga0207676_10203796
1279 Ga0207674_10025675
1280 Ga0207674_10046269
1281 Ga0207674_11214591
1282 Ga0207675_100253113
1283 Ga0207675_100370235
1284 Ga0207683_10219502
1285 Ga0207698_10048794
1286 Ga0207698_10932457
1287 Ga0209984_1029863
1288 Ga0209282_1000015
1289 Ga0209971_1016062
1290 Ga0207428_10155634
1291 Ga0268266_10089699
1292 Ga0268266_10129900
1293 Ga0268266_10229893
1294 Ga0268266_10450789
1295 Ga0268265_10315103
1296 Ga0268265_10775702
1297 Ga0268264_10065291
1298 Ga0268264_10100331
1299 Ga0268264_10760381
1300 Ga0268264_11032797
1301 Ga0265318_10001257
1302 Ga0307515_10046228
1303 Ga0307515_10262900
1304 Ga0265328_10000001
1305 Ga0265328_10022673
1306 Ga0265320_10099794
1307 Ga0265325_10332937
1308 Ga0265340_10279657
1309 Ga0265331_10059937
1310 Ga0265327_10000235
1311 Ga0265327_10016776
1312 Ga0265316_10069121
1313 Ga0265316_10391567
1314 Ga0265316_10522256
1315 Ga0265316_10863014
1316 Ga0307513_10726348
1317 Ga0307509_10000006
1318 Ga0307509_10536956
1319 Ga0307509_10600405
1320 Ga0307408_100047223
1321 Ga0307408_100096742
1322 Ga0307408_100182250
1323 Ga0307408_100337892
1324 Ga0307408_100371790
1325 Ga0307408_100503811
1326 Ga0265313_10000482
1327 Ga0265313_10016122
1328 Ga0307508_10030541
1329 Ga0316575_10313381
1330 Ga0316579_10021079
1331 Ga0316579_10433272
1332 Ga0265314_10019786
1333 Ga0265314_10331643
1334 Ga0265342_10306756
1335 Ga0316576_10132191
1336 Ga0316578_10003673
1337 Ga0316578_10460919
1338 Ga0307516_10935563
1339 Ga0307405_10015558
1340 Ga0307405_10043771
1341 Ga0307405_11697123
1342 Ga0316577_10003197
1343 Ga0316577_10066378
1344 Ga0307413_11029252
1345 Ga0307410_10002755
1346 Ga0307410_10390469
1347 Ga0307410_10497892
1348 Ga0307406_10027397
1349 Ga0307406_11089325
1350 Ga0307406_11649236
1351 Ga0307407_10347356
1352 Ga0307412_10011261
1353 Ga0307412_10101112
1354 Ga0307412_10554742
1355 Ga0307412_10575971
1356 Ga0307412_10823855
1357 Ga0307409_100003730
1358 Ga0307409_100028119
1359 Ga0307409_100750979
1360 Ga0307409_101754937
1361 Ga0307416_100001678
1362 Ga0307416_100051722
1363 Ga0307416_100073914
1364 Ga0307416_100412554
1365 Ga0307416_100961210
1366 Ga0307411_10018945
1367 Ga0307411_10247111
1368 Ga0307411_10259147
1369 Ga0307411_10283443
1370 Ga0307411_11525860
1371 Ga0307411_11808285
1372 Ga0307415_100002191
1373 Ga0307415_100003681
1374 Ga0307415_102567512
1375 Ga0316583_10094013
1376 Ga0316585_10064679
1377 Ga0316580_10001189
1378 Ga0316593_10000841
1379 Ga0316593_10014809
1380 Ga0316593_10113944
1381 Ga0316596_1002972
1382 Ga0316596_1147587
1383 Ga0373934_0001684
1384 Ga0373952_0054415
1385 Ga0373956_0000615
1386 Ga0373957_0060102
1387 Ga0373946_0198923
1388 Ga0373961_0262207
1389 Ga0373962_0017274
1390 Ga0316574_0007145
1391 Ga0373931_0571738
1392 Ga0373931_0941184
1393 Ga0373927_0611853
1394 Ga0373933_0001188
1395 Ga0373937_0037625
1396 Ga0316582_0048337
1397 Ga0316584_0009967
1398 Ga0316584_0030340
1399 Ga0373925_1237187
1400 Ga0395899_0262448
1401 Ga0395900_0098953
1402 Ga0395900_0278896
1403 Ga0395900_0629401
1404 Ga0395898_0808129
1405 Ga0395905_0004037
1406 Ga0395905_0048304
1407 Ga0395901_0011265
1408 Ga0395901_0739167
1409 Ga0395901_1010479
1410 Ga0436360_0391140
1411 Ga0436361_1095639
1412 Ga0451789_0341123
1413 Ga0451841_0113566
1414 Ga0451843_0038411
1415 Ga0451843_1449225
1416 Ga0451855_0517695
1417 Ga0439454_105206
1418 Ga0439458_0142971
1419 Ga0439459_0215021
1420 Ga0451577_0025902
1421 Ga0451577_0120151
1422 Ga0451577_0143177
1423 Ga0451577_0491026
1424 Ga0453683_1021694
1425 Ga0453684_0002102
1426 Ga0453684_0003300
1427 Ga0453684_0006085
1428 Ga0453684_0560017
1429 Ga0453684_0598549
1430 Ga0453684_0745325
1431 Ga0453684_0777818
1432 Ga0451576_0002470
1433 Ga0451576_0082681
1434 Ga0451576_0683500
1435 Ga0451576_1603875
1436 Ga0495591_163069
1437 Ga0495638_0001797
1438 Ga0495651_0002995
1439 Ga0495605_0033114
1440 Ga0495605_0052559
1441 Ga0495584_0053684
1442 Ga0495596_0018384
1443 Ga0495607_0064557
1444 Ga0495607_0135161
1445 Ga0495608_0202845
1446 Ga0495610_0025039
1447 Ga0495616_0028541
1448 Ga0495631_0010437
1449 Ga0495643_0490299
1450 Ga0495644_0230437
1451 Ga0495663_0387010
1452 Ga0495598_0299586
1453 Ga0495609_0024107
1454 Ga0495609_0113417
1455 Ga0495597_0156006
1456 Ga0495611_0022876
1457 Ga0495625_0066431
1458 Ga0495661_0151493
1459 Ga0495588_0264213
1460 Ga0495657_0342810
1461 Ga0495657_0399939
1462 Ga0495671_0028011
1463 Ga0495649_0044015
1464 Ga0495604_0407987
1465 Ga0495672_0049991
1466 Ga0495672_0051319
1467 Ga0495680_0360085
1468 Ga0495593_0685051
1469 Ga0496100_0156446
1470 Ga0496100_0805931
1471 Ga0496100_1641832
1472 Ga0496101_0065600
1473 Ga0496101_0108425
1474 Ga0496101_1033129
1475 Ga0496102_0395388
1476 Ga0496104_0151061
1477 Ga0496104_1003720
1478 Ga0496105_0303414
1479 Ga0496106_0221607
1480 Ga0496108_0641109
1481 Ga0496108_0972540
1482 Ga0496109_0237498
1483 Ga0496109_0310644
1484 Ga0496109_0631824
1485 Ga0496109_1074102
1486 Ga0496110_0322106
1487 Ga0496110_1164866
1488 Ga0496111_0734245
1489 Ga0496113_0213023
1490 Ga0496113_0244565
1491 Ga0496114_0013659
1492 Ga0496114_0332435
1493 Ga0496114_0983420
1494 Ga0496115_0296072
1495 Ga0496116_0048325
1496 Ga0496118_0079995
1497 Ga0496121_0109730
1498 Ga0496121_0161311
1499 Ga0496122_0058111
1500 Ga0496123_0071897
1501 Ga0496124_0000206
1502 Ga0496124_0001201
1503 Ga0496125_0141105
1504 Ga0496125_0150802
1505 Ga0496126_0236833
1506 Ga0501304_028359
1507 Ga0501290_005019
1508 Ga0501292_005367
1509 Ga0501294_005096
1510 Ga0501295_160906
1511 Ga0501031_0004430
1512 Ga0501031_0110195
1513 Ga0501031_0615755
1514 Ga0501032_0001741
1515 Ga0501032_0010188
1516 Ga0501032_0015048
1517 Ga0501032_0318473
1518 Ga0501033_0000364
1519 Ga0501033_0005262
1520 Ga0501033_0006818
1521 Ga0501034_0005376
1522 Ga0501034_0019811
1523 Ga0501034_0039568
1524 Ga0501034_0222923
1525 Ga0501036_0208777
1526 Ga0501036_0270537
1527 Ga0501036_0903900
1528 Ga0501037_0000162
1529 Ga0501038_0003864
1530 Ga0501038_0008423
1531 Ga0501038_0011277
1532 Ga0501038_0108142
1533 Ga0501039_0003351
1534 Ga0501039_0008915
1535 Ga0501040_0023959
1536 Ga0501040_0394221
1537 Ga0501042_0000536
1538 Ga0501043_0003874
1539 Ga0501043_0015184
1540 Ga0501043_0021892
1541 Ga0501043_0228914
1542 Ga0501043_0671568
1543 Ga0501043_1076067
1544 Ga0501046_0006470
1545 Ga0501046_0036301
1546 Ga0501047_0034699
1547 Ga0501047_0399516
1548 Ga0501067_0132629
1549 Ga0501068_0039781
1550 Ga0501070_0024315
1551 Ga0501070_0155438
1552 Ga0501071_1151839
1553 Ga0501072_0924082
1554 Ga0501076_0229878
1555 Ga0501076_0573202
1556 Ga0501076_0819307
1557 Ga0501198_000011
1558 Ga0501207_057861
1559 Ga0501222_000022
1560 Ga0501222_048286
1561 Ga0501228_003345
1562 Ga0501250_005766
1563 Ga0501083_0136365
1564 Ga0501262_012033
1565 Ga0501269_036219
1566 Ga0501270_118778
1567 Ga0501281_03705
1568 Ga0501282_005143
1569 Ga0501035_0005055
1570 Ga0501035_0103882
1571 Ga0501035_0131593
1572 Ga0501035_0443245
1573 Ga0501035_1437982
1574 Ga0501044_0001481
1575 Ga0501044_0003222
1576 Ga0501044_0018325
1577 Ga0501044_0024640
1578 Ga0501044_0059334
1579 Ga0501044_0116851
1580 Ga0501044_0457246
1581 Ga0501044_0548151
1582 Ga0501045_0014729
1583 Ga0501045_0715750
1584 nmdc:mga03683_178041_c1
1585 nmdc:mga0k408_115321_c1
1586 nmdc:mga0k408_148325_c1
1587 nmdc:mga0k408_172752_c1
1588 nmdc:mga0k408_17631_c1
1589 nmdc:mga0k408_563343_c1
1590 nmdc:mga06z11_259474_c1
1591 nmdc:mga07m45_10321_c1
1592 nmdc:mga07m45_295151_c1
1593 nmdc:mga06r32_1364471_c1
1594 nmdc:mga08y16_1374483_c1
1595 nmdc:mga08y16_1922955_c1
1596 nmdc:mga08y16_299492_c1
1597 nmdc:mga0rr50_131794_c1
1598 nmdc:mga08x19_745_c1
1599 nmdc:mga0a205_1252467_c1
1600 Ga0500646_0057574
1601 Ga0500658_0085132
1602 Ga0500568_0041414
1603 Ga0500568_0054943
1604 Ga0500604_0000078
1605 Ga0500616_0000128
1606 Ga0500616_0006548
1607 Ga0500622_0000002
1608 Ga0500645_062236
1609 Ga0590071_001070
1610 Ga0590075_150228
1611 Ga0587080_087219
1612 Ga0587083_0068047
1613 Ga0587083_0124428
1614 Ga0587088_125521
1615 Ga0587091_139457
1616 Ga0587094_077547
1617 Ga0587098_055952
1618 Ga0587067_091675
1619 Ga0587068_091984
1620 Ga0587072_087172
1621 Ga0587072_096855
1622 Ga0587076_117715
1623 Ga0587104_016271
1624 Ga0587107_083582
1625 2548846986
1626 2597030029
1627 2599443886
1628 2735817355
1629 2738829397
1630 2739153193
1631 2739195113
1632 2739321589
1633 2739339855
1634 2821131420
1635 2834641715
1636 2857564911
1637 2858692757
1638 2885267230
1639 2891634785
1640 2900582615
1641 2928062167
1642 8003402802

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

18

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.9275 5 88
7qso-assembly1.cif.gz_K bovine complex i in lipid nanodisc, state 3 (slack) 0.9245 10 88
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.92 4 88
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.913 4 88
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.9104 12 95
ID Description Score Start End Superfamily
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9278 9 96 1.10.287.3510
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9168 9 96 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9034 9 96 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8914 5 99 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.866 5 99 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A368F7W0-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) 0.9548 11 88 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
AF-A0A1E4AVB3-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.9483 4 80 GO:0016651
GO:0030964
GO:0042773
AF-A0A0U1XJ79-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) 0.9467 9 91 GO:0005739
GO:0016020
AF-A0A367IZW3-F1-model_v4 NADH dehydrogenase subunit 4 0.9459 6 95 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A7Z9I686-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9419 1 67 GO:0016651
GO:0030964
GO:0042773

Map