F482274
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 313 | 821 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300049584|Ga0501068_0848532|Ga0501068_0848532_41_466 |
| Length | 141 |
| Sequence | MGTVQGMPKVGDAATRAKTASSRDIELYTEITGDRNPLHYDAAAARGSVFGGLIVQGGITTGILNAIVAEELPGPGTVFLAMELKFVKAVYVGDTITGRVELTGVREDKPICTMAVTVRNQAGDLCLSGNATTYTAALVKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 219 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 222 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 223 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 226 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 227 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 228 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 296 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 1.1 |
| Rhizosphere | 98.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3090340 | 2162886007 | Bacteria | 969 |
| 2 | MRS1b_contig_7347823 | 2162886011 | Unclassified | 988 |
| 3 | JGI24746J21847_1005903 | 3300001977 | Bacteria | 1904 |
| 4 | JGI24746J21847_1018795 | 3300001977 | Unclassified | 977 |
| 5 | JGI24742J22300_10037705 | 3300002244 | Bacteria | 856 |
| 6 | Ga0065704_10107681 | 3300005289 | Bacteria | 2049 |
| 7 | Ga0065704_10475771 | 3300005289 | Unclassified | 677 |
| 8 | Ga0065712_10179213 | 3300005290 | Bacteria | 1202 |
| 9 | Ga0065712_10309829 | 3300005290 | Unclassified | 845 |
| 10 | Ga0065715_10017516 | 3300005293 | Bacteria | 2699 |
| 11 | Ga0065715_10934425 | 3300005293 | Unclassified | 564 |
| 12 | Ga0065707_10085184 | 3300005295 | Bacteria | 6378 |
| 13 | Ga0065707_10280353 | 3300005295 | Unclassified | 1048 |
| 14 | Ga0065707_10290541 | 3300005295 | Unclassified | 1026 |
| 15 | Ga0065707_10953746 | 3300005295 | Bacteria | 551 |
| 16 | Ga0070658_10816169 | 3300005327 | Unclassified | 810 |
| 17 | Ga0070676_10016381 | 3300005328 | Bacteria | 4097 |
| 18 | Ga0070676_10044388 | 3300005328 | Unclassified | 2587 |
| 19 | Ga0070676_11056818 | 3300005328 | Unclassified | 612 |
| 20 | Ga0070683_100022077 | 3300005329 | Bacteria | 5685 |
| 21 | Ga0070683_100025311 | 3300005329 | Bacteria | 5328 |
| 22 | Ga0070683_100111540 | 3300005329 | Bacteria | 2580 |
| 23 | Ga0070690_100023916 | 3300005330 | Bacteria | 3753 |
| 24 | Ga0070690_100546691 | 3300005330 | Bacteria | 873 |
| 25 | Ga0070670_100139832 | 3300005331 | Bacteria | 2094 |
| 26 | Ga0070670_100251587 | 3300005331 | Bacteria | 1539 |
| 27 | Ga0070670_100718420 | 3300005331 | Unclassified | 899 |
| 28 | Ga0070677_10005078 | 3300005333 | Bacteria | 4323 |
| 29 | Ga0068869_100050215 | 3300005334 | Unclassified | 3023 |
| 30 | Ga0068869_100198356 | 3300005334 | Bacteria | 1581 |
| 31 | Ga0068869_100642302 | 3300005334 | Bacteria | 900 |
| 32 | Ga0070666_10100761 | 3300005335 | Bacteria | 1990 |
| 33 | Ga0070666_10191581 | 3300005335 | Unclassified | 1437 |
| 34 | Ga0070680_100005979 | 3300005336 | Bacteria | 9231 |
| 35 | Ga0070680_100100134 | 3300005336 | Bacteria | 2405 |
| 36 | Ga0070680_100101289 | 3300005336 | Bacteria | 2391 |
| 37 | Ga0070682_100099187 | 3300005337 | Bacteria | 1920 |
| 38 | Ga0068868_100034062 | 3300005338 | Bacteria | 3930 |
| 39 | Ga0068868_100324062 | 3300005338 | Unclassified | 1313 |
| 40 | Ga0068868_101520780 | 3300005338 | Bacteria | 627 |
| 41 | Ga0070660_100096997 | 3300005339 | Bacteria | 2332 |
| 42 | Ga0070689_100072634 | 3300005340 | Bacteria | 2689 |
| 43 | Ga0070689_100781988 | 3300005340 | Bacteria | 838 |
| 44 | Ga0070691_10014882 | 3300005341 | Unclassified | 3571 |
| 45 | Ga0070691_10066612 | 3300005341 | Bacteria | 1741 |
| 46 | Ga0070691_10234061 | 3300005341 | Bacteria | 979 |
| 47 | Ga0070687_100008622 | 3300005343 | Bacteria | 4328 |
| 48 | Ga0070661_100007509 | 3300005344 | Bacteria | 7521 |
| 49 | Ga0070661_100026282 | 3300005344 | Bacteria | 4186 |
| 50 | Ga0070661_100431631 | 3300005344 | Bacteria | 1046 |
| 51 | Ga0070661_100941603 | 3300005344 | Bacteria | 714 |
| 52 | Ga0070668_100106234 | 3300005347 | Bacteria | 2230 |
| 53 | Ga0070668_100107386 | 3300005347 | Bacteria | 2219 |
| 54 | Ga0070668_101042892 | 3300005347 | Bacteria | 736 |
| 55 | Ga0070669_100017310 | 3300005353 | Bacteria | 5141 |
| 56 | Ga0070669_100058948 | 3300005353 | Plasmid | 2818 |
| 57 | Ga0070669_100195133 | 3300005353 | Unclassified | 1590 |
| 58 | Ga0070669_100309091 | 3300005353 | Bacteria | 1273 |
| 59 | Ga0070669_100969604 | 3300005353 | Unclassified | 728 |
| 60 | Ga0070669_101491412 | 3300005353 | Bacteria | 588 |
| 61 | Ga0070675_100562422 | 3300005354 | Unclassified | 1032 |
| 62 | Ga0070675_100869661 | 3300005354 | Bacteria | 825 |
| 63 | Ga0070675_101275816 | 3300005354 | Bacteria | 677 |
| 64 | Ga0070671_100207954 | 3300005355 | Bacteria | 1659 |
| 65 | Ga0070674_100004735 | 3300005356 | Bacteria | 7791 |
| 66 | Ga0070674_100006894 | 3300005356 | Bacteria | 6660 |
| 67 | Ga0070674_100588467 | 3300005356 | Bacteria | 938 |
| 68 | Ga0070673_100029315 | 3300005364 | Unclassified | 4103 |
| 69 | Ga0070673_100100980 | 3300005364 | Unclassified | 2376 |
| 70 | Ga0070688_100000962 | 3300005365 | Bacteria | 14417 |
| 71 | Ga0070688_100056301 | 3300005365 | Bacteria | 2469 |
| 72 | Ga0070688_101035351 | 3300005365 | Bacteria | 654 |
| 73 | Ga0070688_101240837 | 3300005365 | Bacteria | 600 |
| 74 | Ga0070659_100009099 | 3300005366 | Bacteria | 7285 |
| 75 | Ga0070659_100345311 | 3300005366 | Bacteria | 1248 |
| 76 | Ga0070667_100031981 | 3300005367 | Bacteria | 4387 |
| 77 | Ga0070667_101177264 | 3300005367 | Bacteria | 717 |
| 78 | Ga0070703_10058468 | 3300005406 | Bacteria | 1255 |
| 79 | Ga0070703_10168449 | 3300005406 | Bacteria | 837 |
| 80 | Ga0070709_10001469 | 3300005434 | Bacteria | 12722 |
| 81 | Ga0070709_10387287 | 3300005434 | Bacteria | 1041 |
| 82 | Ga0070714_100018344 | 3300005435 | Bacteria | 5683 |
| 83 | Ga0070714_100223076 | 3300005435 | Bacteria | 1733 |
| 84 | Ga0070713_100001501 | 3300005436 | Bacteria | 14883 |
| 85 | Ga0070713_100501893 | 3300005436 | Bacteria | 1145 |
| 86 | Ga0070701_10049952 | 3300005438 | Bacteria | 2164 |
| 87 | Ga0070711_100000395 | 3300005439 | Bacteria | 22479 |
| 88 | Ga0070711_100624640 | 3300005439 | Unclassified | 901 |
| 89 | Ga0070705_100007996 | 3300005440 | Bacteria | 5227 |
| 90 | Ga0070705_100063806 | 3300005440 | Bacteria | 2198 |
| 91 | Ga0070705_100333440 | 3300005440 | Bacteria | 1100 |
| 92 | Ga0070705_100701326 | 3300005440 | Unclassified | 795 |
| 93 | Ga0070705_101943172 | 3300005440 | Unclassified | 501 |
| 94 | Ga0070700_100558259 | 3300005441 | Unclassified | 891 |
| 95 | Ga0070694_100004758 | 3300005444 | Bacteria | 8177 |
| 96 | Ga0070694_100181736 | 3300005444 | Bacteria | 1556 |
| 97 | Ga0070694_100260372 | 3300005444 | Bacteria | 1315 |
| 98 | Ga0070694_100336162 | 3300005444 | Bacteria | 1166 |
| 99 | Ga0070708_100002004 | 3300005445 | Bacteria | 15669 |
| 100 | Ga0070708_100970972 | 3300005445 | Bacteria | 797 |
| 101 | Ga0070708_100977370 | 3300005445 | Unclassified | 794 |
| 102 | Ga0070708_101411936 | 3300005445 | Unclassified | 649 |
| 103 | Ga0070708_101544986 | 3300005445 | Bacteria | 618 |
| 104 | Ga0070678_100008983 | 3300005456 | Bacteria | 6019 |
| 105 | Ga0070678_100242567 | 3300005456 | Unclassified | 1507 |
| 106 | Ga0070678_100886985 | 3300005456 | Unclassified | 815 |
| 107 | Ga0070678_101285479 | 3300005456 | Unclassified | 680 |
| 108 | Ga0070662_100004071 | 3300005457 | Bacteria | 9188 |
| 109 | Ga0070662_101510244 | 3300005457 | Bacteria | 579 |
| 110 | Ga0070681_10000857 | 3300005458 | Bacteria | 25575 |
| 111 | Ga0070681_10002670 | 3300005458 | Bacteria | 16378 |
| 112 | Ga0070681_10268187 | 3300005458 | Bacteria | 1618 |
| 113 | Ga0070681_10659412 | 3300005458 | Unclassified | 961 |
| 114 | Ga0068867_100018446 | 3300005459 | Bacteria | 4960 |
| 115 | Ga0068867_100271215 | 3300005459 | Bacteria | 1387 |
| 116 | Ga0068867_100772484 | 3300005459 | Bacteria | 854 |
| 117 | Ga0070685_10396735 | 3300005466 | Bacteria | 954 |
| 118 | Ga0070707_100052251 | 3300005468 | Bacteria | 3918 |
| 119 | Ga0070707_100074613 | 3300005468 | Bacteria | 3271 |
| 120 | Ga0070707_102014512 | 3300005468 | Bacteria | 545 |
| 121 | Ga0070698_100119735 | 3300005471 | Bacteria | 2593 |
| 122 | Ga0070698_100190385 | 3300005471 | Bacteria | 1989 |
| 123 | Ga0070698_100235724 | 3300005471 | Bacteria | 1763 |
| 124 | Ga0070698_100399011 | 3300005471 | Unclassified | 1308 |
| 125 | Ga0070698_101181702 | 3300005471 | Bacteria | 714 |
| 126 | Ga0070698_101327485 | 3300005471 | Bacteria | 669 |
| 127 | Ga0070699_100113259 | 3300005518 | Bacteria | 2383 |
| 128 | Ga0070699_101878236 | 3300005518 | Unclassified | 548 |
| 129 | Ga0070679_100000924 | 3300005530 | Bacteria | 25545 |
| 130 | Ga0070679_100007124 | 3300005530 | Bacteria | 10438 |
| 131 | Ga0070679_100010037 | 3300005530 | Bacteria | 8968 |
| 132 | Ga0070679_100023377 | 3300005530 | Bacteria | 6049 |
| 133 | Ga0070684_100005166 | 3300005535 | Bacteria | 9981 |
| 134 | Ga0070684_100005387 | 3300005535 | Bacteria | 9803 |
| 135 | Ga0070684_100044553 | 3300005535 | Bacteria | 3838 |
| 136 | Ga0070684_100095964 | 3300005535 | Bacteria | 2642 |
| 137 | Ga0070684_100282863 | 3300005535 | Bacteria | 1520 |
| 138 | Ga0070697_100135178 | 3300005536 | Unclassified | 2070 |
| 139 | Ga0070697_100387765 | 3300005536 | Bacteria | 1211 |
| 140 | Ga0068853_100244178 | 3300005539 | Bacteria | 1646 |
| 141 | Ga0070672_100039084 | 3300005543 | Bacteria | 3632 |
| 142 | Ga0070672_100554576 | 3300005543 | Unclassified | 998 |
| 143 | Ga0070672_101966103 | 3300005543 | Unclassified | 526 |
| 144 | Ga0070695_100009930 | 3300005545 | Bacteria | 5674 |
| 145 | Ga0070695_100016981 | 3300005545 | Bacteria | 4413 |
| 146 | Ga0070695_100091297 | 3300005545 | Bacteria | 2034 |
| 147 | Ga0070696_100041120 | 3300005546 | Bacteria | 3193 |
| 148 | Ga0070696_100096187 | 3300005546 | Bacteria | 2116 |
| 149 | Ga0070693_100041763 | 3300005547 | Bacteria | 2582 |
| 150 | Ga0070665_100474274 | 3300005548 | Unclassified | 1262 |
| 151 | Ga0070665_101085792 | 3300005548 | Bacteria | 812 |
| 152 | Ga0070704_100110008 | 3300005549 | Bacteria | 2095 |
| 153 | Ga0070704_101761225 | 3300005549 | Unclassified | 573 |
| 154 | Ga0070704_101956123 | 3300005549 | Unclassified | 544 |
| 155 | Ga0068855_100089330 | 3300005563 | Bacteria | 3557 |
| 156 | Ga0068855_100127202 | 3300005563 | Bacteria | 2912 |
| 157 | Ga0068855_100339396 | 3300005563 | Bacteria | 1657 |
| 158 | Ga0068855_100485257 | 3300005563 | Bacteria | 1345 |
| 159 | Ga0068855_100788143 | 3300005563 | Bacteria | 1011 |
| 160 | Ga0068855_101249569 | 3300005563 | Bacteria | 770 |
| 161 | Ga0070664_100023271 | 3300005564 | Bacteria | 5116 |
| 162 | Ga0070664_100135458 | 3300005564 | Bacteria | 2165 |
| 163 | Ga0068857_100010501 | 3300005577 | Bacteria | 8048 |
| 164 | Ga0068857_100034089 | 3300005577 | Bacteria | 4504 |
| 165 | Ga0068857_100224213 | 3300005577 | Bacteria | 1718 |
| 166 | Ga0068857_100461313 | 3300005577 | Bacteria | 1189 |
| 167 | Ga0068854_100023851 | 3300005578 | Bacteria | 4181 |
| 168 | Ga0068854_100070969 | 3300005578 | Bacteria | 2546 |
| 169 | Ga0068856_100171932 | 3300005614 | Bacteria | 2179 |
| 170 | Ga0068856_100221555 | 3300005614 | Unclassified | 1907 |
| 171 | Ga0068856_100383410 | 3300005614 | Unclassified | 1425 |
| 172 | Ga0068856_100384463 | 3300005614 | Bacteria | 1423 |
| 173 | Ga0068856_100395308 | 3300005614 | Bacteria | 1402 |
| 174 | Ga0068856_100668769 | 3300005614 | Bacteria | 1059 |
| 175 | Ga0070702_100065981 | 3300005615 | Unclassified | 2121 |
| 176 | Ga0070702_101572413 | 3300005615 | Bacteria | 543 |
| 177 | Ga0068852_100202518 | 3300005616 | Bacteria | 1879 |
| 178 | Ga0068852_100296547 | 3300005616 | Bacteria | 1563 |
| 179 | Ga0068852_100721904 | 3300005616 | Bacteria | 1007 |
| 180 | Ga0068852_102535176 | 3300005616 | Bacteria | 533 |
| 181 | Ga0068859_100063067 | 3300005617 | Bacteria | 3736 |
| 182 | Ga0068859_100102931 | 3300005617 | Bacteria | 2913 |
| 183 | Ga0068859_100335684 | 3300005617 | Bacteria | 1606 |
| 184 | Ga0068859_100339909 | 3300005617 | Bacteria | 1595 |
| 185 | Ga0068859_100437093 | 3300005617 | Bacteria | 1405 |
| 186 | Ga0068859_100637673 | 3300005617 | Bacteria | 1158 |
| 187 | Ga0068859_101324515 | 3300005617 | Bacteria | 794 |
| 188 | Ga0068864_100000808 | 3300005618 | Bacteria | 26308 |
| 189 | Ga0068864_100055483 | 3300005618 | Bacteria | 3421 |
| 190 | Ga0068864_100654107 | 3300005618 | Bacteria | 1023 |
| 191 | Ga0068866_10000622 | 3300005718 | Bacteria | 16181 |
| 192 | Ga0068861_100088044 | 3300005719 | Bacteria | 2444 |
| 193 | Ga0068861_101480848 | 3300005719 | Bacteria | 665 |
| 194 | Ga0068851_10039531 | 3300005834 | Bacteria | 2369 |
| 195 | Ga0068870_10006745 | 3300005840 | Bacteria | 5086 |
| 196 | Ga0068870_10008802 | 3300005840 | Bacteria | 4553 |
| 197 | Ga0068870_10040468 | 3300005840 | Bacteria | 2417 |
| 198 | Ga0068870_10242642 | 3300005840 | Bacteria | 1113 |
| 199 | Ga0068863_100824988 | 3300005841 | Bacteria | 925 |
| 200 | Ga0068863_100991921 | 3300005841 | Unclassified | 842 |
| 201 | Ga0068858_100005538 | 3300005842 | Bacteria | 12362 |
| 202 | Ga0068858_100028383 | 3300005842 | Bacteria | 5199 |
| 203 | Ga0068858_100161843 | 3300005842 | Unclassified | 2107 |
| 204 | Ga0068858_100437128 | 3300005842 | Bacteria | 1260 |
| 205 | Ga0068860_100047100 | 3300005843 | Bacteria | 4109 |
| 206 | Ga0068860_100048103 | 3300005843 | Bacteria | 4065 |
| 207 | Ga0068860_100723234 | 3300005843 | Bacteria | 1006 |
| 208 | Ga0068860_102424643 | 3300005843 | Unclassified | 545 |
| 209 | Ga0068862_100081503 | 3300005844 | Bacteria | 2807 |
| 210 | Ga0068862_100154147 | 3300005844 | Bacteria | 2047 |
| 211 | Ga0068862_100159333 | 3300005844 | Bacteria | 2014 |
| 212 | Ga0068862_100216817 | 3300005844 | Bacteria | 1731 |
| 213 | Ga0068862_100746415 | 3300005844 | Bacteria | 952 |
| 214 | Ga0068862_101218614 | 3300005844 | Bacteria | 752 |
| 215 | Ga0068862_102160210 | 3300005844 | Bacteria | 568 |
| 216 | Ga0070717_10009515 | 3300006028 | Bacteria | 7309 |
| 217 | Ga0070715_10202067 | 3300006163 | Bacteria | 1010 |
| 218 | Ga0097621_100083684 | 3300006237 | Unclassified | 2659 |
| 219 | Ga0097621_100151740 | 3300006237 | Bacteria | 1987 |
| 220 | Ga0097621_100168103 | 3300006237 | Bacteria | 1889 |
| 221 | Ga0068871_100163873 | 3300006358 | Bacteria | 1902 |
| 222 | Ga0068871_100164587 | 3300006358 | Unclassified | 1898 |
| 223 | Ga0068871_102145162 | 3300006358 | Bacteria | 532 |
| 224 | Ga0075428_100008283 | 3300006844 | Bacteria | 11525 |
| 225 | Ga0075428_100026824 | 3300006844 | Bacteria | 6379 |
| 226 | Ga0075428_100410673 | 3300006844 | Bacteria | 1451 |
| 227 | Ga0075428_101426050 | 3300006844 | Bacteria | 726 |
| 228 | Ga0075430_100004611 | 3300006846 | Bacteria | 11607 |
| 229 | Ga0075430_100017467 | 3300006846 | Bacteria | 6111 |
| 230 | Ga0075430_100125114 | 3300006846 | Bacteria | 2143 |
| 231 | Ga0075430_100268252 | 3300006846 | Unclassified | 1413 |
| 232 | Ga0075431_100016666 | 3300006847 | Bacteria | 7461 |
| 233 | Ga0075431_100201898 | 3300006847 | Bacteria | 2034 |
| 234 | Ga0075433_10004730 | 3300006852 | Bacteria | 10617 |
| 235 | Ga0075433_10006512 | 3300006852 | Bacteria | 9239 |
| 236 | Ga0075433_10119365 | 3300006852 | Bacteria | 2341 |
| 237 | Ga0075433_10120871 | 3300006852 | Bacteria | 2326 |
| 238 | Ga0075433_10129820 | 3300006852 | Bacteria | 2239 |
| 239 | Ga0075433_10157465 | 3300006852 | Bacteria | 2021 |
| 240 | Ga0075433_10180798 | 3300006852 | Bacteria | 1877 |
| 241 | Ga0075433_10874776 | 3300006852 | Unclassified | 784 |
| 242 | Ga0075434_100003938 | 3300006871 | Bacteria | 13303 |
| 243 | Ga0075434_100015773 | 3300006871 | Bacteria | 7252 |
| 244 | Ga0075434_100041599 | 3300006871 | Bacteria | 4553 |
| 245 | Ga0075434_100054083 | 3300006871 | Bacteria | 3988 |
| 246 | Ga0075434_100484624 | 3300006871 | Unclassified | 1258 |
| 247 | Ga0075434_100585423 | 3300006871 | Bacteria | 1135 |
| 248 | Ga0075434_100701851 | 3300006871 | Bacteria | 1029 |
| 249 | Ga0075434_100745445 | 3300006871 | Bacteria | 996 |
| 250 | Ga0075434_101313221 | 3300006871 | Bacteria | 734 |
| 251 | Ga0075434_101320581 | 3300006871 | Bacteria | 732 |
| 252 | Ga0075434_102333447 | 3300006871 | Bacteria | 538 |
| 253 | Ga0075429_100038955 | 3300006880 | Bacteria | 4137 |
| 254 | Ga0075429_100112926 | 3300006880 | Bacteria | 2374 |
| 255 | Ga0075429_100115857 | 3300006880 | Bacteria | 2343 |
| 256 | Ga0068865_100004039 | 3300006881 | Bacteria | 8814 |
| 257 | Ga0068865_100991361 | 3300006881 | Unclassified | 735 |
| 258 | Ga0075436_100017379 | 3300006914 | Bacteria | 4924 |
| 259 | Ga0075436_100068509 | 3300006914 | Bacteria | 2451 |
| 260 | Ga0075436_100259917 | 3300006914 | Bacteria | 1238 |
| 261 | Ga0097620_100063070 | 3300006931 | Bacteria | 3736 |
| 262 | Ga0097620_100102946 | 3300006931 | Bacteria | 2913 |
| 263 | Ga0097620_100335697 | 3300006931 | Bacteria | 1606 |
| 264 | Ga0097620_100339929 | 3300006931 | Bacteria | 1595 |
| 265 | Ga0097620_100437121 | 3300006931 | Bacteria | 1405 |
| 266 | Ga0097620_100637628 | 3300006931 | Bacteria | 1158 |
| 267 | Ga0097620_101324480 | 3300006931 | Bacteria | 794 |
| 268 | Ga0075435_100114545 | 3300007076 | Bacteria | 2244 |
| 269 | Ga0075435_100496263 | 3300007076 | Bacteria | 1055 |
| 270 | Ga0075435_100938945 | 3300007076 | Bacteria | 755 |
| 271 | Ga0075435_101005875 | 3300007076 | Bacteria | 728 |
| 272 | Ga0099794_10111313 | 3300007265 | Bacteria | 1372 |
| 273 | Ga0105240_10046309 | 3300009093 | Bacteria | 5511 |
| 274 | Ga0105240_10059528 | 3300009093 | Bacteria | 4766 |
| 275 | Ga0105240_10191668 | 3300009093 | Unclassified | 2403 |
| 276 | Ga0105240_10208317 | 3300009093 | Bacteria | 2286 |
| 277 | Ga0105240_10397314 | 3300009093 | Bacteria | 1553 |
| 278 | Ga0105240_11341500 | 3300009093 | Bacteria | 753 |
| 279 | Ga0105240_11516081 | 3300009093 | Bacteria | 703 |
| 280 | Ga0105240_11620829 | 3300009093 | Bacteria | 677 |
| 281 | Ga0111539_10000538 | 3300009094 | Bacteria | 48180 |
| 282 | Ga0111539_10179483 | 3300009094 | Bacteria | 2473 |
| 283 | Ga0111539_11766176 | 3300009094 | Unclassified | 717 |
| 284 | Ga0105245_10229926 | 3300009098 | Unclassified | 1793 |
| 285 | Ga0105245_11116699 | 3300009098 | Bacteria | 835 |
| 286 | Ga0105245_11764017 | 3300009098 | Bacteria | 672 |
| 287 | Ga0105247_10029435 | 3300009101 | Bacteria | 3327 |
| 288 | Ga0105247_10342378 | 3300009101 | Unclassified | 1049 |
| 289 | Ga0114129_10044723 | 3300009147 | Bacteria | 6229 |
| 290 | Ga0114129_10241115 | 3300009147 | Bacteria | 2430 |
| 291 | Ga0114129_10311196 | 3300009147 | Bacteria | 2096 |
| 292 | Ga0114129_10663598 | 3300009147 | Bacteria | 1344 |
| 293 | Ga0114129_12262037 | 3300009147 | Unclassified | 653 |
| 294 | Ga0105243_10146569 | 3300009148 | Unclassified | 2020 |
| 295 | Ga0105243_10211014 | 3300009148 | Bacteria | 1710 |
| 296 | Ga0105243_10538199 | 3300009148 | Bacteria | 1114 |
| 297 | Ga0105241_10015144 | 3300009174 | Bacteria | 5648 |
| 298 | Ga0105241_10341291 | 3300009174 | Bacteria | 1298 |
| 299 | Ga0105241_11412751 | 3300009174 | Bacteria | 667 |
| 300 | Ga0105242_10271682 | 3300009176 | Bacteria | 1536 |
| 301 | Ga0105242_11566824 | 3300009176 | Bacteria | 691 |
| 302 | Ga0105242_13237381 | 3300009176 | Bacteria | 506 |
| 303 | Ga0105248_10015782 | 3300009177 | Bacteria | 8325 |
| 304 | Ga0105248_10048596 | 3300009177 | Bacteria | 4759 |
| 305 | Ga0105248_10358334 | 3300009177 | Bacteria | 1642 |
| 306 | Ga0105248_10596299 | 3300009177 | Bacteria | 1247 |
| 307 | Ga0105248_12247339 | 3300009177 | Unclassified | 621 |
| 308 | Ga0105237_10453565 | 3300009545 | Bacteria | 1288 |
| 309 | Ga0105237_11348473 | 3300009545 | Unclassified | 720 |
| 310 | Ga0105237_11568470 | 3300009545 | Bacteria | 665 |
| 311 | Ga0105237_12164916 | 3300009545 | Unclassified | 565 |
| 312 | Ga0105237_12474661 | 3300009545 | Bacteria | 529 |
| 313 | Ga0105238_10150008 | 3300009551 | Bacteria | 2306 |
| 314 | Ga0105238_10370067 | 3300009551 | Bacteria | 1423 |
| 315 | Ga0105238_11922225 | 3300009551 | Unclassified | 625 |
| 316 | Ga0105249_10086258 | 3300009553 | Bacteria | 2927 |
| 317 | Ga0105249_10117150 | 3300009553 | Bacteria | 2526 |
| 318 | Ga0105249_10209614 | 3300009553 | Unclassified | 1912 |
| 319 | Ga0105249_10316566 | 3300009553 | Unclassified | 1570 |
| 320 | Ga0105249_10737523 | 3300009553 | Bacteria | 1047 |
| 321 | Ga0105249_10801055 | 3300009553 | Bacteria | 1006 |
| 322 | Ga0105249_10903643 | 3300009553 | Bacteria | 950 |
| 323 | Ga0105239_10058947 | 3300010375 | Bacteria | 4214 |
| 324 | Ga0105239_10296177 | 3300010375 | Bacteria | 1822 |
| 325 | Ga0105239_11030392 | 3300010375 | Bacteria | 947 |
| 326 | Ga0105246_10009650 | 3300011119 | Bacteria | 5948 |
| 327 | Ga0105246_10026634 | 3300011119 | Bacteria | 3781 |
| 328 | Ga0105246_10287913 | 3300011119 | Bacteria | 1321 |
| 329 | Ga0105246_10959677 | 3300011119 | Bacteria | 771 |
| 330 | Ga0157373_10006113 | 3300013100 | Bacteria | 9002 |
| 331 | Ga0157373_10008139 | 3300013100 | Bacteria | 7798 |
| 332 | Ga0157373_10592253 | 3300013100 | Unclassified | 807 |
| 333 | Ga0157373_10610590 | 3300013100 | Unclassified | 794 |
| 334 | Ga0157370_10036803 | 3300013104 | Bacteria | 4748 |
| 335 | Ga0157370_10041048 | 3300013104 | Bacteria | 4466 |
| 336 | Ga0157370_10082090 | 3300013104 | Bacteria | 3033 |
| 337 | Ga0157370_10139785 | 3300013104 | Unclassified | 2256 |
| 338 | Ga0157370_10343630 | 3300013104 | Bacteria | 1375 |
| 339 | Ga0157370_10482976 | 3300013104 | Unclassified | 1138 |
| 340 | Ga0157370_10532707 | 3300013104 | Bacteria | 1077 |
| 341 | Ga0157370_11162709 | 3300013104 | Bacteria | 697 |
| 342 | Ga0157369_10021262 | 3300013105 | Bacteria | 7257 |
| 343 | Ga0157369_10022113 | 3300013105 | Bacteria | 7104 |
| 344 | Ga0157369_10120701 | 3300013105 | Unclassified | 2782 |
| 345 | Ga0157369_10262498 | 3300013105 | Bacteria | 1801 |
| 346 | Ga0157369_10300046 | 3300013105 | Bacteria | 1671 |
| 347 | Ga0157369_10371513 | 3300013105 | Bacteria | 1484 |
| 348 | Ga0157369_10410123 | 3300013105 | Bacteria | 1405 |
| 349 | Ga0157369_10600419 | 3300013105 | Bacteria | 1136 |
| 350 | Ga0157369_12311297 | 3300013105 | Unclassified | 545 |
| 351 | Ga0157374_10439314 | 3300013296 | Bacteria | 1305 |
| 352 | Ga0157374_11246992 | 3300013296 | Bacteria | 765 |
| 353 | Ga0157374_12528854 | 3300013296 | Unclassified | 541 |
| 354 | Ga0157378_10032881 | 3300013297 | Unclassified | 4584 |
| 355 | Ga0163162_10036256 | 3300013306 | Bacteria | 4914 |
| 356 | Ga0163162_10102699 | 3300013306 | Unclassified | 2953 |
| 357 | Ga0163162_12402203 | 3300013306 | Unclassified | 606 |
| 358 | Ga0157372_10011579 | 3300013307 | Bacteria | 9385 |
| 359 | Ga0157372_10012424 | 3300013307 | Bacteria | 9076 |
| 360 | Ga0157372_10025733 | 3300013307 | Bacteria | 6401 |
| 361 | Ga0157372_10044399 | 3300013307 | Bacteria | 4924 |
| 362 | Ga0157372_10471837 | 3300013307 | Bacteria | 1463 |
| 363 | Ga0157375_10091378 | 3300013308 | Bacteria | 3106 |
| 364 | Ga0157375_10197222 | 3300013308 | Bacteria | 2168 |
| 365 | Ga0157375_10498405 | 3300013308 | Unclassified | 1382 |
| 366 | Ga0157375_10920548 | 3300013308 | Bacteria | 1017 |
| 367 | Ga0163163_10229071 | 3300014325 | Bacteria | 1907 |
| 368 | Ga0157380_10007796 | 3300014326 | Bacteria | 7619 |
| 369 | Ga0157380_10014458 | 3300014326 | Bacteria | 5774 |
| 370 | Ga0157380_10021654 | 3300014326 | Bacteria | 4825 |
| 371 | Ga0157380_10105668 | 3300014326 | Bacteria | 2354 |
| 372 | Ga0157380_10598207 | 3300014326 | Unclassified | 1090 |
| 373 | Ga0157380_11668258 | 3300014326 | Bacteria | 694 |
| 374 | Ga0182008_10458431 | 3300014497 | Bacteria | 694 |
| 375 | Ga0157377_10260657 | 3300014745 | Bacteria | 1128 |
| 376 | Ga0157379_10028104 | 3300014968 | Bacteria | 5006 |
| 377 | Ga0157379_10067008 | 3300014968 | Bacteria | 3210 |
| 378 | Ga0157376_10277619 | 3300014969 | Bacteria | 1577 |
| 379 | Ga0157376_10428804 | 3300014969 | Bacteria | 1285 |
| 380 | Ga0157376_10491124 | 3300014969 | Bacteria | 1205 |
| 381 | Ga0163161_10005896 | 3300017792 | Bacteria | 8498 |
| 382 | Ga0163161_10079041 | 3300017792 | Bacteria | 2418 |
| 383 | Ga0163161_10715563 | 3300017792 | Unclassified | 835 |
| 384 | Ga0163161_11179949 | 3300017792 | Bacteria | 661 |
| 385 | Ga0206356_10206487 | 3300020070 | Bacteria | 1496 |
| 386 | Ga0206353_10366391 | 3300020082 | Bacteria | 1790 |
| 387 | Ga0213876_10254517 | 3300021384 | Unclassified | 933 |
| 388 | Ga0207697_10001167 | 3300025315 | Bacteria | 14410 |
| 389 | Ga0207656_10027037 | 3300025321 | Bacteria | 2344 |
| 390 | Ga0207656_10028196 | 3300025321 | Bacteria | 2303 |
| 391 | Ga0207653_10000528 | 3300025885 | Bacteria | 14414 |
| 392 | Ga0207653_10039485 | 3300025885 | Bacteria | 1545 |
| 393 | Ga0207653_10261613 | 3300025885 | Unclassified | 665 |
| 394 | Ga0207682_10003279 | 3300025893 | Bacteria | 7078 |
| 395 | Ga0207682_10019128 | 3300025893 | Bacteria | 2680 |
| 396 | Ga0207642_10001495 | 3300025899 | Bacteria | 7208 |
| 397 | Ga0207642_10664893 | 3300025899 | Unclassified | 654 |
| 398 | Ga0207710_10137492 | 3300025900 | Bacteria | 1178 |
| 399 | Ga0207688_10004841 | 3300025901 | Bacteria | 7331 |
| 400 | Ga0207680_10068497 | 3300025903 | Bacteria | 2189 |
| 401 | Ga0207680_10205043 | 3300025903 | Bacteria | 1346 |
| 402 | Ga0207680_10263434 | 3300025903 | Unclassified | 1194 |
| 403 | Ga0207647_10286326 | 3300025904 | Bacteria | 940 |
| 404 | Ga0207685_10163786 | 3300025905 | Unclassified | 1017 |
| 405 | Ga0207699_10021613 | 3300025906 | Bacteria | 3471 |
| 406 | Ga0207699_10602461 | 3300025906 | Bacteria | 800 |
| 407 | Ga0207645_10003863 | 3300025907 | Bacteria | 11211 |
| 408 | Ga0207645_10011601 | 3300025907 | Bacteria | 6010 |
| 409 | Ga0207643_10001455 | 3300025908 | Bacteria | 13577 |
| 410 | Ga0207643_10008047 | 3300025908 | Bacteria | 5655 |
| 411 | Ga0207643_10009672 | 3300025908 | Bacteria | 5177 |
| 412 | Ga0207643_10081260 | 3300025908 | Unclassified | 1878 |
| 413 | Ga0207643_10118306 | 3300025908 | Bacteria | 1567 |
| 414 | Ga0207643_10127074 | 3300025908 | Bacteria | 1514 |
| 415 | Ga0207684_10031113 | 3300025910 | Bacteria | 4542 |
| 416 | Ga0207684_10457109 | 3300025910 | Bacteria | 1096 |
| 417 | Ga0207684_10644718 | 3300025910 | Unclassified | 903 |
| 418 | Ga0207654_10025951 | 3300025911 | Bacteria | 3167 |
| 419 | Ga0207707_10019304 | 3300025912 | Bacteria | 5949 |
| 420 | Ga0207707_10180764 | 3300025912 | Bacteria | 1841 |
| 421 | Ga0207707_10270175 | 3300025912 | Bacteria | 1474 |
| 422 | Ga0207707_10725595 | 3300025912 | Bacteria | 833 |
| 423 | Ga0207707_10728274 | 3300025912 | Bacteria | 831 |
| 424 | Ga0207707_10729336 | 3300025912 | Bacteria | 830 |
| 425 | Ga0207695_10016423 | 3300025913 | Bacteria | 8662 |
| 426 | Ga0207695_10021694 | 3300025913 | Bacteria | 7321 |
| 427 | Ga0207695_10043911 | 3300025913 | Bacteria | 4759 |
| 428 | Ga0207695_10056696 | 3300025913 | Bacteria | 4076 |
| 429 | Ga0207695_10093519 | 3300025913 | Bacteria | 3015 |
| 430 | Ga0207695_10177887 | 3300025913 | Unclassified | 2049 |
| 431 | Ga0207695_10305110 | 3300025913 | Bacteria | 1483 |
| 432 | Ga0207695_10351933 | 3300025913 | Bacteria | 1360 |
| 433 | Ga0207671_10541336 | 3300025914 | Unclassified | 928 |
| 434 | Ga0207671_10682758 | 3300025914 | Bacteria | 817 |
| 435 | Ga0207660_10028143 | 3300025917 | Bacteria | 3843 |
| 436 | Ga0207660_10068958 | 3300025917 | Bacteria | 2566 |
| 437 | Ga0207660_10087225 | 3300025917 | Bacteria | 2305 |
| 438 | Ga0207662_10009327 | 3300025918 | Bacteria | 5395 |
| 439 | Ga0207662_10015377 | 3300025918 | Bacteria | 4306 |
| 440 | Ga0207662_11116726 | 3300025918 | Unclassified | 560 |
| 441 | Ga0207657_10104968 | 3300025919 | Bacteria | 2340 |
| 442 | Ga0207657_10118678 | 3300025919 | Bacteria | 2177 |
| 443 | Ga0207657_10453211 | 3300025919 | Bacteria | 1006 |
| 444 | Ga0207649_10007168 | 3300025920 | Bacteria | 6060 |
| 445 | Ga0207649_10080026 | 3300025920 | Bacteria | 2112 |
| 446 | Ga0207649_10111178 | 3300025920 | Bacteria | 1831 |
| 447 | Ga0207649_10258873 | 3300025920 | Bacteria | 1257 |
| 448 | Ga0207649_10731697 | 3300025920 | Bacteria | 769 |
| 449 | Ga0207652_10007095 | 3300025921 | Bacteria | 9027 |
| 450 | Ga0207652_10177997 | 3300025921 | Bacteria | 1910 |
| 451 | Ga0207652_10841185 | 3300025921 | Bacteria | 813 |
| 452 | Ga0207652_10970579 | 3300025921 | Bacteria | 748 |
| 453 | Ga0207646_10001564 | 3300025922 | Bacteria | 28014 |
| 454 | Ga0207646_10097986 | 3300025922 | Bacteria | 2627 |
| 455 | Ga0207646_11126822 | 3300025922 | Bacteria | 690 |
| 456 | Ga0207646_11663688 | 3300025922 | Unclassified | 549 |
| 457 | Ga0207646_11739667 | 3300025922 | Bacteria | 535 |
| 458 | Ga0207681_10068742 | 3300025923 | Bacteria | 2461 |
| 459 | Ga0207681_10238544 | 3300025923 | Unclassified | 1414 |
| 460 | Ga0207681_10460184 | 3300025923 | Bacteria | 1036 |
| 461 | Ga0207681_10482698 | 3300025923 | Bacteria | 1012 |
| 462 | Ga0207681_10570530 | 3300025923 | Bacteria | 933 |
| 463 | Ga0207681_11292550 | 3300025923 | Unclassified | 613 |
| 464 | Ga0207694_10044734 | 3300025924 | Bacteria | 3419 |
| 465 | Ga0207694_10176592 | 3300025924 | Bacteria | 1731 |
| 466 | Ga0207694_10432399 | 3300025924 | Bacteria | 1097 |
| 467 | Ga0207694_10940635 | 3300025924 | Unclassified | 731 |
| 468 | Ga0207650_10023723 | 3300025925 | Unclassified | 4356 |
| 469 | Ga0207650_10095642 | 3300025925 | Bacteria | 2277 |
| 470 | Ga0207650_10140751 | 3300025925 | Bacteria | 1896 |
| 471 | Ga0207650_10232895 | 3300025925 | Unclassified | 1486 |
| 472 | Ga0207650_10350029 | 3300025925 | Unclassified | 1215 |
| 473 | Ga0207650_10515628 | 3300025925 | Unclassified | 1000 |
| 474 | Ga0207659_10126749 | 3300025926 | Bacteria | 1964 |
| 475 | Ga0207659_10395868 | 3300025926 | Bacteria | 1154 |
| 476 | Ga0207659_10635235 | 3300025926 | Unclassified | 912 |
| 477 | Ga0207687_10604142 | 3300025927 | Bacteria | 925 |
| 478 | Ga0207700_10017897 | 3300025928 | Bacteria | 4744 |
| 479 | Ga0207664_10236792 | 3300025929 | Bacteria | 1588 |
| 480 | Ga0207664_10838424 | 3300025929 | Bacteria | 826 |
| 481 | Ga0207664_10872239 | 3300025929 | Unclassified | 809 |
| 482 | Ga0207644_11353542 | 3300025931 | Unclassified | 598 |
| 483 | Ga0207690_10002601 | 3300025932 | Bacteria | 10886 |
| 484 | Ga0207690_10591278 | 3300025932 | Bacteria | 905 |
| 485 | Ga0207690_10732238 | 3300025932 | Bacteria | 814 |
| 486 | Ga0207690_10976900 | 3300025932 | Unclassified | 704 |
| 487 | Ga0207706_10000218 | 3300025933 | Bacteria | 62776 |
| 488 | Ga0207706_10252509 | 3300025933 | Bacteria | 1540 |
| 489 | Ga0207686_10002437 | 3300025934 | Bacteria | 10120 |
| 490 | Ga0207686_10005688 | 3300025934 | Bacteria | 6684 |
| 491 | Ga0207686_10626626 | 3300025934 | Unclassified | 849 |
| 492 | Ga0207709_10015176 | 3300025935 | Bacteria | 4270 |
| 493 | Ga0207709_10115993 | 3300025935 | Bacteria | 1800 |
| 494 | Ga0207709_10363511 | 3300025935 | Bacteria | 1096 |
| 495 | Ga0207670_10013106 | 3300025936 | Unclassified | 4878 |
| 496 | Ga0207670_10183131 | 3300025936 | Bacteria | 1579 |
| 497 | Ga0207670_10301509 | 3300025936 | Unclassified | 1255 |
| 498 | Ga0207670_10387709 | 3300025936 | Bacteria | 1114 |
| 499 | Ga0207670_10920000 | 3300025936 | Unclassified | 733 |
| 500 | Ga0207669_10000933 | 3300025937 | Bacteria | 12357 |
| 501 | Ga0207669_10041790 | 3300025937 | Unclassified | 2671 |
| 502 | Ga0207669_10727899 | 3300025937 | Unclassified | 817 |
| 503 | Ga0207704_10134275 | 3300025938 | Unclassified | 1720 |
| 504 | Ga0207704_10363145 | 3300025938 | Bacteria | 1131 |
| 505 | Ga0207665_10007638 | 3300025939 | Bacteria | 7138 |
| 506 | Ga0207665_10355486 | 3300025939 | Unclassified | 1106 |
| 507 | Ga0207691_10007060 | 3300025940 | Bacteria | 10835 |
| 508 | Ga0207691_10030230 | 3300025940 | Bacteria | 5063 |
| 509 | Ga0207691_10246920 | 3300025940 | Bacteria | 1542 |
| 510 | Ga0207711_10051808 | 3300025941 | Bacteria | 3517 |
| 511 | Ga0207711_10069994 | 3300025941 | Bacteria | 3042 |
| 512 | Ga0207711_10124465 | 3300025941 | Bacteria | 2305 |
| 513 | Ga0207711_10242612 | 3300025941 | Bacteria | 1652 |
| 514 | Ga0207689_10005269 | 3300025942 | Bacteria | 11590 |
| 515 | Ga0207689_10035162 | 3300025942 | Plasmid | 4162 |
| 516 | Ga0207689_10084992 | 3300025942 | Bacteria | 2601 |
| 517 | Ga0207689_10105432 | 3300025942 | Unclassified | 2316 |
| 518 | Ga0207689_10549402 | 3300025942 | Bacteria | 970 |
| 519 | Ga0207661_10062543 | 3300025944 | Bacteria | 3012 |
| 520 | Ga0207661_10065614 | 3300025944 | Bacteria | 2947 |
| 521 | Ga0207661_10082900 | 3300025944 | Bacteria | 2652 |
| 522 | Ga0207661_10344541 | 3300025944 | Unclassified | 1343 |
| 523 | Ga0207679_10006327 | 3300025945 | Bacteria | 7479 |
| 524 | Ga0207679_10252834 | 3300025945 | Bacteria | 1499 |
| 525 | Ga0207667_10207784 | 3300025949 | Bacteria | 2007 |
| 526 | Ga0207667_10233112 | 3300025949 | Bacteria | 1885 |
| 527 | Ga0207667_10368845 | 3300025949 | Bacteria | 1463 |
| 528 | Ga0207667_10392228 | 3300025949 | Bacteria | 1414 |
| 529 | Ga0207667_10992843 | 3300025949 | Bacteria | 827 |
| 530 | Ga0207651_10014021 | 3300025960 | Bacteria | 4612 |
| 531 | Ga0207712_10000775 | 3300025961 | Bacteria | 23829 |
| 532 | Ga0207712_10002104 | 3300025961 | Bacteria | 13034 |
| 533 | Ga0207712_10015131 | 3300025961 | Bacteria | 4972 |
| 534 | Ga0207712_10062297 | 3300025961 | Bacteria | 2651 |
| 535 | Ga0207712_10239722 | 3300025961 | Bacteria | 1460 |
| 536 | Ga0207712_10294561 | 3300025961 | Unclassified | 1329 |
| 537 | Ga0207712_10305393 | 3300025961 | Bacteria | 1308 |
| 538 | Ga0207712_10625736 | 3300025961 | Bacteria | 933 |
| 539 | Ga0207668_10295135 | 3300025972 | Bacteria | 1335 |
| 540 | Ga0207640_10180218 | 3300025981 | Bacteria | 1583 |
| 541 | Ga0207640_10252595 | 3300025981 | Bacteria | 1369 |
| 542 | Ga0207640_10968394 | 3300025981 | Bacteria | 747 |
| 543 | Ga0207658_10078354 | 3300025986 | Bacteria | 2525 |
| 544 | Ga0207658_10646539 | 3300025986 | Bacteria | 953 |
| 545 | Ga0207658_11204486 | 3300025986 | Bacteria | 692 |
| 546 | Ga0207658_11469967 | 3300025986 | Unclassified | 623 |
| 547 | Ga0207677_10590463 | 3300026023 | Bacteria | 973 |
| 548 | Ga0207677_10843337 | 3300026023 | Bacteria | 823 |
| 549 | Ga0207677_11400862 | 3300026023 | Bacteria | 644 |
| 550 | Ga0207703_10052362 | 3300026035 | Bacteria | 3314 |
| 551 | Ga0207703_10151765 | 3300026035 | Unclassified | 2021 |
| 552 | Ga0207703_10419100 | 3300026035 | Bacteria | 1245 |
| 553 | Ga0207703_10442667 | 3300026035 | Bacteria | 1212 |
| 554 | Ga0207678_10013214 | 3300026067 | Bacteria | 7245 |
| 555 | Ga0207708_10023908 | 3300026075 | Bacteria | 4621 |
| 556 | Ga0207708_10162139 | 3300026075 | Bacteria | 1766 |
| 557 | Ga0207708_10186525 | 3300026075 | Bacteria | 1649 |
| 558 | Ga0207708_10348212 | 3300026075 | Bacteria | 1215 |
| 559 | Ga0207708_10441859 | 3300026075 | Bacteria | 1082 |
| 560 | Ga0207702_10072027 | 3300026078 | Bacteria | 2977 |
| 561 | Ga0207702_10289200 | 3300026078 | Bacteria | 1552 |
| 562 | Ga0207702_10309578 | 3300026078 | Bacteria | 1501 |
| 563 | Ga0207702_10741570 | 3300026078 | Unclassified | 969 |
| 564 | Ga0207702_11370257 | 3300026078 | Bacteria | 701 |
| 565 | Ga0207702_11451523 | 3300026078 | Unclassified | 680 |
| 566 | Ga0207641_10001235 | 3300026088 | Bacteria | 25590 |
| 567 | Ga0207641_10011819 | 3300026088 | Bacteria | 7163 |
| 568 | Ga0207641_10042331 | 3300026088 | Bacteria | 3820 |
| 569 | Ga0207641_10321971 | 3300026088 | Bacteria | 1466 |
| 570 | Ga0207648_10003314 | 3300026089 | Bacteria | 16910 |
| 571 | Ga0207648_10028708 | 3300026089 | Bacteria | 4932 |
| 572 | Ga0207648_10152251 | 3300026089 | Bacteria | 2041 |
| 573 | Ga0207648_11080109 | 3300026089 | Bacteria | 752 |
| 574 | Ga0207648_11166577 | 3300026089 | Unclassified | 723 |
| 575 | Ga0207676_10026480 | 3300026095 | Bacteria | 4314 |
| 576 | Ga0207676_10051603 | 3300026095 | Bacteria | 3211 |
| 577 | Ga0207676_10203391 | 3300026095 | Bacteria | 1751 |
| 578 | Ga0207676_10495504 | 3300026095 | Unclassified | 1159 |
| 579 | Ga0207676_11090265 | 3300026095 | Bacteria | 789 |
| 580 | Ga0207674_10001105 | 3300026116 | Bacteria | 35054 |
| 581 | Ga0207674_10005320 | 3300026116 | Bacteria | 15315 |
| 582 | Ga0207674_10093328 | 3300026116 | Bacteria | 2998 |
| 583 | Ga0207674_10499006 | 3300026116 | Bacteria | 1176 |
| 584 | Ga0207674_10804200 | 3300026116 | Bacteria | 907 |
| 585 | Ga0207674_11218331 | 3300026116 | Unclassified | 722 |
| 586 | Ga0207675_100009956 | 3300026118 | Bacteria | 8900 |
| 587 | Ga0207675_100042433 | 3300026118 | Bacteria | 4247 |
| 588 | Ga0207675_100141120 | 3300026118 | Bacteria | 2289 |
| 589 | Ga0207675_100261617 | 3300026118 | Unclassified | 1677 |
| 590 | Ga0207675_101125594 | 3300026118 | Bacteria | 805 |
| 591 | Ga0207683_10072473 | 3300026121 | Bacteria | 3046 |
| 592 | Ga0207683_10120221 | 3300026121 | Bacteria | 2357 |
| 593 | Ga0207683_10601172 | 3300026121 | Bacteria | 1018 |
| 594 | Ga0207698_10412916 | 3300026142 | Bacteria | 1293 |
| 595 | Ga0207698_10453003 | 3300026142 | Bacteria | 1239 |
| 596 | Ga0207698_11277820 | 3300026142 | Bacteria | 748 |
| 597 | Ga0209588_1025967 | 3300027671 | Bacteria | 1857 |
| 598 | Ga0207428_10000413 | 3300027907 | Bacteria | 53087 |
| 599 | Ga0207428_10046079 | 3300027907 | Bacteria | 3508 |
| 600 | Ga0207428_10432135 | 3300027907 | Bacteria | 961 |
| 601 | Ga0207428_10633861 | 3300027907 | Bacteria | 768 |
| 602 | Ga0268266_11174764 | 3300028379 | Unclassified | 742 |
| 603 | Ga0268266_11189189 | 3300028379 | Bacteria | 737 |
| 604 | Ga0268265_10043935 | 3300028380 | Bacteria | 3325 |
| 605 | Ga0268265_10070052 | 3300028380 | Bacteria | 2726 |
| 606 | Ga0268265_10125984 | 3300028380 | Bacteria | 2119 |
| 607 | Ga0268265_10428404 | 3300028380 | Unclassified | 1230 |
| 608 | Ga0268265_10700909 | 3300028380 | Bacteria | 978 |
| 609 | Ga0268265_10761037 | 3300028380 | Bacteria | 941 |
| 610 | Ga0268264_10025346 | 3300028381 | Bacteria | 4845 |
| 611 | Ga0268264_10281833 | 3300028381 | Bacteria | 1557 |
| 612 | Ga0268264_10742538 | 3300028381 | Bacteria | 977 |
| 613 | Ga0307405_11048789 | 3300031731 | Unclassified | 698 |
| 614 | Ga0307410_10101259 | 3300031852 | Bacteria | 2065 |
| 615 | Ga0307410_11558810 | 3300031852 | Unclassified | 583 |
| 616 | Ga0307407_10567255 | 3300031903 | Bacteria | 841 |
| 617 | Ga0307412_11635896 | 3300031911 | Unclassified | 589 |
| 618 | Ga0307409_100707007 | 3300031995 | Bacteria | 1008 |
| 619 | Ga0307416_100429599 | 3300032002 | Bacteria | 1368 |
| 620 | Ga0307416_101420413 | 3300032002 | Bacteria | 800 |
| 621 | Ga0307416_102338677 | 3300032002 | Unclassified | 634 |
| 622 | Ga0307411_10370259 | 3300032005 | Bacteria | 1175 |
| 623 | Ga0373928_0019043 | 3300035084 | Bacteria | 1429 |
| 624 | Ga0373934_0025992 | 3300035086 | Bacteria | 2270 |
| 625 | Ga0373939_0497241 | 3300035114 | Bacteria | 520 |
| 626 | Ga0373941_0305631 | 3300035115 | Bacteria | 636 |
| 627 | Ga0373945_0306214 | 3300035116 | Bacteria | 681 |
| 628 | Ga0373945_0543322 | 3300035116 | Unclassified | 521 |
| 629 | Ga0373953_0238492 | 3300035117 | Bacteria | 789 |
| 630 | Ga0373943_0230162 | 3300035170 | Unclassified | 1035 |
| 631 | Ga0373943_0245571 | 3300035170 | Bacteria | 1004 |
| 632 | Ga0373955_0073794 | 3300035172 | Bacteria | 1913 |
| 633 | Ga0316574_0087116 | 3300035398 | Bacteria | 1988 |
| 634 | Ga0316574_0139357 | 3300035398 | Bacteria | 1562 |
| 635 | Ga0373927_0033214 | 3300035695 | Bacteria | 3359 |
| 636 | Ga0373933_0155748 | 3300035724 | Unclassified | 1449 |
| 637 | Ga0373947_1062700 | 3300035725 | Unclassified | 552 |
| 638 | Ga0373947_1236113 | 3300035725 | Bacteria | 509 |
| 639 | Ga0373937_0106882 | 3300036401 | Bacteria | 2601 |
| 640 | Ga0373937_0561838 | 3300036401 | Bacteria | 1084 |
| 641 | Ga0316584_0732277 | 3300036712 | Bacteria | 676 |
| 642 | Ga0373925_0008740 | 3300037068 | Bacteria | 7378 |
| 643 | Ga0373925_0092136 | 3300037068 | Bacteria | 2318 |
| 644 | Ga0395905_0171347 | 3300037471 | Bacteria | 2039 |
| 645 | Ga0436365_0615410 | 3300039437 | Unclassified | 1030 |
| 646 | Ga0436365_1265377 | 3300039437 | Unclassified | 687 |
| 647 | Ga0439466_0224634 | 3300041411 | Unclassified | 570 |
| 648 | Ga0451802_1169347 | 3300041460 | Bacteria | 536 |
| 649 | Ga0451853_3447544 | 3300041512 | Bacteria | 915 |
| 650 | Ga0439433_0003604 | 3300041999 | Unclassified | 3329 |
| 651 | Ga0439441_014075 | 3300042001 | Bacteria | 1397 |
| 652 | Ga0439462_0146830 | 3300042015 | Unclassified | 662 |
| 653 | Ga0439434_0087992 | 3300042435 | Bacteria | 991 |
| 654 | Ga0439435_0187600 | 3300042436 | Unclassified | 677 |
| 655 | Ga0439444_0071870 | 3300042437 | Bacteria | 742 |
| 656 | Ga0439464_0180592 | 3300042439 | Bacteria | 668 |
| 657 | Ga0439464_0198468 | 3300042439 | Bacteria | 639 |
| 658 | Ga0439464_0255048 | 3300042439 | Bacteria | 567 |
| 659 | Ga0450918_046349 | 3300042531 | Bacteria | 787 |
| 660 | Ga0450918_125916 | 3300042531 | Bacteria | 515 |
| 661 | Ga0451577_0810891 | 3300042876 | Bacteria | 845 |
| 662 | Ga0453683_0247526 | 3300044673 | Bacteria | 1136 |
| 663 | Ga0453683_0622087 | 3300044673 | Bacteria | 705 |
| 664 | Ga0466963_0037445 | 3300044694 | Bacteria | 3168 |
| 665 | Ga0453684_0540312 | 3300044712 | Bacteria | 1285 |
| 666 | Ga0466957_0110110 | 3300044842 | Bacteria | 1746 |
| 667 | Ga0466957_0123233 | 3300044842 | Bacteria | 1654 |
| 668 | Ga0451576_0012058 | 3300045051 | Bacteria | 9756 |
| 669 | Ga0451576_0174738 | 3300045051 | Unclassified | 2242 |
| 670 | Ga0451576_0240415 | 3300045051 | Bacteria | 1891 |
| 671 | Ga0451576_0408910 | 3300045051 | Unclassified | 1423 |
| 672 | Ga0451576_0484599 | 3300045051 | Bacteria | 1299 |
| 673 | Ga0451576_0722391 | 3300045051 | Bacteria | 1046 |
| 674 | Ga0466967_0084859 | 3300045976 | Bacteria | 2866 |
| 675 | Ga0466967_1059398 | 3300045976 | Bacteria | 808 |
| 676 | Ga0495592_0098553 | 3300046454 | Bacteria | 2086 |
| 677 | Ga0495651_0006446 | 3300046462 | Bacteria | 8978 |
| 678 | Ga0495580_0025669 | 3300046472 | Bacteria | 4306 |
| 679 | Ga0495580_0269569 | 3300046472 | Bacteria | 1163 |
| 680 | Ga0495582_0170945 | 3300046473 | Bacteria | 1237 |
| 681 | Ga0495639_0717609 | 3300046475 | Bacteria | 517 |
| 682 | Ga0495664_0034160 | 3300046477 | Bacteria | 2991 |
| 683 | Ga0495594_0060961 | 3300046499 | Bacteria | 2087 |
| 684 | Ga0495594_0100588 | 3300046499 | Bacteria | 1626 |
| 685 | Ga0495628_0174963 | 3300046516 | Unclassified | 1626 |
| 686 | Ga0495630_0029235 | 3300046517 | Bacteria | 4096 |
| 687 | Ga0495666_0235260 | 3300046526 | Bacteria | 837 |
| 688 | Ga0495652_0018170 | 3300046529 | Bacteria | 6275 |
| 689 | Ga0495665_0680592 | 3300046531 | Bacteria | 511 |
| 690 | Ga0495586_0033992 | 3300046535 | Bacteria | 2737 |
| 691 | Ga0495587_0009958 | 3300046536 | Bacteria | 6068 |
| 692 | Ga0495621_0124207 | 3300046539 | Bacteria | 1000 |
| 693 | Ga0495621_0273706 | 3300046539 | Bacteria | 694 |
| 694 | Ga0495645_0003822 | 3300046543 | Bacteria | 10242 |
| 695 | Ga0495645_0157246 | 3300046543 | Bacteria | 1574 |
| 696 | Ga0495622_0058709 | 3300046557 | Unclassified | 1782 |
| 697 | Ga0495633_0135743 | 3300046558 | Bacteria | 1138 |
| 698 | Ga0495667_0038543 | 3300046559 | Bacteria | 3182 |
| 699 | Ga0495656_0272123 | 3300046615 | Bacteria | 861 |
| 700 | Ga0495634_0732350 | 3300046642 | Bacteria | 567 |
| 701 | Ga0495659_0365017 | 3300046664 | Bacteria | 619 |
| 702 | Ga0495659_0524672 | 3300046664 | Bacteria | 521 |
| 703 | Ga0495657_0335776 | 3300046675 | Bacteria | 896 |
| 704 | Ga0495599_0047894 | 3300046678 | Bacteria | 2679 |
| 705 | Ga0495623_0161334 | 3300046679 | Bacteria | 1317 |
| 706 | Ga0495647_0264227 | 3300046681 | Bacteria | 769 |
| 707 | Ga0495600_0006903 | 3300046809 | Bacteria | 6924 |
| 708 | Ga0495600_0102040 | 3300046809 | Bacteria | 1870 |
| 709 | Ga0495581_0282060 | 3300047315 | Bacteria | 971 |
| 710 | Ga0495604_0575763 | 3300047317 | Bacteria | 724 |
| 711 | Ga0495636_0540280 | 3300047318 | Unclassified | 566 |
| 712 | Ga0495672_0003461 | 3300047320 | Bacteria | 13501 |
| 713 | Ga0495684_0109941 | 3300047471 | Bacteria | 2081 |
| 714 | Ga0495602_0327073 | 3300048088 | Bacteria | 1113 |
| 715 | Ga0496100_1583314 | 3300048903 | Bacteria | 518 |
| 716 | Ga0496102_0576392 | 3300048905 | Bacteria | 1048 |
| 717 | Ga0496103_0619129 | 3300048906 | Bacteria | 689 |
| 718 | Ga0496104_0535311 | 3300048907 | Bacteria | 1082 |
| 719 | Ga0496106_0078456 | 3300048909 | Unclassified | 2534 |
| 720 | Ga0496108_0835643 | 3300048911 | Bacteria | 793 |
| 721 | Ga0496109_1981475 | 3300048912 | Bacteria | 514 |
| 722 | Ga0496114_0309549 | 3300048917 | Unclassified | 1395 |
| 723 | Ga0501032_0535554 | 3300049569 | Bacteria | 747 |
| 724 | Ga0501039_0018331 | 3300049575 | Bacteria | 5372 |
| 725 | Ga0501039_1187743 | 3300049575 | Bacteria | 590 |
| 726 | Ga0501040_0362592 | 3300049576 | Bacteria | 1039 |
| 727 | Ga0501040_1260270 | 3300049576 | Bacteria | 536 |
| 728 | Ga0501042_0067436 | 3300049578 | Unclassified | 2558 |
| 729 | Ga0501042_0362979 | 3300049578 | Unclassified | 1048 |
| 730 | Ga0501043_0020312 | 3300049579 | Bacteria | 5211 |
| 731 | Ga0501046_0684129 | 3300049580 | Unclassified | 724 |
| 732 | Ga0501047_1200178 | 3300049581 | Unclassified | 572 |
| 733 | Ga0501068_0848532 | 3300049584 | Bacteria | 600 |
| 734 | Ga0501071_0065019 | 3300049587 | Unclassified | 2648 |
| 735 | Ga0501071_0288847 | 3300049587 | Bacteria | 1242 |
| 736 | Ga0501072_0185991 | 3300049588 | Bacteria | 1657 |
| 737 | Ga0501074_0354091 | 3300049590 | Unclassified | 1042 |
| 738 | Ga0501074_0644776 | 3300049590 | Bacteria | 748 |
| 739 | Ga0501075_0947351 | 3300049591 | Bacteria | 654 |
| 740 | Ga0501075_1349242 | 3300049591 | Unclassified | 540 |
| 741 | Ga0501076_0174488 | 3300049592 | Unclassified | 1752 |
| 742 | Ga0501076_0354472 | 3300049592 | Unclassified | 1205 |
| 743 | Ga0501076_1290911 | 3300049592 | Unclassified | 600 |
| 744 | Ga0501198_061380 | 3300049649 | Bacteria | 691 |
| 745 | Ga0501235_227979 | 3300049669 | Unclassified | 514 |
| 746 | Ga0501258_040272 | 3300049687 | Bacteria | 622 |
| 747 | Ga0501079_0089327 | 3300049741 | Bacteria | 2386 |
| 748 | Ga0501079_0296192 | 3300049741 | Bacteria | 1265 |
| 749 | Ga0501081_0033223 | 3300049743 | Bacteria | 3504 |
| 750 | Ga0501081_0512572 | 3300049743 | Unclassified | 894 |
| 751 | Ga0501081_0879707 | 3300049743 | Bacteria | 675 |
| 752 | Ga0501081_1191888 | 3300049743 | Unclassified | 577 |
| 753 | Ga0501081_1223252 | 3300049743 | Unclassified | 569 |
| 754 | Ga0501263_050209 | 3300049760 | Bacteria | 633 |
| 755 | Ga0501264_026778 | 3300049761 | Unclassified | 643 |
| 756 | Ga0501035_0114716 | 3300049822 | Bacteria | 2359 |
| 757 | Ga0501044_0190159 | 3300049823 | Bacteria | 2016 |
| 758 | Ga0501045_0060520 | 3300049824 | Bacteria | 2776 |
| 759 | nmdc:mga05p37_1242900_c1 | 3300050507 | Unclassified | 765 |
| 760 | nmdc:mga05p37_209039_c1 | 3300050507 | Bacteria | 2360 |
| 761 | nmdc:mga05p37_358605_c1 | 3300050507 | Bacteria | 1715 |
| 762 | nmdc:mga05p37_869252_c1 | 3300050507 | Unclassified | 977 |
| 763 | nmdc:mga09592_297687_c1 | 3300050508 | Bacteria | 1399 |
| 764 | nmdc:mga09592_37831_c1 | 3300050508 | Bacteria | 4049 |
| 765 | nmdc:mga09592_66660_c1 | 3300050508 | Bacteria | 3052 |
| 766 | nmdc:mga0qj67_1118289_c1 | 3300050509 | Unclassified | 615 |
| 767 | nmdc:mga0qj67_181777_c1 | 3300050509 | Bacteria | 1708 |
| 768 | nmdc:mga0qj67_33516_c1 | 3300050509 | Bacteria | 4008 |
| 769 | nmdc:mga0qj67_400226_c1 | 3300050509 | Unclassified | 1108 |
| 770 | nmdc:mga0qj67_430558_c1 | 3300050509 | Bacteria | 1063 |
| 771 | nmdc:mga0qj67_55384_c1 | 3300050509 | Bacteria | 3142 |
| 772 | nmdc:mga06r32_198310_c1 | 3300050510 | Bacteria | 1995 |
| 773 | nmdc:mga06r32_273347_c1 | 3300050510 | Bacteria | 1677 |
| 774 | nmdc:mga06r32_396366_c1 | 3300050510 | Bacteria | 1363 |
| 775 | nmdc:mga06r32_77335_c1 | 3300050510 | Bacteria | 3232 |
| 776 | nmdc:mga06r32_98488_c1 | 3300050510 | Bacteria | 2866 |
| 777 | nmdc:mga08y16_170117_c1 | 3300050511 | Bacteria | 2263 |
| 778 | nmdc:mga08y16_180873_c1 | 3300050511 | Bacteria | 2190 |
| 779 | nmdc:mga08y16_189372_c1 | 3300050511 | Bacteria | 2134 |
| 780 | nmdc:mga08y16_346951_c1 | 3300050511 | Bacteria | 1525 |
| 781 | nmdc:mga08y16_734048_c1 | 3300050511 | Bacteria | 985 |
| 782 | nmdc:mga08y16_805632_c1 | 3300050511 | Bacteria | 932 |
| 783 | nmdc:mga08y16_8540_c1 | 3300050511 | Bacteria | 10729 |
| 784 | nmdc:mga0n895_126690_c1 | 3300050512 | Unclassified | 2577 |
| 785 | nmdc:mga0n895_1268511_c1 | 3300050512 | Bacteria | 709 |
| 786 | nmdc:mga0n895_139421_c1 | 3300050512 | Bacteria | 2453 |
| 787 | nmdc:mga0n895_18896_c1 | 3300050512 | Bacteria | 6391 |
| 788 | nmdc:mga0n895_2066763_c1 | 3300050512 | Bacteria | 527 |
| 789 | nmdc:mga0n895_26982_c1 | 3300050512 | Bacteria | 5449 |
| 790 | nmdc:mga0n895_323155_c1 | 3300050512 | Bacteria | 1564 |
| 791 | nmdc:mga0n895_3306_c1 | 3300050512 | Bacteria | 12944 |
| 792 | nmdc:mga0n895_429_c1 | 3300050512 | Bacteria | 28206 |
| 793 | nmdc:mga0n895_629469_c1 | 3300050512 | Bacteria | 1073 |
| 794 | nmdc:mga0n895_79585_c1 | 3300050512 | Bacteria | 3264 |
| 795 | nmdc:mga0rr50_564959_c1 | 3300050513 | Bacteria | 969 |
| 796 | nmdc:mga0rr50_82415_c1 | 3300050513 | Bacteria | 2484 |
| 797 | nmdc:mga0rr50_8697_c1 | 3300050513 | Bacteria | 6330 |
| 798 | nmdc:mga08x19_101042_c1 | 3300050514 | Unclassified | 1914 |
| 799 | nmdc:mga08x19_1182136_c1 | 3300050514 | Bacteria | 542 |
| 800 | nmdc:mga08x19_156502_c1 | 3300050514 | Bacteria | 1546 |
| 801 | nmdc:mga08x19_37004_c1 | 3300050514 | Bacteria | 3095 |
| 802 | nmdc:mga0a205_1684_c1 | 3300050515 | Bacteria | 19076 |
| 803 | nmdc:mga0a205_179418_c1 | 3300050515 | Bacteria | 2012 |
| 804 | nmdc:mga0a205_222029_c1 | 3300050515 | Bacteria | 1775 |
| 805 | nmdc:mga0a205_309780_c1 | 3300050515 | Bacteria | 1451 |
| 806 | nmdc:mga0a205_417275_c1 | 3300050515 | Bacteria | 1204 |
| 807 | nmdc:mga0a205_45241_c1 | 3300050515 | Unclassified | 4244 |
| 808 | nmdc:mga0a205_574036_c1 | 3300050515 | Bacteria | 982 |
| 809 | nmdc:mga0a205_5976_c1 | 3300050515 | Bacteria | 10970 |
| 810 | nmdc:mga0a205_5997_c1 | 3300050515 | Bacteria | 10955 |
| 811 | nmdc:mga0a205_700868_c1 | 3300050515 | Bacteria | 862 |
| 812 | nmdc:mga0a205_728372_c1 | 3300050515 | Unclassified | 841 |
| 813 | nmdc:mga0a205_8622_c1 | 3300050515 | Bacteria | 9277 |
| 814 | Ga0495619_0094686 | 3300053085 | Bacteria | 2026 |
| 815 | Ga0500596_069325 | 3300053735 | Unclassified | 600 |
| 816 | Ga0501084_0210398 | 3300054114 | Unclassified | 1641 |
| 817 | Ga0501084_1806343 | 3300054114 | Bacteria | 510 |
| 818 | Ga0501082_0247904 | 3300060353 | Unclassified | 1550 |
| 819 | Ga0501082_1283266 | 3300060353 | Unclassified | 640 |
| 820 | Ga0530510_0195283 | 3300061734 | Unclassified | 1503 |
| 821 | Ga0530510_0308051 | 3300061734 | Bacteria | 1186 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10410123 | Ga0157369_104101232 | 122 |
| 2 | 3300049743 | Ga0501081_0879707 | Ga0501081_0879707_223_639 | 122 |
| 3 | 3300007076 | Ga0075435_100938945 | Ga0075435_1009389451 | 130 |
| 4 | 3300050512 | nmdc:mga0n895_2066763_c1 | nmdc:mga0n895_2066763_c1_26_433 | 130 |
| 5 | 3300050515 | nmdc:mga0a205_574036_c1 | nmdc:mga0a205_574036_c1_161_568 | 130 |
| 6 | 3300006846 | Ga0075430_100125114 | Ga0075430_1001251142 | 131 |
| 7 | 3300042436 | Ga0439435_0187600 | Ga0439435_0187600_143_547 | 131 |
| 8 | 3300042439 | Ga0439464_0255048 | Ga0439464_0255048_103_507 | 131 |
| 9 | 3300050509 | nmdc:mga0qj67_181777_c1 | nmdc:mga0qj67_181777_c1_330_734 | 131 |
| 10 | 3300005290 | Ga0065712_10179213 | Ga0065712_101792131 | 132 |
| 11 | 3300005329 | Ga0070683_100022077 | Ga0070683_1000220776 | 132 |
| 12 | 3300005331 | Ga0070670_100139832 | Ga0070670_1001398322 | 132 |
| 13 | 3300005334 | Ga0068869_100642302 | Ga0068869_1006423022 | 132 |
| 14 | 3300005338 | Ga0068868_101520780 | Ga0068868_1015207801 | 132 |
| 15 | 3300005364 | Ga0070673_100029315 | Ga0070673_1000293152 | 132 |
| 16 | 3300005530 | Ga0070679_100000924 | Ga0070679_10000092420 | 132 |
| 17 | 3300005535 | Ga0070684_100282863 | Ga0070684_1002828632 | 132 |
| 18 | 3300005564 | Ga0070664_100135458 | Ga0070664_1001354582 | 132 |
| 19 | 3300006358 | Ga0068871_100163873 | Ga0068871_1001638732 | 132 |
| 20 | 3300006844 | Ga0075428_101426050 | Ga0075428_1014260502 | 132 |
| 21 | 3300009094 | Ga0111539_11766176 | Ga0111539_117661761 | 132 |
| 22 | 3300025912 | Ga0207707_10180764 | Ga0207707_101807641 | 132 |
| 23 | 3300025917 | Ga0207660_10068958 | Ga0207660_100689584 | 132 |
| 24 | 3300025921 | Ga0207652_10007095 | Ga0207652_100070958 | 132 |
| 25 | 3300025925 | Ga0207650_10140751 | Ga0207650_101407512 | 132 |
| 26 | 3300025936 | Ga0207670_10301509 | Ga0207670_103015092 | 132 |
| 27 | 3300025938 | Ga0207704_10363145 | Ga0207704_103631451 | 132 |
| 28 | 3300025942 | Ga0207689_10549402 | Ga0207689_105494022 | 132 |
| 29 | 3300025945 | Ga0207679_10252834 | Ga0207679_102528342 | 132 |
| 30 | 3300025986 | Ga0207658_10646539 | Ga0207658_106465392 | 132 |
| 31 | 3300026023 | Ga0207677_11400862 | Ga0207677_114008622 | 132 |
| 32 | 3300035116 | Ga0373945_0543322 | Ga0373945_0543322_47_445 | 132 |
| 33 | 3300035725 | Ga0373947_1062700 | Ga0373947_1062700_71_469 | 132 |
| 34 | 3300036401 | Ga0373937_0561838 | Ga0373937_0561838_478_876 | 132 |
| 35 | 3300049590 | Ga0501074_0354091 | Ga0501074_0354091_588_986 | 132 |
| 36 | 3300049592 | Ga0501076_0354472 | Ga0501076_0354472_232_630 | 132 |
| 37 | 3300050507 | nmdc:mga05p37_1242900_c1 | nmdc:mga05p37_1242900_c1_257_658 | 132 |
| 38 | 3300050512 | nmdc:mga0n895_26982_c1 | nmdc:mga0n895_26982_c1_682_1083 | 132 |
| 39 | 3300050515 | nmdc:mga0a205_1684_c1 | nmdc:mga0a205_1684_c1_4367_4768 | 132 |
| 40 | 3300050515 | nmdc:mga0a205_700868_c1 | nmdc:mga0a205_700868_c1_381_779 | 132 |
| 41 | 3300060353 | Ga0501082_0247904 | Ga0501082_0247904_367_765 | 132 |
| 42 | 3300005336 | Ga0070680_100005979 | Ga0070680_1000059794 | 133 |
| 43 | 3300005353 | Ga0070669_100195133 | Ga0070669_1001951332 | 133 |
| 44 | 3300005354 | Ga0070675_100562422 | Ga0070675_1005624222 | 133 |
| 45 | 3300005440 | Ga0070705_101943172 | Ga0070705_1019431721 | 133 |
| 46 | 3300005445 | Ga0070708_100002004 | Ga0070708_10000200414 | 133 |
| 47 | 3300005458 | Ga0070681_10268187 | Ga0070681_102681874 | 133 |
| 48 | 3300005468 | Ga0070707_100074613 | Ga0070707_1000746132 | 133 |
| 49 | 3300005518 | Ga0070699_101878236 | Ga0070699_1018782361 | 133 |
| 50 | 3300005530 | Ga0070679_100023377 | Ga0070679_1000233773 | 133 |
| 51 | 3300005535 | Ga0070684_100044553 | Ga0070684_1000445533 | 133 |
| 52 | 3300005543 | Ga0070672_100554576 | Ga0070672_1005545762 | 133 |
| 53 | 3300005563 | Ga0068855_100127202 | Ga0068855_1001272022 | 133 |
| 54 | 3300005563 | Ga0068855_101249569 | Ga0068855_1012495692 | 133 |
| 55 | 3300005577 | Ga0068857_100034089 | Ga0068857_1000340892 | 133 |
| 56 | 3300005577 | Ga0068857_100224213 | Ga0068857_1002242132 | 133 |
| 57 | 3300005578 | Ga0068854_100023851 | Ga0068854_1000238514 | 133 |
| 58 | 3300005616 | Ga0068852_100296547 | Ga0068852_1002965472 | 133 |
| 59 | 3300005616 | Ga0068852_100721904 | Ga0068852_1007219042 | 133 |
| 60 | 3300005618 | Ga0068864_100000808 | Ga0068864_10000080819 | 133 |
| 61 | 3300005840 | Ga0068870_10008802 | Ga0068870_100088025 | 133 |
| 62 | 3300006846 | Ga0075430_100268252 | Ga0075430_1002682521 | 133 |
| 63 | 3300006914 | Ga0075436_100017379 | Ga0075436_1000173795 | 133 |
| 64 | 3300007076 | Ga0075435_100496263 | Ga0075435_1004962632 | 133 |
| 65 | 3300009093 | Ga0105240_10397314 | Ga0105240_103973141 | 133 |
| 66 | 3300009093 | Ga0105240_11341500 | Ga0105240_113415001 | 133 |
| 67 | 3300009093 | Ga0105240_11516081 | Ga0105240_115160811 | 133 |
| 68 | 3300009093 | Ga0105240_11620829 | Ga0105240_116208292 | 133 |
| 69 | 3300009174 | Ga0105241_10341291 | Ga0105241_103412912 | 133 |
| 70 | 3300009174 | Ga0105241_11412751 | Ga0105241_114127511 | 133 |
| 71 | 3300009545 | Ga0105237_12164916 | Ga0105237_121649161 | 133 |
| 72 | 3300009545 | Ga0105237_12474661 | Ga0105237_124746611 | 133 |
| 73 | 3300009551 | Ga0105238_10370067 | Ga0105238_103700673 | 133 |
| 74 | 3300010375 | Ga0105239_11030392 | Ga0105239_110303922 | 133 |
| 75 | 3300011119 | Ga0105246_10009650 | Ga0105246_100096503 | 133 |
| 76 | 3300013100 | Ga0157373_10008139 | Ga0157373_100081398 | 133 |
| 77 | 3300013104 | Ga0157370_10082090 | Ga0157370_100820905 | 133 |
| 78 | 3300013104 | Ga0157370_10532707 | Ga0157370_105327071 | 133 |
| 79 | 3300013104 | Ga0157370_11162709 | Ga0157370_111627092 | 133 |
| 80 | 3300013105 | Ga0157369_10300046 | Ga0157369_103000462 | 133 |
| 81 | 3300013307 | Ga0157372_10471837 | Ga0157372_104718373 | 133 |
| 82 | 3300013308 | Ga0157375_10498405 | Ga0157375_104984052 | 133 |
| 83 | 3300020070 | Ga0206356_10206487 | Ga0206356_102064873 | 133 |
| 84 | 3300020082 | Ga0206353_10366391 | Ga0206353_103663912 | 133 |
| 85 | 3300021384 | Ga0213876_10254517 | Ga0213876_102545172 | 133 |
| 86 | 3300025908 | Ga0207643_10008047 | Ga0207643_100080476 | 133 |
| 87 | 3300025910 | Ga0207684_10031113 | Ga0207684_100311133 | 133 |
| 88 | 3300025911 | Ga0207654_10025951 | Ga0207654_100259512 | 133 |
| 89 | 3300025912 | Ga0207707_10270175 | Ga0207707_102701751 | 133 |
| 90 | 3300025912 | Ga0207707_10725595 | Ga0207707_107255951 | 133 |
| 91 | 3300025913 | Ga0207695_10043911 | Ga0207695_100439112 | 133 |
| 92 | 3300025913 | Ga0207695_10056696 | Ga0207695_100566963 | 133 |
| 93 | 3300025913 | Ga0207695_10351933 | Ga0207695_103519331 | 133 |
| 94 | 3300025914 | Ga0207671_10682758 | Ga0207671_106827582 | 133 |
| 95 | 3300025919 | Ga0207657_10118678 | Ga0207657_101186782 | 133 |
| 96 | 3300025920 | Ga0207649_10111178 | Ga0207649_101111782 | 133 |
| 97 | 3300025922 | Ga0207646_10097986 | Ga0207646_100979863 | 133 |
| 98 | 3300025924 | Ga0207694_10432399 | Ga0207694_104323991 | 133 |
| 99 | 3300025925 | Ga0207650_10350029 | Ga0207650_103500292 | 133 |
| 100 | 3300025926 | Ga0207659_10635235 | Ga0207659_106352352 | 133 |
| 101 | 3300025949 | Ga0207667_10992843 | Ga0207667_109928432 | 133 |
| 102 | 3300025981 | Ga0207640_10252595 | Ga0207640_102525951 | 133 |
| 103 | 3300026095 | Ga0207676_10051603 | Ga0207676_100516032 | 133 |
| 104 | 3300026116 | Ga0207674_10005320 | Ga0207674_100053202 | 133 |
| 105 | 3300026116 | Ga0207674_10499006 | Ga0207674_104990062 | 133 |
| 106 | 3300026142 | Ga0207698_10412916 | Ga0207698_104129162 | 133 |
| 107 | 3300031911 | Ga0307412_11635896 | Ga0307412_116358961 | 133 |
| 108 | 3300039437 | Ga0436365_0615410 | Ga0436365_0615410_288_689 | 133 |
| 109 | 3300044694 | Ga0466963_0037445 | Ga0466963_0037445_2218_2622 | 133 |
| 110 | 3300044842 | Ga0466957_0110110 | Ga0466957_0110110_1079_1525 | 133 |
| 111 | 3300044842 | Ga0466957_0123233 | Ga0466957_0123233_826_1230 | 133 |
| 112 | 3300045976 | Ga0466967_1059398 | Ga0466967_1059398_301_711 | 133 |
| 113 | 3300046472 | Ga0495580_0269569 | Ga0495580_0269569_99_512 | 133 |
| 114 | 3300050513 | nmdc:mga0rr50_564959_c1 | nmdc:mga0rr50_564959_c1_86_487 | 133 |
| 115 | 3300050514 | nmdc:mga08x19_37004_c1 | nmdc:mga08x19_37004_c1_310_711 | 133 |
| 116 | 2162886007 | SwRhRL2b_contig_3090340 | SwRhRL2b_0837.00003090 | 134 |
| 117 | 2162886011 | MRS1b_contig_7347823 | MRS1b_0915.00001840 | 134 |
| 118 | 3300001977 | JGI24746J21847_1005903 | JGI24746J21847_10059032 | 134 |
| 119 | 3300001977 | JGI24746J21847_1018795 | JGI24746J21847_10187952 | 134 |
| 120 | 3300002244 | JGI24742J22300_10037705 | JGI24742J22300_100377051 | 134 |
| 121 | 3300005289 | Ga0065704_10107681 | Ga0065704_101076812 | 134 |
| 122 | 3300005289 | Ga0065704_10475771 | Ga0065704_104757711 | 134 |
| 123 | 3300005290 | Ga0065712_10309829 | Ga0065712_103098292 | 134 |
| 124 | 3300005293 | Ga0065715_10017516 | Ga0065715_100175162 | 134 |
| 125 | 3300005293 | Ga0065715_10934425 | Ga0065715_109344251 | 134 |
| 126 | 3300005295 | Ga0065707_10085184 | Ga0065707_100851842 | 134 |
| 127 | 3300005295 | Ga0065707_10280353 | Ga0065707_102803531 | 134 |
| 128 | 3300005295 | Ga0065707_10290541 | Ga0065707_102905411 | 134 |
| 129 | 3300005295 | Ga0065707_10953746 | Ga0065707_109537461 | 134 |
| 130 | 3300005327 | Ga0070658_10816169 | Ga0070658_108161691 | 134 |
| 131 | 3300005328 | Ga0070676_10016381 | Ga0070676_100163813 | 134 |
| 132 | 3300005328 | Ga0070676_10044388 | Ga0070676_100443881 | 134 |
| 133 | 3300005328 | Ga0070676_11056818 | Ga0070676_110568181 | 134 |
| 134 | 3300005329 | Ga0070683_100025311 | Ga0070683_1000253113 | 134 |
| 135 | 3300005329 | Ga0070683_100111540 | Ga0070683_1001115402 | 134 |
| 136 | 3300005330 | Ga0070690_100023916 | Ga0070690_1000239163 | 134 |
| 137 | 3300005330 | Ga0070690_100546691 | Ga0070690_1005466912 | 134 |
| 138 | 3300005331 | Ga0070670_100251587 | Ga0070670_1002515872 | 134 |
| 139 | 3300005331 | Ga0070670_100718420 | Ga0070670_1007184202 | 134 |
| 140 | 3300005333 | Ga0070677_10005078 | Ga0070677_100050784 | 134 |
| 141 | 3300005334 | Ga0068869_100050215 | Ga0068869_1000502152 | 134 |
| 142 | 3300005334 | Ga0068869_100198356 | Ga0068869_1001983563 | 134 |
| 143 | 3300005335 | Ga0070666_10100761 | Ga0070666_101007613 | 134 |
| 144 | 3300005335 | Ga0070666_10191581 | Ga0070666_101915812 | 134 |
| 145 | 3300005336 | Ga0070680_100100134 | Ga0070680_1001001344 | 134 |
| 146 | 3300005336 | Ga0070680_100101289 | Ga0070680_1001012892 | 134 |
| 147 | 3300005337 | Ga0070682_100099187 | Ga0070682_1000991872 | 134 |
| 148 | 3300005338 | Ga0068868_100034062 | Ga0068868_1000340624 | 134 |
| 149 | 3300005338 | Ga0068868_100324062 | Ga0068868_1003240622 | 134 |
| 150 | 3300005339 | Ga0070660_100096997 | Ga0070660_1000969973 | 134 |
| 151 | 3300005340 | Ga0070689_100072634 | Ga0070689_1000726343 | 134 |
| 152 | 3300005340 | Ga0070689_100781988 | Ga0070689_1007819882 | 134 |
| 153 | 3300005341 | Ga0070691_10014882 | Ga0070691_100148822 | 134 |
| 154 | 3300005341 | Ga0070691_10066612 | Ga0070691_100666123 | 134 |
| 155 | 3300005341 | Ga0070691_10234061 | Ga0070691_102340612 | 134 |
| 156 | 3300005343 | Ga0070687_100008622 | Ga0070687_1000086222 | 134 |
| 157 | 3300005344 | Ga0070661_100007509 | Ga0070661_1000075093 | 134 |
| 158 | 3300005344 | Ga0070661_100026282 | Ga0070661_1000262823 | 134 |
| 159 | 3300005344 | Ga0070661_100431631 | Ga0070661_1004316312 | 134 |
| 160 | 3300005344 | Ga0070661_100941603 | Ga0070661_1009416032 | 134 |
| 161 | 3300005347 | Ga0070668_100106234 | Ga0070668_1001062342 | 134 |
| 162 | 3300005347 | Ga0070668_100107386 | Ga0070668_1001073862 | 134 |
| 163 | 3300005347 | Ga0070668_101042892 | Ga0070668_1010428922 | 134 |
| 164 | 3300005353 | Ga0070669_100017310 | Ga0070669_1000173101 | 134 |
| 165 | 3300005353 | Ga0070669_100058948 | Ga0070669_1000589481 | 134 |
| 166 | 3300005353 | Ga0070669_100309091 | Ga0070669_1003090911 | 134 |
| 167 | 3300005353 | Ga0070669_100969604 | Ga0070669_1009696042 | 134 |
| 168 | 3300005353 | Ga0070669_101491412 | Ga0070669_1014914121 | 134 |
| 169 | 3300005354 | Ga0070675_100869661 | Ga0070675_1008696611 | 134 |
| 170 | 3300005354 | Ga0070675_101275816 | Ga0070675_1012758162 | 134 |
| 171 | 3300005355 | Ga0070671_100207954 | Ga0070671_1002079541 | 134 |
| 172 | 3300005356 | Ga0070674_100004735 | Ga0070674_1000047356 | 134 |
| 173 | 3300005356 | Ga0070674_100006894 | Ga0070674_1000068947 | 134 |
| 174 | 3300005356 | Ga0070674_100588467 | Ga0070674_1005884672 | 134 |
| 175 | 3300005364 | Ga0070673_100100980 | Ga0070673_1001009803 | 134 |
| 176 | 3300005365 | Ga0070688_100000962 | Ga0070688_10000096216 | 134 |
| 177 | 3300005365 | Ga0070688_100056301 | Ga0070688_1000563012 | 134 |
| 178 | 3300005365 | Ga0070688_101035351 | Ga0070688_1010353511 | 134 |
| 179 | 3300005365 | Ga0070688_101240837 | Ga0070688_1012408372 | 134 |
| 180 | 3300005366 | Ga0070659_100009099 | Ga0070659_1000090995 | 134 |
| 181 | 3300005366 | Ga0070659_100345311 | Ga0070659_1003453111 | 134 |
| 182 | 3300005367 | Ga0070667_100031981 | Ga0070667_1000319812 | 134 |
| 183 | 3300005367 | Ga0070667_101177264 | Ga0070667_1011772641 | 134 |
| 184 | 3300005406 | Ga0070703_10058468 | Ga0070703_100584682 | 134 |
| 185 | 3300005406 | Ga0070703_10168449 | Ga0070703_101684491 | 134 |
| 186 | 3300005434 | Ga0070709_10001469 | Ga0070709_1000146914 | 134 |
| 187 | 3300005434 | Ga0070709_10387287 | Ga0070709_103872872 | 134 |
| 188 | 3300005435 | Ga0070714_100018344 | Ga0070714_1000183443 | 134 |
| 189 | 3300005435 | Ga0070714_100223076 | Ga0070714_1002230762 | 134 |
| 190 | 3300005436 | Ga0070713_100001501 | Ga0070713_1000015012 | 134 |
| 191 | 3300005436 | Ga0070713_100501893 | Ga0070713_1005018932 | 134 |
| 192 | 3300005438 | Ga0070701_10049952 | Ga0070701_100499522 | 134 |
| 193 | 3300005439 | Ga0070711_100000395 | Ga0070711_10000039523 | 134 |
| 194 | 3300005439 | Ga0070711_100624640 | Ga0070711_1006246402 | 134 |
| 195 | 3300005440 | Ga0070705_100007996 | Ga0070705_1000079969 | 134 |
| 196 | 3300005440 | Ga0070705_100063806 | Ga0070705_1000638063 | 134 |
| 197 | 3300005440 | Ga0070705_100333440 | Ga0070705_1003334402 | 134 |
| 198 | 3300005440 | Ga0070705_100701326 | Ga0070705_1007013262 | 134 |
| 199 | 3300005441 | Ga0070700_100558259 | Ga0070700_1005582592 | 134 |
| 200 | 3300005444 | Ga0070694_100004758 | Ga0070694_1000047587 | 134 |
| 201 | 3300005444 | Ga0070694_100181736 | Ga0070694_1001817362 | 134 |
| 202 | 3300005444 | Ga0070694_100260372 | Ga0070694_1002603723 | 134 |
| 203 | 3300005444 | Ga0070694_100336162 | Ga0070694_1003361622 | 134 |
| 204 | 3300005445 | Ga0070708_100970972 | Ga0070708_1009709721 | 134 |
| 205 | 3300005445 | Ga0070708_100977370 | Ga0070708_1009773702 | 134 |
| 206 | 3300005445 | Ga0070708_101411936 | Ga0070708_1014119362 | 134 |
| 207 | 3300005445 | Ga0070708_101544986 | Ga0070708_1015449861 | 134 |
| 208 | 3300005456 | Ga0070678_100008983 | Ga0070678_1000089832 | 134 |
| 209 | 3300005456 | Ga0070678_100242567 | Ga0070678_1002425671 | 134 |
| 210 | 3300005456 | Ga0070678_100886985 | Ga0070678_1008869852 | 134 |
| 211 | 3300005456 | Ga0070678_101285479 | Ga0070678_1012854792 | 134 |
| 212 | 3300005457 | Ga0070662_100004071 | Ga0070662_10000407110 | 134 |
| 213 | 3300005457 | Ga0070662_101510244 | Ga0070662_1015102442 | 134 |
| 214 | 3300005458 | Ga0070681_10000857 | Ga0070681_100008575 | 134 |
| 215 | 3300005458 | Ga0070681_10002670 | Ga0070681_100026701 | 134 |
| 216 | 3300005458 | Ga0070681_10659412 | Ga0070681_106594121 | 134 |
| 217 | 3300005459 | Ga0068867_100018446 | Ga0068867_1000184465 | 134 |
| 218 | 3300005459 | Ga0068867_100271215 | Ga0068867_1002712151 | 134 |
| 219 | 3300005459 | Ga0068867_100772484 | Ga0068867_1007724842 | 134 |
| 220 | 3300005466 | Ga0070685_10396735 | Ga0070685_103967352 | 134 |
| 221 | 3300005468 | Ga0070707_100052251 | Ga0070707_1000522512 | 134 |
| 222 | 3300005468 | Ga0070707_102014512 | Ga0070707_1020145121 | 134 |
| 223 | 3300005471 | Ga0070698_100119735 | Ga0070698_1001197354 | 134 |
| 224 | 3300005471 | Ga0070698_100190385 | Ga0070698_1001903852 | 134 |
| 225 | 3300005471 | Ga0070698_100235724 | Ga0070698_1002357244 | 134 |
| 226 | 3300005471 | Ga0070698_100399011 | Ga0070698_1003990112 | 134 |
| 227 | 3300005471 | Ga0070698_101181702 | Ga0070698_1011817022 | 134 |
| 228 | 3300005471 | Ga0070698_101327485 | Ga0070698_1013274851 | 134 |
| 229 | 3300005518 | Ga0070699_100113259 | Ga0070699_1001132592 | 134 |
| 230 | 3300005530 | Ga0070679_100007124 | Ga0070679_10000712413 | 134 |
| 231 | 3300005530 | Ga0070679_100010037 | Ga0070679_1000100379 | 134 |
| 232 | 3300005535 | Ga0070684_100005166 | Ga0070684_1000051666 | 134 |
| 233 | 3300005535 | Ga0070684_100005387 | Ga0070684_1000053877 | 134 |
| 234 | 3300005535 | Ga0070684_100095964 | Ga0070684_1000959643 | 134 |
| 235 | 3300005536 | Ga0070697_100135178 | Ga0070697_1001351783 | 134 |
| 236 | 3300005536 | Ga0070697_100387765 | Ga0070697_1003877652 | 134 |
| 237 | 3300005539 | Ga0068853_100244178 | Ga0068853_1002441783 | 134 |
| 238 | 3300005543 | Ga0070672_100039084 | Ga0070672_1000390843 | 134 |
| 239 | 3300005543 | Ga0070672_101966103 | Ga0070672_1019661031 | 134 |
| 240 | 3300005545 | Ga0070695_100009930 | Ga0070695_1000099305 | 134 |
| 241 | 3300005545 | Ga0070695_100016981 | Ga0070695_1000169813 | 134 |
| 242 | 3300005545 | Ga0070695_100091297 | Ga0070695_1000912972 | 134 |
| 243 | 3300005546 | Ga0070696_100041120 | Ga0070696_1000411204 | 134 |
| 244 | 3300005546 | Ga0070696_100096187 | Ga0070696_1000961872 | 134 |
| 245 | 3300005547 | Ga0070693_100041763 | Ga0070693_1000417631 | 134 |
| 246 | 3300005548 | Ga0070665_100474274 | Ga0070665_1004742742 | 134 |
| 247 | 3300005548 | Ga0070665_101085792 | Ga0070665_1010857922 | 134 |
| 248 | 3300005549 | Ga0070704_100110008 | Ga0070704_1001100082 | 134 |
| 249 | 3300005549 | Ga0070704_101761225 | Ga0070704_1017612251 | 134 |
| 250 | 3300005549 | Ga0070704_101956123 | Ga0070704_1019561231 | 134 |
| 251 | 3300005563 | Ga0068855_100089330 | Ga0068855_1000893302 | 134 |
| 252 | 3300005563 | Ga0068855_100339396 | Ga0068855_1003393962 | 134 |
| 253 | 3300005563 | Ga0068855_100485257 | Ga0068855_1004852573 | 134 |
| 254 | 3300005563 | Ga0068855_100788143 | Ga0068855_1007881432 | 134 |
| 255 | 3300005564 | Ga0070664_100023271 | Ga0070664_1000232715 | 134 |
| 256 | 3300005577 | Ga0068857_100010501 | Ga0068857_1000105012 | 134 |
| 257 | 3300005577 | Ga0068857_100461313 | Ga0068857_1004613132 | 134 |
| 258 | 3300005578 | Ga0068854_100070969 | Ga0068854_1000709692 | 134 |
| 259 | 3300005614 | Ga0068856_100171932 | Ga0068856_1001719322 | 134 |
| 260 | 3300005614 | Ga0068856_100221555 | Ga0068856_1002215552 | 134 |
| 261 | 3300005614 | Ga0068856_100383410 | Ga0068856_1003834101 | 134 |
| 262 | 3300005614 | Ga0068856_100384463 | Ga0068856_1003844633 | 134 |
| 263 | 3300005614 | Ga0068856_100395308 | Ga0068856_1003953082 | 134 |
| 264 | 3300005614 | Ga0068856_100668769 | Ga0068856_1006687692 | 134 |
| 265 | 3300005615 | Ga0070702_100065981 | Ga0070702_1000659813 | 134 |
| 266 | 3300005615 | Ga0070702_101572413 | Ga0070702_1015724131 | 134 |
| 267 | 3300005616 | Ga0068852_100202518 | Ga0068852_1002025183 | 134 |
| 268 | 3300005616 | Ga0068852_102535176 | Ga0068852_1025351761 | 134 |
| 269 | 3300005617 | Ga0068859_100063067 | Ga0068859_1000630673 | 134 |
| 270 | 3300005617 | Ga0068859_100102931 | Ga0068859_1001029314 | 134 |
| 271 | 3300005617 | Ga0068859_100335684 | Ga0068859_1003356842 | 134 |
| 272 | 3300005617 | Ga0068859_100339909 | Ga0068859_1003399092 | 134 |
| 273 | 3300005617 | Ga0068859_100437093 | Ga0068859_1004370933 | 134 |
| 274 | 3300005617 | Ga0068859_100637673 | Ga0068859_1006376732 | 134 |
| 275 | 3300005617 | Ga0068859_101324515 | Ga0068859_1013245151 | 134 |
| 276 | 3300005618 | Ga0068864_100055483 | Ga0068864_1000554835 | 134 |
| 277 | 3300005618 | Ga0068864_100654107 | Ga0068864_1006541072 | 134 |
| 278 | 3300005718 | Ga0068866_10000622 | Ga0068866_100006227 | 134 |
| 279 | 3300005719 | Ga0068861_100088044 | Ga0068861_1000880446 | 134 |
| 280 | 3300005719 | Ga0068861_101480848 | Ga0068861_1014808482 | 134 |
| 281 | 3300005834 | Ga0068851_10039531 | Ga0068851_100395314 | 134 |
| 282 | 3300005840 | Ga0068870_10006745 | Ga0068870_100067452 | 134 |
| 283 | 3300005840 | Ga0068870_10040468 | Ga0068870_100404683 | 134 |
| 284 | 3300005840 | Ga0068870_10242642 | Ga0068870_102426423 | 134 |
| 285 | 3300005841 | Ga0068863_100824988 | Ga0068863_1008249882 | 134 |
| 286 | 3300005841 | Ga0068863_100991921 | Ga0068863_1009919211 | 134 |
| 287 | 3300005842 | Ga0068858_100005538 | Ga0068858_1000055383 | 134 |
| 288 | 3300005842 | Ga0068858_100028383 | Ga0068858_1000283835 | 134 |
| 289 | 3300005842 | Ga0068858_100161843 | Ga0068858_1001618432 | 134 |
| 290 | 3300005842 | Ga0068858_100437128 | Ga0068858_1004371282 | 134 |
| 291 | 3300005843 | Ga0068860_100047100 | Ga0068860_1000471003 | 134 |
| 292 | 3300005843 | Ga0068860_100048103 | Ga0068860_1000481032 | 134 |
| 293 | 3300005843 | Ga0068860_100723234 | Ga0068860_1007232342 | 134 |
| 294 | 3300005843 | Ga0068860_102424643 | Ga0068860_1024246431 | 134 |
| 295 | 3300005844 | Ga0068862_100081503 | Ga0068862_1000815032 | 134 |
| 296 | 3300005844 | Ga0068862_100154147 | Ga0068862_1001541473 | 134 |
| 297 | 3300005844 | Ga0068862_100159333 | Ga0068862_1001593331 | 134 |
| 298 | 3300005844 | Ga0068862_100216817 | Ga0068862_1002168172 | 134 |
| 299 | 3300005844 | Ga0068862_100746415 | Ga0068862_1007464152 | 134 |
| 300 | 3300005844 | Ga0068862_101218614 | Ga0068862_1012186141 | 134 |
| 301 | 3300005844 | Ga0068862_102160210 | Ga0068862_1021602101 | 134 |
| 302 | 3300006028 | Ga0070717_10009515 | Ga0070717_100095152 | 134 |
| 303 | 3300006163 | Ga0070715_10202067 | Ga0070715_102020672 | 134 |
| 304 | 3300006237 | Ga0097621_100083684 | Ga0097621_1000836842 | 134 |
| 305 | 3300006237 | Ga0097621_100151740 | Ga0097621_1001517402 | 134 |
| 306 | 3300006237 | Ga0097621_100168103 | Ga0097621_1001681032 | 134 |
| 307 | 3300006358 | Ga0068871_100164587 | Ga0068871_1001645872 | 134 |
| 308 | 3300006358 | Ga0068871_102145162 | Ga0068871_1021451621 | 134 |
| 309 | 3300006844 | Ga0075428_100008283 | Ga0075428_1000082837 | 134 |
| 310 | 3300006844 | Ga0075428_100026824 | Ga0075428_1000268244 | 134 |
| 311 | 3300006844 | Ga0075428_100410673 | Ga0075428_1004106732 | 134 |
| 312 | 3300006846 | Ga0075430_100004611 | Ga0075430_1000046118 | 134 |
| 313 | 3300006846 | Ga0075430_100017467 | Ga0075430_1000174674 | 134 |
| 314 | 3300006847 | Ga0075431_100016666 | Ga0075431_1000166668 | 134 |
| 315 | 3300006847 | Ga0075431_100201898 | Ga0075431_1002018982 | 134 |
| 316 | 3300006852 | Ga0075433_10004730 | Ga0075433_100047303 | 134 |
| 317 | 3300006852 | Ga0075433_10006512 | Ga0075433_100065122 | 134 |
| 318 | 3300006852 | Ga0075433_10119365 | Ga0075433_101193653 | 134 |
| 319 | 3300006852 | Ga0075433_10120871 | Ga0075433_101208712 | 134 |
| 320 | 3300006852 | Ga0075433_10129820 | Ga0075433_101298202 | 134 |
| 321 | 3300006852 | Ga0075433_10157465 | Ga0075433_101574652 | 134 |
| 322 | 3300006852 | Ga0075433_10180798 | Ga0075433_101807982 | 134 |
| 323 | 3300006852 | Ga0075433_10874776 | Ga0075433_108747762 | 134 |
| 324 | 3300006871 | Ga0075434_100003938 | Ga0075434_1000039387 | 134 |
| 325 | 3300006871 | Ga0075434_100015773 | Ga0075434_1000157733 | 134 |
| 326 | 3300006871 | Ga0075434_100041599 | Ga0075434_1000415996 | 134 |
| 327 | 3300006871 | Ga0075434_100054083 | Ga0075434_1000540833 | 134 |
| 328 | 3300006871 | Ga0075434_100484624 | Ga0075434_1004846242 | 134 |
| 329 | 3300006871 | Ga0075434_100585423 | Ga0075434_1005854232 | 134 |
| 330 | 3300006871 | Ga0075434_100701851 | Ga0075434_1007018512 | 134 |
| 331 | 3300006871 | Ga0075434_100745445 | Ga0075434_1007454452 | 134 |
| 332 | 3300006871 | Ga0075434_101313221 | Ga0075434_1013132211 | 134 |
| 333 | 3300006871 | Ga0075434_101320581 | Ga0075434_1013205812 | 134 |
| 334 | 3300006871 | Ga0075434_102333447 | Ga0075434_1023334471 | 134 |
| 335 | 3300006880 | Ga0075429_100038955 | Ga0075429_1000389554 | 134 |
| 336 | 3300006880 | Ga0075429_100112926 | Ga0075429_1001129262 | 134 |
| 337 | 3300006880 | Ga0075429_100115857 | Ga0075429_1001158573 | 134 |
| 338 | 3300006881 | Ga0068865_100004039 | Ga0068865_1000040398 | 134 |
| 339 | 3300006881 | Ga0068865_100991361 | Ga0068865_1009913612 | 134 |
| 340 | 3300006914 | Ga0075436_100068509 | Ga0075436_1000685093 | 134 |
| 341 | 3300006914 | Ga0075436_100259917 | Ga0075436_1002599172 | 134 |
| 342 | 3300006931 | Ga0097620_100063070 | Ga0097620_1000630703 | 134 |
| 343 | 3300006931 | Ga0097620_100102946 | Ga0097620_1001029464 | 134 |
| 344 | 3300006931 | Ga0097620_100335697 | Ga0097620_1003356972 | 134 |
| 345 | 3300006931 | Ga0097620_100339929 | Ga0097620_1003399292 | 134 |
| 346 | 3300006931 | Ga0097620_100437121 | Ga0097620_1004371213 | 134 |
| 347 | 3300006931 | Ga0097620_100637628 | Ga0097620_1006376282 | 134 |
| 348 | 3300006931 | Ga0097620_101324480 | Ga0097620_1013244801 | 134 |
| 349 | 3300007076 | Ga0075435_100114545 | Ga0075435_1001145454 | 134 |
| 350 | 3300007076 | Ga0075435_101005875 | Ga0075435_1010058752 | 134 |
| 351 | 3300007265 | Ga0099794_10111313 | Ga0099794_101113132 | 134 |
| 352 | 3300009093 | Ga0105240_10046309 | Ga0105240_100463092 | 134 |
| 353 | 3300009093 | Ga0105240_10059528 | Ga0105240_100595282 | 134 |
| 354 | 3300009093 | Ga0105240_10191668 | Ga0105240_101916683 | 134 |
| 355 | 3300009093 | Ga0105240_10208317 | Ga0105240_102083172 | 134 |
| 356 | 3300009094 | Ga0111539_10000538 | Ga0111539_1000053840 | 134 |
| 357 | 3300009094 | Ga0111539_10179483 | Ga0111539_101794831 | 134 |
| 358 | 3300009098 | Ga0105245_10229926 | Ga0105245_102299262 | 134 |
| 359 | 3300009098 | Ga0105245_11116699 | Ga0105245_111166992 | 134 |
| 360 | 3300009098 | Ga0105245_11764017 | Ga0105245_117640172 | 134 |
| 361 | 3300009101 | Ga0105247_10029435 | Ga0105247_100294354 | 134 |
| 362 | 3300009101 | Ga0105247_10342378 | Ga0105247_103423782 | 134 |
| 363 | 3300009147 | Ga0114129_10044723 | Ga0114129_100447234 | 134 |
| 364 | 3300009147 | Ga0114129_10241115 | Ga0114129_102411152 | 134 |
| 365 | 3300009147 | Ga0114129_10311196 | Ga0114129_103111962 | 134 |
| 366 | 3300009147 | Ga0114129_10663598 | Ga0114129_106635981 | 134 |
| 367 | 3300009147 | Ga0114129_12262037 | Ga0114129_122620371 | 134 |
| 368 | 3300009148 | Ga0105243_10146569 | Ga0105243_101465692 | 134 |
| 369 | 3300009148 | Ga0105243_10211014 | Ga0105243_102110142 | 134 |
| 370 | 3300009148 | Ga0105243_10538199 | Ga0105243_105381991 | 134 |
| 371 | 3300009174 | Ga0105241_10015144 | Ga0105241_1001514410 | 134 |
| 372 | 3300009176 | Ga0105242_10271682 | Ga0105242_102716822 | 134 |
| 373 | 3300009176 | Ga0105242_11566824 | Ga0105242_115668241 | 134 |
| 374 | 3300009176 | Ga0105242_13237381 | Ga0105242_132373811 | 134 |
| 375 | 3300009177 | Ga0105248_10015782 | Ga0105248_100157828 | 134 |
| 376 | 3300009177 | Ga0105248_10048596 | Ga0105248_100485962 | 134 |
| 377 | 3300009177 | Ga0105248_10358334 | Ga0105248_103583342 | 134 |
| 378 | 3300009177 | Ga0105248_10596299 | Ga0105248_105962992 | 134 |
| 379 | 3300009177 | Ga0105248_12247339 | Ga0105248_122473391 | 134 |
| 380 | 3300009545 | Ga0105237_10453565 | Ga0105237_104535652 | 134 |
| 381 | 3300009545 | Ga0105237_11348473 | Ga0105237_113484732 | 134 |
| 382 | 3300009545 | Ga0105237_11568470 | Ga0105237_115684701 | 134 |
| 383 | 3300009551 | Ga0105238_10150008 | Ga0105238_101500082 | 134 |
| 384 | 3300009551 | Ga0105238_11922225 | Ga0105238_119222252 | 134 |
| 385 | 3300009553 | Ga0105249_10086258 | Ga0105249_100862583 | 134 |
| 386 | 3300009553 | Ga0105249_10117150 | Ga0105249_101171502 | 134 |
| 387 | 3300009553 | Ga0105249_10209614 | Ga0105249_102096142 | 134 |
| 388 | 3300009553 | Ga0105249_10316566 | Ga0105249_103165662 | 134 |
| 389 | 3300009553 | Ga0105249_10737523 | Ga0105249_107375231 | 134 |
| 390 | 3300009553 | Ga0105249_10801055 | Ga0105249_108010551 | 134 |
| 391 | 3300009553 | Ga0105249_10903643 | Ga0105249_109036433 | 134 |
| 392 | 3300010375 | Ga0105239_10058947 | Ga0105239_100589472 | 134 |
| 393 | 3300010375 | Ga0105239_10296177 | Ga0105239_102961772 | 134 |
| 394 | 3300011119 | Ga0105246_10026634 | Ga0105246_100266343 | 134 |
| 395 | 3300011119 | Ga0105246_10287913 | Ga0105246_102879132 | 134 |
| 396 | 3300011119 | Ga0105246_10959677 | Ga0105246_109596772 | 134 |
| 397 | 3300013100 | Ga0157373_10006113 | Ga0157373_1000611314 | 134 |
| 398 | 3300013100 | Ga0157373_10592253 | Ga0157373_105922532 | 134 |
| 399 | 3300013100 | Ga0157373_10610590 | Ga0157373_106105902 | 134 |
| 400 | 3300013104 | Ga0157370_10036803 | Ga0157370_100368032 | 134 |
| 401 | 3300013104 | Ga0157370_10041048 | Ga0157370_100410486 | 134 |
| 402 | 3300013104 | Ga0157370_10139785 | Ga0157370_101397852 | 134 |
| 403 | 3300013104 | Ga0157370_10343630 | Ga0157370_103436302 | 134 |
| 404 | 3300013104 | Ga0157370_10482976 | Ga0157370_104829761 | 134 |
| 405 | 3300013105 | Ga0157369_10021262 | Ga0157369_100212623 | 134 |
| 406 | 3300013105 | Ga0157369_10022113 | Ga0157369_100221138 | 134 |
| 407 | 3300013105 | Ga0157369_10120701 | Ga0157369_101207012 | 134 |
| 408 | 3300013105 | Ga0157369_10262498 | Ga0157369_102624983 | 134 |
| 409 | 3300013105 | Ga0157369_10371513 | Ga0157369_103715132 | 134 |
| 410 | 3300013105 | Ga0157369_10600419 | Ga0157369_106004191 | 134 |
| 411 | 3300013105 | Ga0157369_12311297 | Ga0157369_123112971 | 134 |
| 412 | 3300013296 | Ga0157374_10439314 | Ga0157374_104393142 | 134 |
| 413 | 3300013296 | Ga0157374_11246992 | Ga0157374_112469921 | 134 |
| 414 | 3300013296 | Ga0157374_12528854 | Ga0157374_125288541 | 134 |
| 415 | 3300013297 | Ga0157378_10032881 | Ga0157378_100328812 | 134 |
| 416 | 3300013306 | Ga0163162_10036256 | Ga0163162_100362562 | 134 |
| 417 | 3300013306 | Ga0163162_10102699 | Ga0163162_101026992 | 134 |
| 418 | 3300013306 | Ga0163162_12402203 | Ga0163162_124022031 | 134 |
| 419 | 3300013307 | Ga0157372_10011579 | Ga0157372_100115797 | 134 |
| 420 | 3300013307 | Ga0157372_10012424 | Ga0157372_100124245 | 134 |
| 421 | 3300013307 | Ga0157372_10025733 | Ga0157372_100257332 | 134 |
| 422 | 3300013307 | Ga0157372_10044399 | Ga0157372_1004439910 | 134 |
| 423 | 3300013308 | Ga0157375_10091378 | Ga0157375_100913782 | 134 |
| 424 | 3300013308 | Ga0157375_10197222 | Ga0157375_101972225 | 134 |
| 425 | 3300013308 | Ga0157375_10920548 | Ga0157375_109205482 | 134 |
| 426 | 3300014325 | Ga0163163_10229071 | Ga0163163_102290711 | 134 |
| 427 | 3300014326 | Ga0157380_10007796 | Ga0157380_100077964 | 134 |
| 428 | 3300014326 | Ga0157380_10014458 | Ga0157380_100144585 | 134 |
| 429 | 3300014326 | Ga0157380_10021654 | Ga0157380_100216544 | 134 |
| 430 | 3300014326 | Ga0157380_10105668 | Ga0157380_101056681 | 134 |
| 431 | 3300014326 | Ga0157380_10598207 | Ga0157380_105982072 | 134 |
| 432 | 3300014326 | Ga0157380_11668258 | Ga0157380_116682582 | 134 |
| 433 | 3300014497 | Ga0182008_10458431 | Ga0182008_104584311 | 134 |
| 434 | 3300014745 | Ga0157377_10260657 | Ga0157377_102606572 | 134 |
| 435 | 3300014968 | Ga0157379_10028104 | Ga0157379_100281047 | 134 |
| 436 | 3300014968 | Ga0157379_10067008 | Ga0157379_100670082 | 134 |
| 437 | 3300014969 | Ga0157376_10277619 | Ga0157376_102776192 | 134 |
| 438 | 3300014969 | Ga0157376_10428804 | Ga0157376_104288042 | 134 |
| 439 | 3300014969 | Ga0157376_10491124 | Ga0157376_104911241 | 134 |
| 440 | 3300017792 | Ga0163161_10005896 | Ga0163161_1000589615 | 134 |
| 441 | 3300017792 | Ga0163161_10079041 | Ga0163161_100790413 | 134 |
| 442 | 3300017792 | Ga0163161_10715563 | Ga0163161_107155631 | 134 |
| 443 | 3300017792 | Ga0163161_11179949 | Ga0163161_111799491 | 134 |
| 444 | 3300025315 | Ga0207697_10001167 | Ga0207697_1000116710 | 134 |
| 445 | 3300025321 | Ga0207656_10027037 | Ga0207656_100270373 | 134 |
| 446 | 3300025321 | Ga0207656_10028196 | Ga0207656_100281964 | 134 |
| 447 | 3300025885 | Ga0207653_10000528 | Ga0207653_100005284 | 134 |
| 448 | 3300025885 | Ga0207653_10039485 | Ga0207653_100394852 | 134 |
| 449 | 3300025885 | Ga0207653_10261613 | Ga0207653_102616132 | 134 |
| 450 | 3300025893 | Ga0207682_10003279 | Ga0207682_100032793 | 134 |
| 451 | 3300025893 | Ga0207682_10019128 | Ga0207682_100191284 | 134 |
| 452 | 3300025899 | Ga0207642_10001495 | Ga0207642_100014956 | 134 |
| 453 | 3300025899 | Ga0207642_10664893 | Ga0207642_106648931 | 134 |
| 454 | 3300025900 | Ga0207710_10137492 | Ga0207710_101374922 | 134 |
| 455 | 3300025901 | Ga0207688_10004841 | Ga0207688_100048416 | 134 |
| 456 | 3300025903 | Ga0207680_10068497 | Ga0207680_100684973 | 134 |
| 457 | 3300025903 | Ga0207680_10205043 | Ga0207680_102050432 | 134 |
| 458 | 3300025903 | Ga0207680_10263434 | Ga0207680_102634342 | 134 |
| 459 | 3300025904 | Ga0207647_10286326 | Ga0207647_102863261 | 134 |
| 460 | 3300025905 | Ga0207685_10163786 | Ga0207685_101637862 | 134 |
| 461 | 3300025906 | Ga0207699_10021613 | Ga0207699_100216134 | 134 |
| 462 | 3300025906 | Ga0207699_10602461 | Ga0207699_106024612 | 134 |
| 463 | 3300025907 | Ga0207645_10003863 | Ga0207645_100038632 | 134 |
| 464 | 3300025907 | Ga0207645_10011601 | Ga0207645_100116015 | 134 |
| 465 | 3300025908 | Ga0207643_10001455 | Ga0207643_100014554 | 134 |
| 466 | 3300025908 | Ga0207643_10009672 | Ga0207643_100096725 | 134 |
| 467 | 3300025908 | Ga0207643_10081260 | Ga0207643_100812603 | 134 |
| 468 | 3300025908 | Ga0207643_10118306 | Ga0207643_101183063 | 134 |
| 469 | 3300025908 | Ga0207643_10127074 | Ga0207643_101270741 | 134 |
| 470 | 3300025910 | Ga0207684_10457109 | Ga0207684_104571092 | 134 |
| 471 | 3300025910 | Ga0207684_10644718 | Ga0207684_106447182 | 134 |
| 472 | 3300025912 | Ga0207707_10019304 | Ga0207707_100193042 | 134 |
| 473 | 3300025912 | Ga0207707_10728274 | Ga0207707_107282741 | 134 |
| 474 | 3300025912 | Ga0207707_10729336 | Ga0207707_107293362 | 134 |
| 475 | 3300025913 | Ga0207695_10016423 | Ga0207695_1001642310 | 134 |
| 476 | 3300025913 | Ga0207695_10021694 | Ga0207695_100216942 | 134 |
| 477 | 3300025913 | Ga0207695_10093519 | Ga0207695_100935191 | 134 |
| 478 | 3300025913 | Ga0207695_10177887 | Ga0207695_101778873 | 134 |
| 479 | 3300025913 | Ga0207695_10305110 | Ga0207695_103051102 | 134 |
| 480 | 3300025914 | Ga0207671_10541336 | Ga0207671_105413362 | 134 |
| 481 | 3300025917 | Ga0207660_10028143 | Ga0207660_100281432 | 134 |
| 482 | 3300025917 | Ga0207660_10087225 | Ga0207660_100872252 | 134 |
| 483 | 3300025918 | Ga0207662_10009327 | Ga0207662_100093275 | 134 |
| 484 | 3300025918 | Ga0207662_10015377 | Ga0207662_100153774 | 134 |
| 485 | 3300025918 | Ga0207662_11116726 | Ga0207662_111167262 | 134 |
| 486 | 3300025919 | Ga0207657_10104968 | Ga0207657_101049683 | 134 |
| 487 | 3300025919 | Ga0207657_10453211 | Ga0207657_104532111 | 134 |
| 488 | 3300025920 | Ga0207649_10007168 | Ga0207649_100071685 | 134 |
| 489 | 3300025920 | Ga0207649_10080026 | Ga0207649_100800262 | 134 |
| 490 | 3300025920 | Ga0207649_10258873 | Ga0207649_102588731 | 134 |
| 491 | 3300025920 | Ga0207649_10731697 | Ga0207649_107316972 | 134 |
| 492 | 3300025921 | Ga0207652_10177997 | Ga0207652_101779972 | 134 |
| 493 | 3300025921 | Ga0207652_10841185 | Ga0207652_108411852 | 134 |
| 494 | 3300025921 | Ga0207652_10970579 | Ga0207652_109705791 | 134 |
| 495 | 3300025922 | Ga0207646_10001564 | Ga0207646_1000156410 | 134 |
| 496 | 3300025922 | Ga0207646_11126822 | Ga0207646_111268221 | 134 |
| 497 | 3300025922 | Ga0207646_11663688 | Ga0207646_116636882 | 134 |
| 498 | 3300025922 | Ga0207646_11739667 | Ga0207646_117396671 | 134 |
| 499 | 3300025923 | Ga0207681_10068742 | Ga0207681_100687422 | 134 |
| 500 | 3300025923 | Ga0207681_10238544 | Ga0207681_102385441 | 134 |
| 501 | 3300025923 | Ga0207681_10460184 | Ga0207681_104601841 | 134 |
| 502 | 3300025923 | Ga0207681_10482698 | Ga0207681_104826983 | 134 |
| 503 | 3300025923 | Ga0207681_10570530 | Ga0207681_105705301 | 134 |
| 504 | 3300025923 | Ga0207681_11292550 | Ga0207681_112925501 | 134 |
| 505 | 3300025924 | Ga0207694_10044734 | Ga0207694_100447343 | 134 |
| 506 | 3300025924 | Ga0207694_10176592 | Ga0207694_101765922 | 134 |
| 507 | 3300025924 | Ga0207694_10940635 | Ga0207694_109406352 | 134 |
| 508 | 3300025925 | Ga0207650_10023723 | Ga0207650_100237233 | 134 |
| 509 | 3300025925 | Ga0207650_10095642 | Ga0207650_100956422 | 134 |
| 510 | 3300025925 | Ga0207650_10232895 | Ga0207650_102328953 | 134 |
| 511 | 3300025925 | Ga0207650_10515628 | Ga0207650_105156281 | 134 |
| 512 | 3300025926 | Ga0207659_10126749 | Ga0207659_101267491 | 134 |
| 513 | 3300025926 | Ga0207659_10395868 | Ga0207659_103958682 | 134 |
| 514 | 3300025927 | Ga0207687_10604142 | Ga0207687_106041421 | 134 |
| 515 | 3300025928 | Ga0207700_10017897 | Ga0207700_100178972 | 134 |
| 516 | 3300025929 | Ga0207664_10236792 | Ga0207664_102367922 | 134 |
| 517 | 3300025929 | Ga0207664_10838424 | Ga0207664_108384242 | 134 |
| 518 | 3300025929 | Ga0207664_10872239 | Ga0207664_108722392 | 134 |
| 519 | 3300025931 | Ga0207644_11353542 | Ga0207644_113535422 | 134 |
| 520 | 3300025932 | Ga0207690_10002601 | Ga0207690_100026018 | 134 |
| 521 | 3300025932 | Ga0207690_10591278 | Ga0207690_105912781 | 134 |
| 522 | 3300025932 | Ga0207690_10732238 | Ga0207690_107322382 | 134 |
| 523 | 3300025932 | Ga0207690_10976900 | Ga0207690_109769001 | 134 |
| 524 | 3300025933 | Ga0207706_10000218 | Ga0207706_1000021811 | 134 |
| 525 | 3300025933 | Ga0207706_10252509 | Ga0207706_102525092 | 134 |
| 526 | 3300025934 | Ga0207686_10002437 | Ga0207686_100024376 | 134 |
| 527 | 3300025934 | Ga0207686_10005688 | Ga0207686_100056886 | 134 |
| 528 | 3300025934 | Ga0207686_10626626 | Ga0207686_106266261 | 134 |
| 529 | 3300025935 | Ga0207709_10015176 | Ga0207709_100151761 | 134 |
| 530 | 3300025935 | Ga0207709_10115993 | Ga0207709_101159932 | 134 |
| 531 | 3300025935 | Ga0207709_10363511 | Ga0207709_103635112 | 134 |
| 532 | 3300025936 | Ga0207670_10013106 | Ga0207670_100131065 | 134 |
| 533 | 3300025936 | Ga0207670_10183131 | Ga0207670_101831313 | 134 |
| 534 | 3300025936 | Ga0207670_10387709 | Ga0207670_103877092 | 134 |
| 535 | 3300025936 | Ga0207670_10920000 | Ga0207670_109200001 | 134 |
| 536 | 3300025937 | Ga0207669_10000933 | Ga0207669_100009332 | 134 |
| 537 | 3300025937 | Ga0207669_10041790 | Ga0207669_100417902 | 134 |
| 538 | 3300025937 | Ga0207669_10727899 | Ga0207669_107278992 | 134 |
| 539 | 3300025938 | Ga0207704_10134275 | Ga0207704_101342752 | 134 |
| 540 | 3300025939 | Ga0207665_10007638 | Ga0207665_100076385 | 134 |
| 541 | 3300025939 | Ga0207665_10355486 | Ga0207665_103554861 | 134 |
| 542 | 3300025940 | Ga0207691_10007060 | Ga0207691_100070608 | 134 |
| 543 | 3300025940 | Ga0207691_10030230 | Ga0207691_100302303 | 134 |
| 544 | 3300025940 | Ga0207691_10246920 | Ga0207691_102469202 | 134 |
| 545 | 3300025941 | Ga0207711_10051808 | Ga0207711_100518081 | 134 |
| 546 | 3300025941 | Ga0207711_10069994 | Ga0207711_100699948 | 134 |
| 547 | 3300025941 | Ga0207711_10124465 | Ga0207711_101244653 | 134 |
| 548 | 3300025941 | Ga0207711_10242612 | Ga0207711_102426122 | 134 |
| 549 | 3300025942 | Ga0207689_10005269 | Ga0207689_100052692 | 134 |
| 550 | 3300025942 | Ga0207689_10035162 | Ga0207689_100351622 | 134 |
| 551 | 3300025942 | Ga0207689_10084992 | Ga0207689_100849923 | 134 |
| 552 | 3300025942 | Ga0207689_10105432 | Ga0207689_101054324 | 134 |
| 553 | 3300025944 | Ga0207661_10062543 | Ga0207661_100625433 | 134 |
| 554 | 3300025944 | Ga0207661_10065614 | Ga0207661_100656143 | 134 |
| 555 | 3300025944 | Ga0207661_10082900 | Ga0207661_100829003 | 134 |
| 556 | 3300025944 | Ga0207661_10344541 | Ga0207661_103445412 | 134 |
| 557 | 3300025945 | Ga0207679_10006327 | Ga0207679_100063275 | 134 |
| 558 | 3300025949 | Ga0207667_10207784 | Ga0207667_102077842 | 134 |
| 559 | 3300025949 | Ga0207667_10233112 | Ga0207667_102331122 | 134 |
| 560 | 3300025949 | Ga0207667_10368845 | Ga0207667_103688452 | 134 |
| 561 | 3300025949 | Ga0207667_10392228 | Ga0207667_103922282 | 134 |
| 562 | 3300025960 | Ga0207651_10014021 | Ga0207651_100140213 | 134 |
| 563 | 3300025961 | Ga0207712_10000775 | Ga0207712_100007759 | 134 |
| 564 | 3300025961 | Ga0207712_10002104 | Ga0207712_100021047 | 134 |
| 565 | 3300025961 | Ga0207712_10015131 | Ga0207712_100151312 | 134 |
| 566 | 3300025961 | Ga0207712_10062297 | Ga0207712_100622975 | 134 |
| 567 | 3300025961 | Ga0207712_10239722 | Ga0207712_102397222 | 134 |
| 568 | 3300025961 | Ga0207712_10294561 | Ga0207712_102945612 | 134 |
| 569 | 3300025961 | Ga0207712_10305393 | Ga0207712_103053932 | 134 |
| 570 | 3300025961 | Ga0207712_10625736 | Ga0207712_106257361 | 134 |
| 571 | 3300025972 | Ga0207668_10295135 | Ga0207668_102951353 | 134 |
| 572 | 3300025981 | Ga0207640_10180218 | Ga0207640_101802182 | 134 |
| 573 | 3300025981 | Ga0207640_10968394 | Ga0207640_109683941 | 134 |
| 574 | 3300025986 | Ga0207658_10078354 | Ga0207658_100783543 | 134 |
| 575 | 3300025986 | Ga0207658_11204486 | Ga0207658_112044861 | 134 |
| 576 | 3300025986 | Ga0207658_11469967 | Ga0207658_114699671 | 134 |
| 577 | 3300026023 | Ga0207677_10590463 | Ga0207677_105904631 | 134 |
| 578 | 3300026023 | Ga0207677_10843337 | Ga0207677_108433372 | 134 |
| 579 | 3300026035 | Ga0207703_10052362 | Ga0207703_100523623 | 134 |
| 580 | 3300026035 | Ga0207703_10151765 | Ga0207703_101517654 | 134 |
| 581 | 3300026035 | Ga0207703_10419100 | Ga0207703_104191001 | 134 |
| 582 | 3300026035 | Ga0207703_10442667 | Ga0207703_104426673 | 134 |
| 583 | 3300026067 | Ga0207678_10013214 | Ga0207678_100132144 | 134 |
| 584 | 3300026075 | Ga0207708_10023908 | Ga0207708_100239082 | 134 |
| 585 | 3300026075 | Ga0207708_10162139 | Ga0207708_101621392 | 134 |
| 586 | 3300026075 | Ga0207708_10186525 | Ga0207708_101865252 | 134 |
| 587 | 3300026075 | Ga0207708_10348212 | Ga0207708_103482122 | 134 |
| 588 | 3300026075 | Ga0207708_10441859 | Ga0207708_104418591 | 134 |
| 589 | 3300026078 | Ga0207702_10072027 | Ga0207702_100720273 | 134 |
| 590 | 3300026078 | Ga0207702_10289200 | Ga0207702_102892001 | 134 |
| 591 | 3300026078 | Ga0207702_10309578 | Ga0207702_103095782 | 134 |
| 592 | 3300026078 | Ga0207702_10741570 | Ga0207702_107415702 | 134 |
| 593 | 3300026078 | Ga0207702_11370257 | Ga0207702_113702571 | 134 |
| 594 | 3300026078 | Ga0207702_11451523 | Ga0207702_114515232 | 134 |
| 595 | 3300026088 | Ga0207641_10001235 | Ga0207641_100012357 | 134 |
| 596 | 3300026088 | Ga0207641_10011819 | Ga0207641_100118193 | 134 |
| 597 | 3300026088 | Ga0207641_10042331 | Ga0207641_100423312 | 134 |
| 598 | 3300026088 | Ga0207641_10321971 | Ga0207641_103219713 | 134 |
| 599 | 3300026089 | Ga0207648_10003314 | Ga0207648_100033148 | 134 |
| 600 | 3300026089 | Ga0207648_10028708 | Ga0207648_100287081 | 134 |
| 601 | 3300026089 | Ga0207648_10152251 | Ga0207648_101522513 | 134 |
| 602 | 3300026089 | Ga0207648_11080109 | Ga0207648_110801091 | 134 |
| 603 | 3300026089 | Ga0207648_11166577 | Ga0207648_111665772 | 134 |
| 604 | 3300026095 | Ga0207676_10026480 | Ga0207676_100264802 | 134 |
| 605 | 3300026095 | Ga0207676_10203391 | Ga0207676_102033912 | 134 |
| 606 | 3300026095 | Ga0207676_10495504 | Ga0207676_104955042 | 134 |
| 607 | 3300026095 | Ga0207676_11090265 | Ga0207676_110902651 | 134 |
| 608 | 3300026116 | Ga0207674_10001105 | Ga0207674_1000110518 | 134 |
| 609 | 3300026116 | Ga0207674_10093328 | Ga0207674_100933284 | 134 |
| 610 | 3300026116 | Ga0207674_10804200 | Ga0207674_108042002 | 134 |
| 611 | 3300026116 | Ga0207674_11218331 | Ga0207674_112183312 | 134 |
| 612 | 3300026118 | Ga0207675_100009956 | Ga0207675_1000099563 | 134 |
| 613 | 3300026118 | Ga0207675_100042433 | Ga0207675_1000424335 | 134 |
| 614 | 3300026118 | Ga0207675_100141120 | Ga0207675_1001411202 | 134 |
| 615 | 3300026118 | Ga0207675_100261617 | Ga0207675_1002616171 | 134 |
| 616 | 3300026118 | Ga0207675_101125594 | Ga0207675_1011255941 | 134 |
| 617 | 3300026121 | Ga0207683_10072473 | Ga0207683_100724732 | 134 |
| 618 | 3300026121 | Ga0207683_10120221 | Ga0207683_101202215 | 134 |
| 619 | 3300026121 | Ga0207683_10601172 | Ga0207683_106011721 | 134 |
| 620 | 3300026142 | Ga0207698_10453003 | Ga0207698_104530031 | 134 |
| 621 | 3300026142 | Ga0207698_11277820 | Ga0207698_112778201 | 134 |
| 622 | 3300027671 | Ga0209588_1025967 | Ga0209588_10259672 | 134 |
| 623 | 3300027907 | Ga0207428_10000413 | Ga0207428_1000041342 | 134 |
| 624 | 3300027907 | Ga0207428_10046079 | Ga0207428_100460793 | 134 |
| 625 | 3300027907 | Ga0207428_10432135 | Ga0207428_104321352 | 134 |
| 626 | 3300027907 | Ga0207428_10633861 | Ga0207428_106338611 | 134 |
| 627 | 3300028379 | Ga0268266_11174764 | Ga0268266_111747641 | 134 |
| 628 | 3300028379 | Ga0268266_11189189 | Ga0268266_111891891 | 134 |
| 629 | 3300028380 | Ga0268265_10043935 | Ga0268265_100439354 | 134 |
| 630 | 3300028380 | Ga0268265_10070052 | Ga0268265_100700522 | 134 |
| 631 | 3300028380 | Ga0268265_10125984 | Ga0268265_101259842 | 134 |
| 632 | 3300028380 | Ga0268265_10428404 | Ga0268265_104284041 | 134 |
| 633 | 3300028380 | Ga0268265_10700909 | Ga0268265_107009092 | 134 |
| 634 | 3300028380 | Ga0268265_10761037 | Ga0268265_107610372 | 134 |
| 635 | 3300028381 | Ga0268264_10025346 | Ga0268264_100253464 | 134 |
| 636 | 3300028381 | Ga0268264_10281833 | Ga0268264_102818333 | 134 |
| 637 | 3300028381 | Ga0268264_10742538 | Ga0268264_107425382 | 134 |
| 638 | 3300031731 | Ga0307405_11048789 | Ga0307405_110487891 | 134 |
| 639 | 3300031852 | Ga0307410_10101259 | Ga0307410_101012591 | 134 |
| 640 | 3300031852 | Ga0307410_11558810 | Ga0307410_115588101 | 134 |
| 641 | 3300031903 | Ga0307407_10567255 | Ga0307407_105672552 | 134 |
| 642 | 3300031995 | Ga0307409_100707007 | Ga0307409_1007070071 | 134 |
| 643 | 3300032002 | Ga0307416_100429599 | Ga0307416_1004295992 | 134 |
| 644 | 3300032002 | Ga0307416_101420413 | Ga0307416_1014204132 | 134 |
| 645 | 3300032002 | Ga0307416_102338677 | Ga0307416_1023386771 | 134 |
| 646 | 3300032005 | Ga0307411_10370259 | Ga0307411_103702592 | 134 |
| 647 | 3300035084 | Ga0373928_0019043 | Ga0373928_0019043_690_1100 | 134 |
| 648 | 3300035086 | Ga0373934_0025992 | Ga0373934_0025992_1213_1620 | 134 |
| 649 | 3300035114 | Ga0373939_0497241 | Ga0373939_0497241_37_447 | 134 |
| 650 | 3300035115 | Ga0373941_0305631 | Ga0373941_0305631_133_543 | 134 |
| 651 | 3300035116 | Ga0373945_0306214 | Ga0373945_0306214_239_643 | 134 |
| 652 | 3300035117 | Ga0373953_0238492 | Ga0373953_0238492_109_516 | 134 |
| 653 | 3300035170 | Ga0373943_0230162 | Ga0373943_0230162_119_541 | 134 |
| 654 | 3300035170 | Ga0373943_0245571 | Ga0373943_0245571_442_846 | 134 |
| 655 | 3300035172 | Ga0373955_0073794 | Ga0373955_0073794_799_1206 | 134 |
| 656 | 3300035398 | Ga0316574_0087116 | Ga0316574_0087116_1263_1673 | 134 |
| 657 | 3300035398 | Ga0316574_0139357 | Ga0316574_0139357_464_871 | 134 |
| 658 | 3300035695 | Ga0373927_0033214 | Ga0373927_0033214_2484_2888 | 134 |
| 659 | 3300035724 | Ga0373933_0155748 | Ga0373933_0155748_755_1162 | 134 |
| 660 | 3300035725 | Ga0373947_1236113 | Ga0373947_1236113_14_418 | 134 |
| 661 | 3300036401 | Ga0373937_0106882 | Ga0373937_0106882_1895_2302 | 134 |
| 662 | 3300036712 | Ga0316584_0732277 | Ga0316584_0732277_38_445 | 134 |
| 663 | 3300037068 | Ga0373925_0008740 | Ga0373925_0008740_2078_2482 | 134 |
| 664 | 3300037068 | Ga0373925_0092136 | Ga0373925_0092136_1567_1971 | 134 |
| 665 | 3300037471 | Ga0395905_0171347 | Ga0395905_0171347_1292_1705 | 134 |
| 666 | 3300039437 | Ga0436365_1265377 | Ga0436365_1265377_256_663 | 134 |
| 667 | 3300041411 | Ga0439466_0224634 | Ga0439466_0224634_84_488 | 134 |
| 668 | 3300041460 | Ga0451802_1169347 | Ga0451802_1169347_108_515 | 134 |
| 669 | 3300041512 | Ga0451853_3447544 | Ga0451853_3447544_146_562 | 134 |
| 670 | 3300041999 | Ga0439433_0003604 | Ga0439433_0003604_564_989 | 134 |
| 671 | 3300042001 | Ga0439441_014075 | Ga0439441_014075_882_1289 | 134 |
| 672 | 3300042015 | Ga0439462_0146830 | Ga0439462_0146830_68_472 | 134 |
| 673 | 3300042435 | Ga0439434_0087992 | Ga0439434_0087992_459_863 | 134 |
| 674 | 3300042437 | Ga0439444_0071870 | Ga0439444_0071870_291_701 | 134 |
| 675 | 3300042439 | Ga0439464_0180592 | Ga0439464_0180592_111_524 | 134 |
| 676 | 3300042439 | Ga0439464_0198468 | Ga0439464_0198468_140_550 | 134 |
| 677 | 3300042531 | Ga0450918_046349 | Ga0450918_046349_251_658 | 134 |
| 678 | 3300042531 | Ga0450918_125916 | Ga0450918_125916_78_482 | 134 |
| 679 | 3300042876 | Ga0451577_0810891 | Ga0451577_0810891_410_814 | 134 |
| 680 | 3300044673 | Ga0453683_0247526 | Ga0453683_0247526_63_467 | 134 |
| 681 | 3300044673 | Ga0453683_0622087 | Ga0453683_0622087_106_516 | 134 |
| 682 | 3300044712 | Ga0453684_0540312 | Ga0453684_0540312_71_475 | 134 |
| 683 | 3300045051 | Ga0451576_0012058 | Ga0451576_0012058_7454_7861 | 134 |
| 684 | 3300045051 | Ga0451576_0174738 | Ga0451576_0174738_1280_1684 | 134 |
| 685 | 3300045051 | Ga0451576_0240415 | Ga0451576_0240415_1092_1502 | 134 |
| 686 | 3300045051 | Ga0451576_0408910 | Ga0451576_0408910_448_870 | 134 |
| 687 | 3300045051 | Ga0451576_0484599 | Ga0451576_0484599_287_691 | 134 |
| 688 | 3300045051 | Ga0451576_0722391 | Ga0451576_0722391_177_587 | 134 |
| 689 | 3300045976 | Ga0466967_0084859 | Ga0466967_0084859_2350_2754 | 134 |
| 690 | 3300046454 | Ga0495592_0098553 | Ga0495592_0098553_1570_1977 | 134 |
| 691 | 3300046462 | Ga0495651_0006446 | Ga0495651_0006446_5314_5721 | 134 |
| 692 | 3300046472 | Ga0495580_0025669 | Ga0495580_0025669_505_909 | 134 |
| 693 | 3300046473 | Ga0495582_0170945 | Ga0495582_0170945_75_479 | 134 |
| 694 | 3300046475 | Ga0495639_0717609 | Ga0495639_0717609_102_506 | 134 |
| 695 | 3300046477 | Ga0495664_0034160 | Ga0495664_0034160_1249_1656 | 134 |
| 696 | 3300046499 | Ga0495594_0060961 | Ga0495594_0060961_183_587 | 134 |
| 697 | 3300046499 | Ga0495594_0100588 | Ga0495594_0100588_149_565 | 134 |
| 698 | 3300046516 | Ga0495628_0174963 | Ga0495628_0174963_11_418 | 134 |
| 699 | 3300046517 | Ga0495630_0029235 | Ga0495630_0029235_47_451 | 134 |
| 700 | 3300046526 | Ga0495666_0235260 | Ga0495666_0235260_348_752 | 134 |
| 701 | 3300046529 | Ga0495652_0018170 | Ga0495652_0018170_1414_1821 | 134 |
| 702 | 3300046531 | Ga0495665_0680592 | Ga0495665_0680592_15_422 | 134 |
| 703 | 3300046535 | Ga0495586_0033992 | Ga0495586_0033992_1013_1420 | 134 |
| 704 | 3300046536 | Ga0495587_0009958 | Ga0495587_0009958_5196_5603 | 134 |
| 705 | 3300046539 | Ga0495621_0124207 | Ga0495621_0124207_498_905 | 134 |
| 706 | 3300046539 | Ga0495621_0273706 | Ga0495621_0273706_180_587 | 134 |
| 707 | 3300046543 | Ga0495645_0003822 | Ga0495645_0003822_6453_6860 | 134 |
| 708 | 3300046543 | Ga0495645_0157246 | Ga0495645_0157246_507_938 | 134 |
| 709 | 3300046557 | Ga0495622_0058709 | Ga0495622_0058709_396_812 | 134 |
| 710 | 3300046558 | Ga0495633_0135743 | Ga0495633_0135743_37_459 | 134 |
| 711 | 3300046559 | Ga0495667_0038543 | Ga0495667_0038543_1136_1543 | 134 |
| 712 | 3300046615 | Ga0495656_0272123 | Ga0495656_0272123_48_455 | 134 |
| 713 | 3300046642 | Ga0495634_0732350 | Ga0495634_0732350_46_453 | 134 |
| 714 | 3300046664 | Ga0495659_0365017 | Ga0495659_0365017_84_488 | 134 |
| 715 | 3300046664 | Ga0495659_0524672 | Ga0495659_0524672_13_420 | 134 |
| 716 | 3300046675 | Ga0495657_0335776 | Ga0495657_0335776_152_559 | 134 |
| 717 | 3300046678 | Ga0495599_0047894 | Ga0495599_0047894_332_739 | 134 |
| 718 | 3300046679 | Ga0495623_0161334 | Ga0495623_0161334_808_1215 | 134 |
| 719 | 3300046681 | Ga0495647_0264227 | Ga0495647_0264227_168_575 | 134 |
| 720 | 3300046809 | Ga0495600_0006903 | Ga0495600_0006903_458_865 | 134 |
| 721 | 3300046809 | Ga0495600_0102040 | Ga0495600_0102040_885_1289 | 134 |
| 722 | 3300047315 | Ga0495581_0282060 | Ga0495581_0282060_193_615 | 134 |
| 723 | 3300047317 | Ga0495604_0575763 | Ga0495604_0575763_205_612 | 134 |
| 724 | 3300047318 | Ga0495636_0540280 | Ga0495636_0540280_38_469 | 134 |
| 725 | 3300047320 | Ga0495672_0003461 | Ga0495672_0003461_253_660 | 134 |
| 726 | 3300047471 | Ga0495684_0109941 | Ga0495684_0109941_108_512 | 134 |
| 727 | 3300048088 | Ga0495602_0327073 | Ga0495602_0327073_122_529 | 134 |
| 728 | 3300048903 | Ga0496100_1583314 | Ga0496100_1583314_36_440 | 134 |
| 729 | 3300048905 | Ga0496102_0576392 | Ga0496102_0576392_165_569 | 134 |
| 730 | 3300048906 | Ga0496103_0619129 | Ga0496103_0619129_240_644 | 134 |
| 731 | 3300048907 | Ga0496104_0535311 | Ga0496104_0535311_24_428 | 134 |
| 732 | 3300048909 | Ga0496106_0078456 | Ga0496106_0078456_68_472 | 134 |
| 733 | 3300048911 | Ga0496108_0835643 | Ga0496108_0835643_143_547 | 134 |
| 734 | 3300048912 | Ga0496109_1981475 | Ga0496109_1981475_66_476 | 134 |
| 735 | 3300048917 | Ga0496114_0309549 | Ga0496114_0309549_458_862 | 134 |
| 736 | 3300049569 | Ga0501032_0535554 | Ga0501032_0535554_24_428 | 134 |
| 737 | 3300049575 | Ga0501039_0018331 | Ga0501039_0018331_164_568 | 134 |
| 738 | 3300049575 | Ga0501039_1187743 | Ga0501039_1187743_17_430 | 134 |
| 739 | 3300049576 | Ga0501040_0362592 | Ga0501040_0362592_524_940 | 134 |
| 740 | 3300049576 | Ga0501040_1260270 | Ga0501040_1260270_79_483 | 134 |
| 741 | 3300049578 | Ga0501042_0067436 | Ga0501042_0067436_1588_1992 | 134 |
| 742 | 3300049578 | Ga0501042_0362979 | Ga0501042_0362979_88_492 | 134 |
| 743 | 3300049579 | Ga0501043_0020312 | Ga0501043_0020312_1427_1849 | 134 |
| 744 | 3300049580 | Ga0501046_0684129 | Ga0501046_0684129_13_423 | 134 |
| 745 | 3300049581 | Ga0501047_1200178 | Ga0501047_1200178_28_450 | 134 |
| 746 | 3300049584 | Ga0501068_0848532 | Ga0501068_0848532_41_466 | 134 |
| 747 | 3300049587 | Ga0501071_0065019 | Ga0501071_0065019_154_582 | 134 |
| 748 | 3300049587 | Ga0501071_0288847 | Ga0501071_0288847_76_480 | 134 |
| 749 | 3300049588 | Ga0501072_0185991 | Ga0501072_0185991_43_447 | 134 |
| 750 | 3300049590 | Ga0501074_0644776 | Ga0501074_0644776_117_521 | 134 |
| 751 | 3300049591 | Ga0501075_0947351 | Ga0501075_0947351_216_620 | 134 |
| 752 | 3300049591 | Ga0501075_1349242 | Ga0501075_1349242_112_519 | 134 |
| 753 | 3300049592 | Ga0501076_0174488 | Ga0501076_0174488_1110_1514 | 134 |
| 754 | 3300049592 | Ga0501076_1290911 | Ga0501076_1290911_17_427 | 134 |
| 755 | 3300049649 | Ga0501198_061380 | Ga0501198_061380_78_488 | 134 |
| 756 | 3300049669 | Ga0501235_227979 | Ga0501235_227979_16_429 | 134 |
| 757 | 3300049687 | Ga0501258_040272 | Ga0501258_040272_185_595 | 134 |
| 758 | 3300049741 | Ga0501079_0089327 | Ga0501079_0089327_737_1141 | 134 |
| 759 | 3300049741 | Ga0501079_0296192 | Ga0501079_0296192_11_439 | 134 |
| 760 | 3300049743 | Ga0501081_0033223 | Ga0501081_0033223_1912_2340 | 134 |
| 761 | 3300049743 | Ga0501081_0512572 | Ga0501081_0512572_270_722 | 134 |
| 762 | 3300049743 | Ga0501081_1191888 | Ga0501081_1191888_94_504 | 134 |
| 763 | 3300049743 | Ga0501081_1223252 | Ga0501081_1223252_38_445 | 134 |
| 764 | 3300049760 | Ga0501263_050209 | Ga0501263_050209_32_442 | 134 |
| 765 | 3300049761 | Ga0501264_026778 | Ga0501264_026778_160_570 | 134 |
| 766 | 3300049822 | Ga0501035_0114716 | Ga0501035_0114716_684_1106 | 134 |
| 767 | 3300049823 | Ga0501044_0190159 | Ga0501044_0190159_366_788 | 134 |
| 768 | 3300049824 | Ga0501045_0060520 | Ga0501045_0060520_153_557 | 134 |
| 769 | 3300050507 | nmdc:mga05p37_209039_c1 | nmdc:mga05p37_209039_c1_502_906 | 134 |
| 770 | 3300050507 | nmdc:mga05p37_358605_c1 | nmdc:mga05p37_358605_c1_358_771 | 134 |
| 771 | 3300050507 | nmdc:mga05p37_869252_c1 | nmdc:mga05p37_869252_c1_419_829 | 134 |
| 772 | 3300050508 | nmdc:mga09592_297687_c1 | nmdc:mga09592_297687_c1_148_561 | 134 |
| 773 | 3300050508 | nmdc:mga09592_37831_c1 | nmdc:mga09592_37831_c1_3591_3998 | 134 |
| 774 | 3300050508 | nmdc:mga09592_66660_c1 | nmdc:mga09592_66660_c1_50_463 | 134 |
| 775 | 3300050509 | nmdc:mga0qj67_1118289_c1 | nmdc:mga0qj67_1118289_c1_143_550 | 134 |
| 776 | 3300050509 | nmdc:mga0qj67_33516_c1 | nmdc:mga0qj67_33516_c1_3419_3832 | 134 |
| 777 | 3300050509 | nmdc:mga0qj67_400226_c1 | nmdc:mga0qj67_400226_c1_654_1064 | 134 |
| 778 | 3300050509 | nmdc:mga0qj67_430558_c1 | nmdc:mga0qj67_430558_c1_449_856 | 134 |
| 779 | 3300050509 | nmdc:mga0qj67_55384_c1 | nmdc:mga0qj67_55384_c1_543_947 | 134 |
| 780 | 3300050510 | nmdc:mga06r32_198310_c1 | nmdc:mga06r32_198310_c1_670_1074 | 134 |
| 781 | 3300050510 | nmdc:mga06r32_273347_c1 | nmdc:mga06r32_273347_c1_1162_1569 | 134 |
| 782 | 3300050510 | nmdc:mga06r32_396366_c1 | nmdc:mga06r32_396366_c1_493_906 | 134 |
| 783 | 3300050510 | nmdc:mga06r32_77335_c1 | nmdc:mga06r32_77335_c1_2064_2477 | 134 |
| 784 | 3300050510 | nmdc:mga06r32_98488_c1 | nmdc:mga06r32_98488_c1_1701_2129 | 134 |
| 785 | 3300050511 | nmdc:mga08y16_170117_c1 | nmdc:mga08y16_170117_c1_919_1326 | 134 |
| 786 | 3300050511 | nmdc:mga08y16_180873_c1 | nmdc:mga08y16_180873_c1_1343_1753 | 134 |
| 787 | 3300050511 | nmdc:mga08y16_189372_c1 | nmdc:mga08y16_189372_c1_771_1178 | 134 |
| 788 | 3300050511 | nmdc:mga08y16_346951_c1 | nmdc:mga08y16_346951_c1_1042_1449 | 134 |
| 789 | 3300050511 | nmdc:mga08y16_734048_c1 | nmdc:mga08y16_734048_c1_48_455 | 134 |
| 790 | 3300050511 | nmdc:mga08y16_805632_c1 | nmdc:mga08y16_805632_c1_137_550 | 134 |
| 791 | 3300050511 | nmdc:mga08y16_8540_c1 | nmdc:mga08y16_8540_c1_6392_6805 | 134 |
| 792 | 3300050512 | nmdc:mga0n895_126690_c1 | nmdc:mga0n895_126690_c1_240_644 | 134 |
| 793 | 3300050512 | nmdc:mga0n895_1268511_c1 | nmdc:mga0n895_1268511_c1_172_579 | 134 |
| 794 | 3300050512 | nmdc:mga0n895_139421_c1 | nmdc:mga0n895_139421_c1_1821_2240 | 134 |
| 795 | 3300050512 | nmdc:mga0n895_18896_c1 | nmdc:mga0n895_18896_c1_5234_5644 | 134 |
| 796 | 3300050512 | nmdc:mga0n895_323155_c1 | nmdc:mga0n895_323155_c1_991_1401 | 134 |
| 797 | 3300050512 | nmdc:mga0n895_3306_c1 | nmdc:mga0n895_3306_c1_3344_3754 | 134 |
| 798 | 3300050512 | nmdc:mga0n895_429_c1 | nmdc:mga0n895_429_c1_26645_27055 | 134 |
| 799 | 3300050512 | nmdc:mga0n895_629469_c1 | nmdc:mga0n895_629469_c1_266_703 | 134 |
| 800 | 3300050512 | nmdc:mga0n895_79585_c1 | nmdc:mga0n895_79585_c1_28_525 | 134 |
| 801 | 3300050513 | nmdc:mga0rr50_82415_c1 | nmdc:mga0rr50_82415_c1_1979_2389 | 134 |
| 802 | 3300050513 | nmdc:mga0rr50_8697_c1 | nmdc:mga0rr50_8697_c1_350_760 | 134 |
| 803 | 3300050514 | nmdc:mga08x19_101042_c1 | nmdc:mga08x19_101042_c1_133_543 | 134 |
| 804 | 3300050514 | nmdc:mga08x19_1182136_c1 | nmdc:mga08x19_1182136_c1_15_428 | 134 |
| 805 | 3300050514 | nmdc:mga08x19_156502_c1 | nmdc:mga08x19_156502_c1_728_1135 | 134 |
| 806 | 3300050515 | nmdc:mga0a205_179418_c1 | nmdc:mga0a205_179418_c1_573_986 | 134 |
| 807 | 3300050515 | nmdc:mga0a205_222029_c1 | nmdc:mga0a205_222029_c1_432_842 | 134 |
| 808 | 3300050515 | nmdc:mga0a205_309780_c1 | nmdc:mga0a205_309780_c1_499_903 | 134 |
| 809 | 3300050515 | nmdc:mga0a205_417275_c1 | nmdc:mga0a205_417275_c1_707_1117 | 134 |
| 810 | 3300050515 | nmdc:mga0a205_45241_c1 | nmdc:mga0a205_45241_c1_2985_3389 | 134 |
| 811 | 3300050515 | nmdc:mga0a205_5976_c1 | nmdc:mga0a205_5976_c1_5291_5701 | 134 |
| 812 | 3300050515 | nmdc:mga0a205_5997_c1 | nmdc:mga0a205_5997_c1_3858_4268 | 134 |
| 813 | 3300050515 | nmdc:mga0a205_728372_c1 | nmdc:mga0a205_728372_c1_179_592 | 134 |
| 814 | 3300050515 | nmdc:mga0a205_8622_c1 | nmdc:mga0a205_8622_c1_2253_2663 | 134 |
| 815 | 3300053085 | Ga0495619_0094686 | Ga0495619_0094686_215_622 | 134 |
| 816 | 3300053735 | Ga0500596_069325 | Ga0500596_069325_109_513 | 134 |
| 817 | 3300054114 | Ga0501084_0210398 | Ga0501084_0210398_349_777 | 134 |
| 818 | 3300054114 | Ga0501084_1806343 | Ga0501084_1806343_59_472 | 134 |
| 819 | 3300060353 | Ga0501082_1283266 | Ga0501082_1283266_95_511 | 134 |
| 820 | 3300061734 | Ga0530510_0195283 | Ga0530510_0195283_229_642 | 134 |
| 821 | 3300061734 | Ga0530510_0308051 | Ga0530510_0308051_615_1022 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1iq6-assembly1.cif.gz_A | (r)-hydratase from a. caviae involved in pha biosynthesis | 0.95 | 2 | 131 |
| 3k67-assembly1.cif.gz_A | crystal structure of protein af1124 from archaeoglobus fulgidus | 0.9364 | 1 | 131 |
| 1iq6-assembly1.cif.gz_A | (r)-hydratase from a. caviae involved in pha biosynthesis | 0.9294 | 2 | 131 |
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.9254 | 2 | 133 |
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.8994 | 2 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QPM6_23_166_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.965 | 1 | 132 | 3.10.129.10 |
| 1iq6A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.95 | 2 | 131 | 3.10.129.10 |
| 3k67A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9364 | 1 | 131 | 3.10.129.10 |
| 1iq6A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9294 | 2 | 131 | 3.10.129.10 |
| 5cpgB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9254 | 2 | 133 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7K448-F1-model_v4 | Acyl dehydratase | 1 | 3 | 134 |
GO:0006633
GO:0019171 |
| AF-A0A2V6SY34-F1-model_v4 | MaoC-like domain-containing protein | 0.9935 | 3 | 134 |
GO:0006633
GO:0019171 |
| AF-A0A2V6TUC0-F1-model_v4 | Acyl dehydratase | 0.9928 | 4 | 134 |
GO:0006633
GO:0019171 |
| AF-A0A524J3D7-F1-model_v4 | MaoC family dehydratase | 0.9924 | 3 | 134 |
GO:0006633
GO:0019171 |
| AF-A0A2V2SHK0-F1-model_v4 | deleted | 0.9912 | 3 | 134 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar