F482274

General Info

Members Datasets Scaffolds Average Seq Length
821 313 821 136

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0848532|Ga0501068_0848532_41_466
Length 141
Sequence MGTVQGMPKVGDAATRAKTASSRDIELYTEITGDRNPLHYDAAAARGSVFGGLIVQGGITTGILNAIVAEELPGPGTVFLAMELKFVKAVYVGDTITGRVELTGVREDKPICTMAVTVRNQAGDLCLSGNATTYTAALVKD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
226 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
296 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 1.1
Rhizosphere 98.29
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3090340 2162886007 Bacteria 969
2 MRS1b_contig_7347823 2162886011 Unclassified 988
3 JGI24746J21847_1005903 3300001977 Bacteria 1904
4 JGI24746J21847_1018795 3300001977 Unclassified 977
5 JGI24742J22300_10037705 3300002244 Bacteria 856
6 Ga0065704_10107681 3300005289 Bacteria 2049
7 Ga0065704_10475771 3300005289 Unclassified 677
8 Ga0065712_10179213 3300005290 Bacteria 1202
9 Ga0065712_10309829 3300005290 Unclassified 845
10 Ga0065715_10017516 3300005293 Bacteria 2699
11 Ga0065715_10934425 3300005293 Unclassified 564
12 Ga0065707_10085184 3300005295 Bacteria 6378
13 Ga0065707_10280353 3300005295 Unclassified 1048
14 Ga0065707_10290541 3300005295 Unclassified 1026
15 Ga0065707_10953746 3300005295 Bacteria 551
16 Ga0070658_10816169 3300005327 Unclassified 810
17 Ga0070676_10016381 3300005328 Bacteria 4097
18 Ga0070676_10044388 3300005328 Unclassified 2587
19 Ga0070676_11056818 3300005328 Unclassified 612
20 Ga0070683_100022077 3300005329 Bacteria 5685
21 Ga0070683_100025311 3300005329 Bacteria 5328
22 Ga0070683_100111540 3300005329 Bacteria 2580
23 Ga0070690_100023916 3300005330 Bacteria 3753
24 Ga0070690_100546691 3300005330 Bacteria 873
25 Ga0070670_100139832 3300005331 Bacteria 2094
26 Ga0070670_100251587 3300005331 Bacteria 1539
27 Ga0070670_100718420 3300005331 Unclassified 899
28 Ga0070677_10005078 3300005333 Bacteria 4323
29 Ga0068869_100050215 3300005334 Unclassified 3023
30 Ga0068869_100198356 3300005334 Bacteria 1581
31 Ga0068869_100642302 3300005334 Bacteria 900
32 Ga0070666_10100761 3300005335 Bacteria 1990
33 Ga0070666_10191581 3300005335 Unclassified 1437
34 Ga0070680_100005979 3300005336 Bacteria 9231
35 Ga0070680_100100134 3300005336 Bacteria 2405
36 Ga0070680_100101289 3300005336 Bacteria 2391
37 Ga0070682_100099187 3300005337 Bacteria 1920
38 Ga0068868_100034062 3300005338 Bacteria 3930
39 Ga0068868_100324062 3300005338 Unclassified 1313
40 Ga0068868_101520780 3300005338 Bacteria 627
41 Ga0070660_100096997 3300005339 Bacteria 2332
42 Ga0070689_100072634 3300005340 Bacteria 2689
43 Ga0070689_100781988 3300005340 Bacteria 838
44 Ga0070691_10014882 3300005341 Unclassified 3571
45 Ga0070691_10066612 3300005341 Bacteria 1741
46 Ga0070691_10234061 3300005341 Bacteria 979
47 Ga0070687_100008622 3300005343 Bacteria 4328
48 Ga0070661_100007509 3300005344 Bacteria 7521
49 Ga0070661_100026282 3300005344 Bacteria 4186
50 Ga0070661_100431631 3300005344 Bacteria 1046
51 Ga0070661_100941603 3300005344 Bacteria 714
52 Ga0070668_100106234 3300005347 Bacteria 2230
53 Ga0070668_100107386 3300005347 Bacteria 2219
54 Ga0070668_101042892 3300005347 Bacteria 736
55 Ga0070669_100017310 3300005353 Bacteria 5141
56 Ga0070669_100058948 3300005353 Plasmid 2818
57 Ga0070669_100195133 3300005353 Unclassified 1590
58 Ga0070669_100309091 3300005353 Bacteria 1273
59 Ga0070669_100969604 3300005353 Unclassified 728
60 Ga0070669_101491412 3300005353 Bacteria 588
61 Ga0070675_100562422 3300005354 Unclassified 1032
62 Ga0070675_100869661 3300005354 Bacteria 825
63 Ga0070675_101275816 3300005354 Bacteria 677
64 Ga0070671_100207954 3300005355 Bacteria 1659
65 Ga0070674_100004735 3300005356 Bacteria 7791
66 Ga0070674_100006894 3300005356 Bacteria 6660
67 Ga0070674_100588467 3300005356 Bacteria 938
68 Ga0070673_100029315 3300005364 Unclassified 4103
69 Ga0070673_100100980 3300005364 Unclassified 2376
70 Ga0070688_100000962 3300005365 Bacteria 14417
71 Ga0070688_100056301 3300005365 Bacteria 2469
72 Ga0070688_101035351 3300005365 Bacteria 654
73 Ga0070688_101240837 3300005365 Bacteria 600
74 Ga0070659_100009099 3300005366 Bacteria 7285
75 Ga0070659_100345311 3300005366 Bacteria 1248
76 Ga0070667_100031981 3300005367 Bacteria 4387
77 Ga0070667_101177264 3300005367 Bacteria 717
78 Ga0070703_10058468 3300005406 Bacteria 1255
79 Ga0070703_10168449 3300005406 Bacteria 837
80 Ga0070709_10001469 3300005434 Bacteria 12722
81 Ga0070709_10387287 3300005434 Bacteria 1041
82 Ga0070714_100018344 3300005435 Bacteria 5683
83 Ga0070714_100223076 3300005435 Bacteria 1733
84 Ga0070713_100001501 3300005436 Bacteria 14883
85 Ga0070713_100501893 3300005436 Bacteria 1145
86 Ga0070701_10049952 3300005438 Bacteria 2164
87 Ga0070711_100000395 3300005439 Bacteria 22479
88 Ga0070711_100624640 3300005439 Unclassified 901
89 Ga0070705_100007996 3300005440 Bacteria 5227
90 Ga0070705_100063806 3300005440 Bacteria 2198
91 Ga0070705_100333440 3300005440 Bacteria 1100
92 Ga0070705_100701326 3300005440 Unclassified 795
93 Ga0070705_101943172 3300005440 Unclassified 501
94 Ga0070700_100558259 3300005441 Unclassified 891
95 Ga0070694_100004758 3300005444 Bacteria 8177
96 Ga0070694_100181736 3300005444 Bacteria 1556
97 Ga0070694_100260372 3300005444 Bacteria 1315
98 Ga0070694_100336162 3300005444 Bacteria 1166
99 Ga0070708_100002004 3300005445 Bacteria 15669
100 Ga0070708_100970972 3300005445 Bacteria 797
101 Ga0070708_100977370 3300005445 Unclassified 794
102 Ga0070708_101411936 3300005445 Unclassified 649
103 Ga0070708_101544986 3300005445 Bacteria 618
104 Ga0070678_100008983 3300005456 Bacteria 6019
105 Ga0070678_100242567 3300005456 Unclassified 1507
106 Ga0070678_100886985 3300005456 Unclassified 815
107 Ga0070678_101285479 3300005456 Unclassified 680
108 Ga0070662_100004071 3300005457 Bacteria 9188
109 Ga0070662_101510244 3300005457 Bacteria 579
110 Ga0070681_10000857 3300005458 Bacteria 25575
111 Ga0070681_10002670 3300005458 Bacteria 16378
112 Ga0070681_10268187 3300005458 Bacteria 1618
113 Ga0070681_10659412 3300005458 Unclassified 961
114 Ga0068867_100018446 3300005459 Bacteria 4960
115 Ga0068867_100271215 3300005459 Bacteria 1387
116 Ga0068867_100772484 3300005459 Bacteria 854
117 Ga0070685_10396735 3300005466 Bacteria 954
118 Ga0070707_100052251 3300005468 Bacteria 3918
119 Ga0070707_100074613 3300005468 Bacteria 3271
120 Ga0070707_102014512 3300005468 Bacteria 545
121 Ga0070698_100119735 3300005471 Bacteria 2593
122 Ga0070698_100190385 3300005471 Bacteria 1989
123 Ga0070698_100235724 3300005471 Bacteria 1763
124 Ga0070698_100399011 3300005471 Unclassified 1308
125 Ga0070698_101181702 3300005471 Bacteria 714
126 Ga0070698_101327485 3300005471 Bacteria 669
127 Ga0070699_100113259 3300005518 Bacteria 2383
128 Ga0070699_101878236 3300005518 Unclassified 548
129 Ga0070679_100000924 3300005530 Bacteria 25545
130 Ga0070679_100007124 3300005530 Bacteria 10438
131 Ga0070679_100010037 3300005530 Bacteria 8968
132 Ga0070679_100023377 3300005530 Bacteria 6049
133 Ga0070684_100005166 3300005535 Bacteria 9981
134 Ga0070684_100005387 3300005535 Bacteria 9803
135 Ga0070684_100044553 3300005535 Bacteria 3838
136 Ga0070684_100095964 3300005535 Bacteria 2642
137 Ga0070684_100282863 3300005535 Bacteria 1520
138 Ga0070697_100135178 3300005536 Unclassified 2070
139 Ga0070697_100387765 3300005536 Bacteria 1211
140 Ga0068853_100244178 3300005539 Bacteria 1646
141 Ga0070672_100039084 3300005543 Bacteria 3632
142 Ga0070672_100554576 3300005543 Unclassified 998
143 Ga0070672_101966103 3300005543 Unclassified 526
144 Ga0070695_100009930 3300005545 Bacteria 5674
145 Ga0070695_100016981 3300005545 Bacteria 4413
146 Ga0070695_100091297 3300005545 Bacteria 2034
147 Ga0070696_100041120 3300005546 Bacteria 3193
148 Ga0070696_100096187 3300005546 Bacteria 2116
149 Ga0070693_100041763 3300005547 Bacteria 2582
150 Ga0070665_100474274 3300005548 Unclassified 1262
151 Ga0070665_101085792 3300005548 Bacteria 812
152 Ga0070704_100110008 3300005549 Bacteria 2095
153 Ga0070704_101761225 3300005549 Unclassified 573
154 Ga0070704_101956123 3300005549 Unclassified 544
155 Ga0068855_100089330 3300005563 Bacteria 3557
156 Ga0068855_100127202 3300005563 Bacteria 2912
157 Ga0068855_100339396 3300005563 Bacteria 1657
158 Ga0068855_100485257 3300005563 Bacteria 1345
159 Ga0068855_100788143 3300005563 Bacteria 1011
160 Ga0068855_101249569 3300005563 Bacteria 770
161 Ga0070664_100023271 3300005564 Bacteria 5116
162 Ga0070664_100135458 3300005564 Bacteria 2165
163 Ga0068857_100010501 3300005577 Bacteria 8048
164 Ga0068857_100034089 3300005577 Bacteria 4504
165 Ga0068857_100224213 3300005577 Bacteria 1718
166 Ga0068857_100461313 3300005577 Bacteria 1189
167 Ga0068854_100023851 3300005578 Bacteria 4181
168 Ga0068854_100070969 3300005578 Bacteria 2546
169 Ga0068856_100171932 3300005614 Bacteria 2179
170 Ga0068856_100221555 3300005614 Unclassified 1907
171 Ga0068856_100383410 3300005614 Unclassified 1425
172 Ga0068856_100384463 3300005614 Bacteria 1423
173 Ga0068856_100395308 3300005614 Bacteria 1402
174 Ga0068856_100668769 3300005614 Bacteria 1059
175 Ga0070702_100065981 3300005615 Unclassified 2121
176 Ga0070702_101572413 3300005615 Bacteria 543
177 Ga0068852_100202518 3300005616 Bacteria 1879
178 Ga0068852_100296547 3300005616 Bacteria 1563
179 Ga0068852_100721904 3300005616 Bacteria 1007
180 Ga0068852_102535176 3300005616 Bacteria 533
181 Ga0068859_100063067 3300005617 Bacteria 3736
182 Ga0068859_100102931 3300005617 Bacteria 2913
183 Ga0068859_100335684 3300005617 Bacteria 1606
184 Ga0068859_100339909 3300005617 Bacteria 1595
185 Ga0068859_100437093 3300005617 Bacteria 1405
186 Ga0068859_100637673 3300005617 Bacteria 1158
187 Ga0068859_101324515 3300005617 Bacteria 794
188 Ga0068864_100000808 3300005618 Bacteria 26308
189 Ga0068864_100055483 3300005618 Bacteria 3421
190 Ga0068864_100654107 3300005618 Bacteria 1023
191 Ga0068866_10000622 3300005718 Bacteria 16181
192 Ga0068861_100088044 3300005719 Bacteria 2444
193 Ga0068861_101480848 3300005719 Bacteria 665
194 Ga0068851_10039531 3300005834 Bacteria 2369
195 Ga0068870_10006745 3300005840 Bacteria 5086
196 Ga0068870_10008802 3300005840 Bacteria 4553
197 Ga0068870_10040468 3300005840 Bacteria 2417
198 Ga0068870_10242642 3300005840 Bacteria 1113
199 Ga0068863_100824988 3300005841 Bacteria 925
200 Ga0068863_100991921 3300005841 Unclassified 842
201 Ga0068858_100005538 3300005842 Bacteria 12362
202 Ga0068858_100028383 3300005842 Bacteria 5199
203 Ga0068858_100161843 3300005842 Unclassified 2107
204 Ga0068858_100437128 3300005842 Bacteria 1260
205 Ga0068860_100047100 3300005843 Bacteria 4109
206 Ga0068860_100048103 3300005843 Bacteria 4065
207 Ga0068860_100723234 3300005843 Bacteria 1006
208 Ga0068860_102424643 3300005843 Unclassified 545
209 Ga0068862_100081503 3300005844 Bacteria 2807
210 Ga0068862_100154147 3300005844 Bacteria 2047
211 Ga0068862_100159333 3300005844 Bacteria 2014
212 Ga0068862_100216817 3300005844 Bacteria 1731
213 Ga0068862_100746415 3300005844 Bacteria 952
214 Ga0068862_101218614 3300005844 Bacteria 752
215 Ga0068862_102160210 3300005844 Bacteria 568
216 Ga0070717_10009515 3300006028 Bacteria 7309
217 Ga0070715_10202067 3300006163 Bacteria 1010
218 Ga0097621_100083684 3300006237 Unclassified 2659
219 Ga0097621_100151740 3300006237 Bacteria 1987
220 Ga0097621_100168103 3300006237 Bacteria 1889
221 Ga0068871_100163873 3300006358 Bacteria 1902
222 Ga0068871_100164587 3300006358 Unclassified 1898
223 Ga0068871_102145162 3300006358 Bacteria 532
224 Ga0075428_100008283 3300006844 Bacteria 11525
225 Ga0075428_100026824 3300006844 Bacteria 6379
226 Ga0075428_100410673 3300006844 Bacteria 1451
227 Ga0075428_101426050 3300006844 Bacteria 726
228 Ga0075430_100004611 3300006846 Bacteria 11607
229 Ga0075430_100017467 3300006846 Bacteria 6111
230 Ga0075430_100125114 3300006846 Bacteria 2143
231 Ga0075430_100268252 3300006846 Unclassified 1413
232 Ga0075431_100016666 3300006847 Bacteria 7461
233 Ga0075431_100201898 3300006847 Bacteria 2034
234 Ga0075433_10004730 3300006852 Bacteria 10617
235 Ga0075433_10006512 3300006852 Bacteria 9239
236 Ga0075433_10119365 3300006852 Bacteria 2341
237 Ga0075433_10120871 3300006852 Bacteria 2326
238 Ga0075433_10129820 3300006852 Bacteria 2239
239 Ga0075433_10157465 3300006852 Bacteria 2021
240 Ga0075433_10180798 3300006852 Bacteria 1877
241 Ga0075433_10874776 3300006852 Unclassified 784
242 Ga0075434_100003938 3300006871 Bacteria 13303
243 Ga0075434_100015773 3300006871 Bacteria 7252
244 Ga0075434_100041599 3300006871 Bacteria 4553
245 Ga0075434_100054083 3300006871 Bacteria 3988
246 Ga0075434_100484624 3300006871 Unclassified 1258
247 Ga0075434_100585423 3300006871 Bacteria 1135
248 Ga0075434_100701851 3300006871 Bacteria 1029
249 Ga0075434_100745445 3300006871 Bacteria 996
250 Ga0075434_101313221 3300006871 Bacteria 734
251 Ga0075434_101320581 3300006871 Bacteria 732
252 Ga0075434_102333447 3300006871 Bacteria 538
253 Ga0075429_100038955 3300006880 Bacteria 4137
254 Ga0075429_100112926 3300006880 Bacteria 2374
255 Ga0075429_100115857 3300006880 Bacteria 2343
256 Ga0068865_100004039 3300006881 Bacteria 8814
257 Ga0068865_100991361 3300006881 Unclassified 735
258 Ga0075436_100017379 3300006914 Bacteria 4924
259 Ga0075436_100068509 3300006914 Bacteria 2451
260 Ga0075436_100259917 3300006914 Bacteria 1238
261 Ga0097620_100063070 3300006931 Bacteria 3736
262 Ga0097620_100102946 3300006931 Bacteria 2913
263 Ga0097620_100335697 3300006931 Bacteria 1606
264 Ga0097620_100339929 3300006931 Bacteria 1595
265 Ga0097620_100437121 3300006931 Bacteria 1405
266 Ga0097620_100637628 3300006931 Bacteria 1158
267 Ga0097620_101324480 3300006931 Bacteria 794
268 Ga0075435_100114545 3300007076 Bacteria 2244
269 Ga0075435_100496263 3300007076 Bacteria 1055
270 Ga0075435_100938945 3300007076 Bacteria 755
271 Ga0075435_101005875 3300007076 Bacteria 728
272 Ga0099794_10111313 3300007265 Bacteria 1372
273 Ga0105240_10046309 3300009093 Bacteria 5511
274 Ga0105240_10059528 3300009093 Bacteria 4766
275 Ga0105240_10191668 3300009093 Unclassified 2403
276 Ga0105240_10208317 3300009093 Bacteria 2286
277 Ga0105240_10397314 3300009093 Bacteria 1553
278 Ga0105240_11341500 3300009093 Bacteria 753
279 Ga0105240_11516081 3300009093 Bacteria 703
280 Ga0105240_11620829 3300009093 Bacteria 677
281 Ga0111539_10000538 3300009094 Bacteria 48180
282 Ga0111539_10179483 3300009094 Bacteria 2473
283 Ga0111539_11766176 3300009094 Unclassified 717
284 Ga0105245_10229926 3300009098 Unclassified 1793
285 Ga0105245_11116699 3300009098 Bacteria 835
286 Ga0105245_11764017 3300009098 Bacteria 672
287 Ga0105247_10029435 3300009101 Bacteria 3327
288 Ga0105247_10342378 3300009101 Unclassified 1049
289 Ga0114129_10044723 3300009147 Bacteria 6229
290 Ga0114129_10241115 3300009147 Bacteria 2430
291 Ga0114129_10311196 3300009147 Bacteria 2096
292 Ga0114129_10663598 3300009147 Bacteria 1344
293 Ga0114129_12262037 3300009147 Unclassified 653
294 Ga0105243_10146569 3300009148 Unclassified 2020
295 Ga0105243_10211014 3300009148 Bacteria 1710
296 Ga0105243_10538199 3300009148 Bacteria 1114
297 Ga0105241_10015144 3300009174 Bacteria 5648
298 Ga0105241_10341291 3300009174 Bacteria 1298
299 Ga0105241_11412751 3300009174 Bacteria 667
300 Ga0105242_10271682 3300009176 Bacteria 1536
301 Ga0105242_11566824 3300009176 Bacteria 691
302 Ga0105242_13237381 3300009176 Bacteria 506
303 Ga0105248_10015782 3300009177 Bacteria 8325
304 Ga0105248_10048596 3300009177 Bacteria 4759
305 Ga0105248_10358334 3300009177 Bacteria 1642
306 Ga0105248_10596299 3300009177 Bacteria 1247
307 Ga0105248_12247339 3300009177 Unclassified 621
308 Ga0105237_10453565 3300009545 Bacteria 1288
309 Ga0105237_11348473 3300009545 Unclassified 720
310 Ga0105237_11568470 3300009545 Bacteria 665
311 Ga0105237_12164916 3300009545 Unclassified 565
312 Ga0105237_12474661 3300009545 Bacteria 529
313 Ga0105238_10150008 3300009551 Bacteria 2306
314 Ga0105238_10370067 3300009551 Bacteria 1423
315 Ga0105238_11922225 3300009551 Unclassified 625
316 Ga0105249_10086258 3300009553 Bacteria 2927
317 Ga0105249_10117150 3300009553 Bacteria 2526
318 Ga0105249_10209614 3300009553 Unclassified 1912
319 Ga0105249_10316566 3300009553 Unclassified 1570
320 Ga0105249_10737523 3300009553 Bacteria 1047
321 Ga0105249_10801055 3300009553 Bacteria 1006
322 Ga0105249_10903643 3300009553 Bacteria 950
323 Ga0105239_10058947 3300010375 Bacteria 4214
324 Ga0105239_10296177 3300010375 Bacteria 1822
325 Ga0105239_11030392 3300010375 Bacteria 947
326 Ga0105246_10009650 3300011119 Bacteria 5948
327 Ga0105246_10026634 3300011119 Bacteria 3781
328 Ga0105246_10287913 3300011119 Bacteria 1321
329 Ga0105246_10959677 3300011119 Bacteria 771
330 Ga0157373_10006113 3300013100 Bacteria 9002
331 Ga0157373_10008139 3300013100 Bacteria 7798
332 Ga0157373_10592253 3300013100 Unclassified 807
333 Ga0157373_10610590 3300013100 Unclassified 794
334 Ga0157370_10036803 3300013104 Bacteria 4748
335 Ga0157370_10041048 3300013104 Bacteria 4466
336 Ga0157370_10082090 3300013104 Bacteria 3033
337 Ga0157370_10139785 3300013104 Unclassified 2256
338 Ga0157370_10343630 3300013104 Bacteria 1375
339 Ga0157370_10482976 3300013104 Unclassified 1138
340 Ga0157370_10532707 3300013104 Bacteria 1077
341 Ga0157370_11162709 3300013104 Bacteria 697
342 Ga0157369_10021262 3300013105 Bacteria 7257
343 Ga0157369_10022113 3300013105 Bacteria 7104
344 Ga0157369_10120701 3300013105 Unclassified 2782
345 Ga0157369_10262498 3300013105 Bacteria 1801
346 Ga0157369_10300046 3300013105 Bacteria 1671
347 Ga0157369_10371513 3300013105 Bacteria 1484
348 Ga0157369_10410123 3300013105 Bacteria 1405
349 Ga0157369_10600419 3300013105 Bacteria 1136
350 Ga0157369_12311297 3300013105 Unclassified 545
351 Ga0157374_10439314 3300013296 Bacteria 1305
352 Ga0157374_11246992 3300013296 Bacteria 765
353 Ga0157374_12528854 3300013296 Unclassified 541
354 Ga0157378_10032881 3300013297 Unclassified 4584
355 Ga0163162_10036256 3300013306 Bacteria 4914
356 Ga0163162_10102699 3300013306 Unclassified 2953
357 Ga0163162_12402203 3300013306 Unclassified 606
358 Ga0157372_10011579 3300013307 Bacteria 9385
359 Ga0157372_10012424 3300013307 Bacteria 9076
360 Ga0157372_10025733 3300013307 Bacteria 6401
361 Ga0157372_10044399 3300013307 Bacteria 4924
362 Ga0157372_10471837 3300013307 Bacteria 1463
363 Ga0157375_10091378 3300013308 Bacteria 3106
364 Ga0157375_10197222 3300013308 Bacteria 2168
365 Ga0157375_10498405 3300013308 Unclassified 1382
366 Ga0157375_10920548 3300013308 Bacteria 1017
367 Ga0163163_10229071 3300014325 Bacteria 1907
368 Ga0157380_10007796 3300014326 Bacteria 7619
369 Ga0157380_10014458 3300014326 Bacteria 5774
370 Ga0157380_10021654 3300014326 Bacteria 4825
371 Ga0157380_10105668 3300014326 Bacteria 2354
372 Ga0157380_10598207 3300014326 Unclassified 1090
373 Ga0157380_11668258 3300014326 Bacteria 694
374 Ga0182008_10458431 3300014497 Bacteria 694
375 Ga0157377_10260657 3300014745 Bacteria 1128
376 Ga0157379_10028104 3300014968 Bacteria 5006
377 Ga0157379_10067008 3300014968 Bacteria 3210
378 Ga0157376_10277619 3300014969 Bacteria 1577
379 Ga0157376_10428804 3300014969 Bacteria 1285
380 Ga0157376_10491124 3300014969 Bacteria 1205
381 Ga0163161_10005896 3300017792 Bacteria 8498
382 Ga0163161_10079041 3300017792 Bacteria 2418
383 Ga0163161_10715563 3300017792 Unclassified 835
384 Ga0163161_11179949 3300017792 Bacteria 661
385 Ga0206356_10206487 3300020070 Bacteria 1496
386 Ga0206353_10366391 3300020082 Bacteria 1790
387 Ga0213876_10254517 3300021384 Unclassified 933
388 Ga0207697_10001167 3300025315 Bacteria 14410
389 Ga0207656_10027037 3300025321 Bacteria 2344
390 Ga0207656_10028196 3300025321 Bacteria 2303
391 Ga0207653_10000528 3300025885 Bacteria 14414
392 Ga0207653_10039485 3300025885 Bacteria 1545
393 Ga0207653_10261613 3300025885 Unclassified 665
394 Ga0207682_10003279 3300025893 Bacteria 7078
395 Ga0207682_10019128 3300025893 Bacteria 2680
396 Ga0207642_10001495 3300025899 Bacteria 7208
397 Ga0207642_10664893 3300025899 Unclassified 654
398 Ga0207710_10137492 3300025900 Bacteria 1178
399 Ga0207688_10004841 3300025901 Bacteria 7331
400 Ga0207680_10068497 3300025903 Bacteria 2189
401 Ga0207680_10205043 3300025903 Bacteria 1346
402 Ga0207680_10263434 3300025903 Unclassified 1194
403 Ga0207647_10286326 3300025904 Bacteria 940
404 Ga0207685_10163786 3300025905 Unclassified 1017
405 Ga0207699_10021613 3300025906 Bacteria 3471
406 Ga0207699_10602461 3300025906 Bacteria 800
407 Ga0207645_10003863 3300025907 Bacteria 11211
408 Ga0207645_10011601 3300025907 Bacteria 6010
409 Ga0207643_10001455 3300025908 Bacteria 13577
410 Ga0207643_10008047 3300025908 Bacteria 5655
411 Ga0207643_10009672 3300025908 Bacteria 5177
412 Ga0207643_10081260 3300025908 Unclassified 1878
413 Ga0207643_10118306 3300025908 Bacteria 1567
414 Ga0207643_10127074 3300025908 Bacteria 1514
415 Ga0207684_10031113 3300025910 Bacteria 4542
416 Ga0207684_10457109 3300025910 Bacteria 1096
417 Ga0207684_10644718 3300025910 Unclassified 903
418 Ga0207654_10025951 3300025911 Bacteria 3167
419 Ga0207707_10019304 3300025912 Bacteria 5949
420 Ga0207707_10180764 3300025912 Bacteria 1841
421 Ga0207707_10270175 3300025912 Bacteria 1474
422 Ga0207707_10725595 3300025912 Bacteria 833
423 Ga0207707_10728274 3300025912 Bacteria 831
424 Ga0207707_10729336 3300025912 Bacteria 830
425 Ga0207695_10016423 3300025913 Bacteria 8662
426 Ga0207695_10021694 3300025913 Bacteria 7321
427 Ga0207695_10043911 3300025913 Bacteria 4759
428 Ga0207695_10056696 3300025913 Bacteria 4076
429 Ga0207695_10093519 3300025913 Bacteria 3015
430 Ga0207695_10177887 3300025913 Unclassified 2049
431 Ga0207695_10305110 3300025913 Bacteria 1483
432 Ga0207695_10351933 3300025913 Bacteria 1360
433 Ga0207671_10541336 3300025914 Unclassified 928
434 Ga0207671_10682758 3300025914 Bacteria 817
435 Ga0207660_10028143 3300025917 Bacteria 3843
436 Ga0207660_10068958 3300025917 Bacteria 2566
437 Ga0207660_10087225 3300025917 Bacteria 2305
438 Ga0207662_10009327 3300025918 Bacteria 5395
439 Ga0207662_10015377 3300025918 Bacteria 4306
440 Ga0207662_11116726 3300025918 Unclassified 560
441 Ga0207657_10104968 3300025919 Bacteria 2340
442 Ga0207657_10118678 3300025919 Bacteria 2177
443 Ga0207657_10453211 3300025919 Bacteria 1006
444 Ga0207649_10007168 3300025920 Bacteria 6060
445 Ga0207649_10080026 3300025920 Bacteria 2112
446 Ga0207649_10111178 3300025920 Bacteria 1831
447 Ga0207649_10258873 3300025920 Bacteria 1257
448 Ga0207649_10731697 3300025920 Bacteria 769
449 Ga0207652_10007095 3300025921 Bacteria 9027
450 Ga0207652_10177997 3300025921 Bacteria 1910
451 Ga0207652_10841185 3300025921 Bacteria 813
452 Ga0207652_10970579 3300025921 Bacteria 748
453 Ga0207646_10001564 3300025922 Bacteria 28014
454 Ga0207646_10097986 3300025922 Bacteria 2627
455 Ga0207646_11126822 3300025922 Bacteria 690
456 Ga0207646_11663688 3300025922 Unclassified 549
457 Ga0207646_11739667 3300025922 Bacteria 535
458 Ga0207681_10068742 3300025923 Bacteria 2461
459 Ga0207681_10238544 3300025923 Unclassified 1414
460 Ga0207681_10460184 3300025923 Bacteria 1036
461 Ga0207681_10482698 3300025923 Bacteria 1012
462 Ga0207681_10570530 3300025923 Bacteria 933
463 Ga0207681_11292550 3300025923 Unclassified 613
464 Ga0207694_10044734 3300025924 Bacteria 3419
465 Ga0207694_10176592 3300025924 Bacteria 1731
466 Ga0207694_10432399 3300025924 Bacteria 1097
467 Ga0207694_10940635 3300025924 Unclassified 731
468 Ga0207650_10023723 3300025925 Unclassified 4356
469 Ga0207650_10095642 3300025925 Bacteria 2277
470 Ga0207650_10140751 3300025925 Bacteria 1896
471 Ga0207650_10232895 3300025925 Unclassified 1486
472 Ga0207650_10350029 3300025925 Unclassified 1215
473 Ga0207650_10515628 3300025925 Unclassified 1000
474 Ga0207659_10126749 3300025926 Bacteria 1964
475 Ga0207659_10395868 3300025926 Bacteria 1154
476 Ga0207659_10635235 3300025926 Unclassified 912
477 Ga0207687_10604142 3300025927 Bacteria 925
478 Ga0207700_10017897 3300025928 Bacteria 4744
479 Ga0207664_10236792 3300025929 Bacteria 1588
480 Ga0207664_10838424 3300025929 Bacteria 826
481 Ga0207664_10872239 3300025929 Unclassified 809
482 Ga0207644_11353542 3300025931 Unclassified 598
483 Ga0207690_10002601 3300025932 Bacteria 10886
484 Ga0207690_10591278 3300025932 Bacteria 905
485 Ga0207690_10732238 3300025932 Bacteria 814
486 Ga0207690_10976900 3300025932 Unclassified 704
487 Ga0207706_10000218 3300025933 Bacteria 62776
488 Ga0207706_10252509 3300025933 Bacteria 1540
489 Ga0207686_10002437 3300025934 Bacteria 10120
490 Ga0207686_10005688 3300025934 Bacteria 6684
491 Ga0207686_10626626 3300025934 Unclassified 849
492 Ga0207709_10015176 3300025935 Bacteria 4270
493 Ga0207709_10115993 3300025935 Bacteria 1800
494 Ga0207709_10363511 3300025935 Bacteria 1096
495 Ga0207670_10013106 3300025936 Unclassified 4878
496 Ga0207670_10183131 3300025936 Bacteria 1579
497 Ga0207670_10301509 3300025936 Unclassified 1255
498 Ga0207670_10387709 3300025936 Bacteria 1114
499 Ga0207670_10920000 3300025936 Unclassified 733
500 Ga0207669_10000933 3300025937 Bacteria 12357
501 Ga0207669_10041790 3300025937 Unclassified 2671
502 Ga0207669_10727899 3300025937 Unclassified 817
503 Ga0207704_10134275 3300025938 Unclassified 1720
504 Ga0207704_10363145 3300025938 Bacteria 1131
505 Ga0207665_10007638 3300025939 Bacteria 7138
506 Ga0207665_10355486 3300025939 Unclassified 1106
507 Ga0207691_10007060 3300025940 Bacteria 10835
508 Ga0207691_10030230 3300025940 Bacteria 5063
509 Ga0207691_10246920 3300025940 Bacteria 1542
510 Ga0207711_10051808 3300025941 Bacteria 3517
511 Ga0207711_10069994 3300025941 Bacteria 3042
512 Ga0207711_10124465 3300025941 Bacteria 2305
513 Ga0207711_10242612 3300025941 Bacteria 1652
514 Ga0207689_10005269 3300025942 Bacteria 11590
515 Ga0207689_10035162 3300025942 Plasmid 4162
516 Ga0207689_10084992 3300025942 Bacteria 2601
517 Ga0207689_10105432 3300025942 Unclassified 2316
518 Ga0207689_10549402 3300025942 Bacteria 970
519 Ga0207661_10062543 3300025944 Bacteria 3012
520 Ga0207661_10065614 3300025944 Bacteria 2947
521 Ga0207661_10082900 3300025944 Bacteria 2652
522 Ga0207661_10344541 3300025944 Unclassified 1343
523 Ga0207679_10006327 3300025945 Bacteria 7479
524 Ga0207679_10252834 3300025945 Bacteria 1499
525 Ga0207667_10207784 3300025949 Bacteria 2007
526 Ga0207667_10233112 3300025949 Bacteria 1885
527 Ga0207667_10368845 3300025949 Bacteria 1463
528 Ga0207667_10392228 3300025949 Bacteria 1414
529 Ga0207667_10992843 3300025949 Bacteria 827
530 Ga0207651_10014021 3300025960 Bacteria 4612
531 Ga0207712_10000775 3300025961 Bacteria 23829
532 Ga0207712_10002104 3300025961 Bacteria 13034
533 Ga0207712_10015131 3300025961 Bacteria 4972
534 Ga0207712_10062297 3300025961 Bacteria 2651
535 Ga0207712_10239722 3300025961 Bacteria 1460
536 Ga0207712_10294561 3300025961 Unclassified 1329
537 Ga0207712_10305393 3300025961 Bacteria 1308
538 Ga0207712_10625736 3300025961 Bacteria 933
539 Ga0207668_10295135 3300025972 Bacteria 1335
540 Ga0207640_10180218 3300025981 Bacteria 1583
541 Ga0207640_10252595 3300025981 Bacteria 1369
542 Ga0207640_10968394 3300025981 Bacteria 747
543 Ga0207658_10078354 3300025986 Bacteria 2525
544 Ga0207658_10646539 3300025986 Bacteria 953
545 Ga0207658_11204486 3300025986 Bacteria 692
546 Ga0207658_11469967 3300025986 Unclassified 623
547 Ga0207677_10590463 3300026023 Bacteria 973
548 Ga0207677_10843337 3300026023 Bacteria 823
549 Ga0207677_11400862 3300026023 Bacteria 644
550 Ga0207703_10052362 3300026035 Bacteria 3314
551 Ga0207703_10151765 3300026035 Unclassified 2021
552 Ga0207703_10419100 3300026035 Bacteria 1245
553 Ga0207703_10442667 3300026035 Bacteria 1212
554 Ga0207678_10013214 3300026067 Bacteria 7245
555 Ga0207708_10023908 3300026075 Bacteria 4621
556 Ga0207708_10162139 3300026075 Bacteria 1766
557 Ga0207708_10186525 3300026075 Bacteria 1649
558 Ga0207708_10348212 3300026075 Bacteria 1215
559 Ga0207708_10441859 3300026075 Bacteria 1082
560 Ga0207702_10072027 3300026078 Bacteria 2977
561 Ga0207702_10289200 3300026078 Bacteria 1552
562 Ga0207702_10309578 3300026078 Bacteria 1501
563 Ga0207702_10741570 3300026078 Unclassified 969
564 Ga0207702_11370257 3300026078 Bacteria 701
565 Ga0207702_11451523 3300026078 Unclassified 680
566 Ga0207641_10001235 3300026088 Bacteria 25590
567 Ga0207641_10011819 3300026088 Bacteria 7163
568 Ga0207641_10042331 3300026088 Bacteria 3820
569 Ga0207641_10321971 3300026088 Bacteria 1466
570 Ga0207648_10003314 3300026089 Bacteria 16910
571 Ga0207648_10028708 3300026089 Bacteria 4932
572 Ga0207648_10152251 3300026089 Bacteria 2041
573 Ga0207648_11080109 3300026089 Bacteria 752
574 Ga0207648_11166577 3300026089 Unclassified 723
575 Ga0207676_10026480 3300026095 Bacteria 4314
576 Ga0207676_10051603 3300026095 Bacteria 3211
577 Ga0207676_10203391 3300026095 Bacteria 1751
578 Ga0207676_10495504 3300026095 Unclassified 1159
579 Ga0207676_11090265 3300026095 Bacteria 789
580 Ga0207674_10001105 3300026116 Bacteria 35054
581 Ga0207674_10005320 3300026116 Bacteria 15315
582 Ga0207674_10093328 3300026116 Bacteria 2998
583 Ga0207674_10499006 3300026116 Bacteria 1176
584 Ga0207674_10804200 3300026116 Bacteria 907
585 Ga0207674_11218331 3300026116 Unclassified 722
586 Ga0207675_100009956 3300026118 Bacteria 8900
587 Ga0207675_100042433 3300026118 Bacteria 4247
588 Ga0207675_100141120 3300026118 Bacteria 2289
589 Ga0207675_100261617 3300026118 Unclassified 1677
590 Ga0207675_101125594 3300026118 Bacteria 805
591 Ga0207683_10072473 3300026121 Bacteria 3046
592 Ga0207683_10120221 3300026121 Bacteria 2357
593 Ga0207683_10601172 3300026121 Bacteria 1018
594 Ga0207698_10412916 3300026142 Bacteria 1293
595 Ga0207698_10453003 3300026142 Bacteria 1239
596 Ga0207698_11277820 3300026142 Bacteria 748
597 Ga0209588_1025967 3300027671 Bacteria 1857
598 Ga0207428_10000413 3300027907 Bacteria 53087
599 Ga0207428_10046079 3300027907 Bacteria 3508
600 Ga0207428_10432135 3300027907 Bacteria 961
601 Ga0207428_10633861 3300027907 Bacteria 768
602 Ga0268266_11174764 3300028379 Unclassified 742
603 Ga0268266_11189189 3300028379 Bacteria 737
604 Ga0268265_10043935 3300028380 Bacteria 3325
605 Ga0268265_10070052 3300028380 Bacteria 2726
606 Ga0268265_10125984 3300028380 Bacteria 2119
607 Ga0268265_10428404 3300028380 Unclassified 1230
608 Ga0268265_10700909 3300028380 Bacteria 978
609 Ga0268265_10761037 3300028380 Bacteria 941
610 Ga0268264_10025346 3300028381 Bacteria 4845
611 Ga0268264_10281833 3300028381 Bacteria 1557
612 Ga0268264_10742538 3300028381 Bacteria 977
613 Ga0307405_11048789 3300031731 Unclassified 698
614 Ga0307410_10101259 3300031852 Bacteria 2065
615 Ga0307410_11558810 3300031852 Unclassified 583
616 Ga0307407_10567255 3300031903 Bacteria 841
617 Ga0307412_11635896 3300031911 Unclassified 589
618 Ga0307409_100707007 3300031995 Bacteria 1008
619 Ga0307416_100429599 3300032002 Bacteria 1368
620 Ga0307416_101420413 3300032002 Bacteria 800
621 Ga0307416_102338677 3300032002 Unclassified 634
622 Ga0307411_10370259 3300032005 Bacteria 1175
623 Ga0373928_0019043 3300035084 Bacteria 1429
624 Ga0373934_0025992 3300035086 Bacteria 2270
625 Ga0373939_0497241 3300035114 Bacteria 520
626 Ga0373941_0305631 3300035115 Bacteria 636
627 Ga0373945_0306214 3300035116 Bacteria 681
628 Ga0373945_0543322 3300035116 Unclassified 521
629 Ga0373953_0238492 3300035117 Bacteria 789
630 Ga0373943_0230162 3300035170 Unclassified 1035
631 Ga0373943_0245571 3300035170 Bacteria 1004
632 Ga0373955_0073794 3300035172 Bacteria 1913
633 Ga0316574_0087116 3300035398 Bacteria 1988
634 Ga0316574_0139357 3300035398 Bacteria 1562
635 Ga0373927_0033214 3300035695 Bacteria 3359
636 Ga0373933_0155748 3300035724 Unclassified 1449
637 Ga0373947_1062700 3300035725 Unclassified 552
638 Ga0373947_1236113 3300035725 Bacteria 509
639 Ga0373937_0106882 3300036401 Bacteria 2601
640 Ga0373937_0561838 3300036401 Bacteria 1084
641 Ga0316584_0732277 3300036712 Bacteria 676
642 Ga0373925_0008740 3300037068 Bacteria 7378
643 Ga0373925_0092136 3300037068 Bacteria 2318
644 Ga0395905_0171347 3300037471 Bacteria 2039
645 Ga0436365_0615410 3300039437 Unclassified 1030
646 Ga0436365_1265377 3300039437 Unclassified 687
647 Ga0439466_0224634 3300041411 Unclassified 570
648 Ga0451802_1169347 3300041460 Bacteria 536
649 Ga0451853_3447544 3300041512 Bacteria 915
650 Ga0439433_0003604 3300041999 Unclassified 3329
651 Ga0439441_014075 3300042001 Bacteria 1397
652 Ga0439462_0146830 3300042015 Unclassified 662
653 Ga0439434_0087992 3300042435 Bacteria 991
654 Ga0439435_0187600 3300042436 Unclassified 677
655 Ga0439444_0071870 3300042437 Bacteria 742
656 Ga0439464_0180592 3300042439 Bacteria 668
657 Ga0439464_0198468 3300042439 Bacteria 639
658 Ga0439464_0255048 3300042439 Bacteria 567
659 Ga0450918_046349 3300042531 Bacteria 787
660 Ga0450918_125916 3300042531 Bacteria 515
661 Ga0451577_0810891 3300042876 Bacteria 845
662 Ga0453683_0247526 3300044673 Bacteria 1136
663 Ga0453683_0622087 3300044673 Bacteria 705
664 Ga0466963_0037445 3300044694 Bacteria 3168
665 Ga0453684_0540312 3300044712 Bacteria 1285
666 Ga0466957_0110110 3300044842 Bacteria 1746
667 Ga0466957_0123233 3300044842 Bacteria 1654
668 Ga0451576_0012058 3300045051 Bacteria 9756
669 Ga0451576_0174738 3300045051 Unclassified 2242
670 Ga0451576_0240415 3300045051 Bacteria 1891
671 Ga0451576_0408910 3300045051 Unclassified 1423
672 Ga0451576_0484599 3300045051 Bacteria 1299
673 Ga0451576_0722391 3300045051 Bacteria 1046
674 Ga0466967_0084859 3300045976 Bacteria 2866
675 Ga0466967_1059398 3300045976 Bacteria 808
676 Ga0495592_0098553 3300046454 Bacteria 2086
677 Ga0495651_0006446 3300046462 Bacteria 8978
678 Ga0495580_0025669 3300046472 Bacteria 4306
679 Ga0495580_0269569 3300046472 Bacteria 1163
680 Ga0495582_0170945 3300046473 Bacteria 1237
681 Ga0495639_0717609 3300046475 Bacteria 517
682 Ga0495664_0034160 3300046477 Bacteria 2991
683 Ga0495594_0060961 3300046499 Bacteria 2087
684 Ga0495594_0100588 3300046499 Bacteria 1626
685 Ga0495628_0174963 3300046516 Unclassified 1626
686 Ga0495630_0029235 3300046517 Bacteria 4096
687 Ga0495666_0235260 3300046526 Bacteria 837
688 Ga0495652_0018170 3300046529 Bacteria 6275
689 Ga0495665_0680592 3300046531 Bacteria 511
690 Ga0495586_0033992 3300046535 Bacteria 2737
691 Ga0495587_0009958 3300046536 Bacteria 6068
692 Ga0495621_0124207 3300046539 Bacteria 1000
693 Ga0495621_0273706 3300046539 Bacteria 694
694 Ga0495645_0003822 3300046543 Bacteria 10242
695 Ga0495645_0157246 3300046543 Bacteria 1574
696 Ga0495622_0058709 3300046557 Unclassified 1782
697 Ga0495633_0135743 3300046558 Bacteria 1138
698 Ga0495667_0038543 3300046559 Bacteria 3182
699 Ga0495656_0272123 3300046615 Bacteria 861
700 Ga0495634_0732350 3300046642 Bacteria 567
701 Ga0495659_0365017 3300046664 Bacteria 619
702 Ga0495659_0524672 3300046664 Bacteria 521
703 Ga0495657_0335776 3300046675 Bacteria 896
704 Ga0495599_0047894 3300046678 Bacteria 2679
705 Ga0495623_0161334 3300046679 Bacteria 1317
706 Ga0495647_0264227 3300046681 Bacteria 769
707 Ga0495600_0006903 3300046809 Bacteria 6924
708 Ga0495600_0102040 3300046809 Bacteria 1870
709 Ga0495581_0282060 3300047315 Bacteria 971
710 Ga0495604_0575763 3300047317 Bacteria 724
711 Ga0495636_0540280 3300047318 Unclassified 566
712 Ga0495672_0003461 3300047320 Bacteria 13501
713 Ga0495684_0109941 3300047471 Bacteria 2081
714 Ga0495602_0327073 3300048088 Bacteria 1113
715 Ga0496100_1583314 3300048903 Bacteria 518
716 Ga0496102_0576392 3300048905 Bacteria 1048
717 Ga0496103_0619129 3300048906 Bacteria 689
718 Ga0496104_0535311 3300048907 Bacteria 1082
719 Ga0496106_0078456 3300048909 Unclassified 2534
720 Ga0496108_0835643 3300048911 Bacteria 793
721 Ga0496109_1981475 3300048912 Bacteria 514
722 Ga0496114_0309549 3300048917 Unclassified 1395
723 Ga0501032_0535554 3300049569 Bacteria 747
724 Ga0501039_0018331 3300049575 Bacteria 5372
725 Ga0501039_1187743 3300049575 Bacteria 590
726 Ga0501040_0362592 3300049576 Bacteria 1039
727 Ga0501040_1260270 3300049576 Bacteria 536
728 Ga0501042_0067436 3300049578 Unclassified 2558
729 Ga0501042_0362979 3300049578 Unclassified 1048
730 Ga0501043_0020312 3300049579 Bacteria 5211
731 Ga0501046_0684129 3300049580 Unclassified 724
732 Ga0501047_1200178 3300049581 Unclassified 572
733 Ga0501068_0848532 3300049584 Bacteria 600
734 Ga0501071_0065019 3300049587 Unclassified 2648
735 Ga0501071_0288847 3300049587 Bacteria 1242
736 Ga0501072_0185991 3300049588 Bacteria 1657
737 Ga0501074_0354091 3300049590 Unclassified 1042
738 Ga0501074_0644776 3300049590 Bacteria 748
739 Ga0501075_0947351 3300049591 Bacteria 654
740 Ga0501075_1349242 3300049591 Unclassified 540
741 Ga0501076_0174488 3300049592 Unclassified 1752
742 Ga0501076_0354472 3300049592 Unclassified 1205
743 Ga0501076_1290911 3300049592 Unclassified 600
744 Ga0501198_061380 3300049649 Bacteria 691
745 Ga0501235_227979 3300049669 Unclassified 514
746 Ga0501258_040272 3300049687 Bacteria 622
747 Ga0501079_0089327 3300049741 Bacteria 2386
748 Ga0501079_0296192 3300049741 Bacteria 1265
749 Ga0501081_0033223 3300049743 Bacteria 3504
750 Ga0501081_0512572 3300049743 Unclassified 894
751 Ga0501081_0879707 3300049743 Bacteria 675
752 Ga0501081_1191888 3300049743 Unclassified 577
753 Ga0501081_1223252 3300049743 Unclassified 569
754 Ga0501263_050209 3300049760 Bacteria 633
755 Ga0501264_026778 3300049761 Unclassified 643
756 Ga0501035_0114716 3300049822 Bacteria 2359
757 Ga0501044_0190159 3300049823 Bacteria 2016
758 Ga0501045_0060520 3300049824 Bacteria 2776
759 nmdc:mga05p37_1242900_c1 3300050507 Unclassified 765
760 nmdc:mga05p37_209039_c1 3300050507 Bacteria 2360
761 nmdc:mga05p37_358605_c1 3300050507 Bacteria 1715
762 nmdc:mga05p37_869252_c1 3300050507 Unclassified 977
763 nmdc:mga09592_297687_c1 3300050508 Bacteria 1399
764 nmdc:mga09592_37831_c1 3300050508 Bacteria 4049
765 nmdc:mga09592_66660_c1 3300050508 Bacteria 3052
766 nmdc:mga0qj67_1118289_c1 3300050509 Unclassified 615
767 nmdc:mga0qj67_181777_c1 3300050509 Bacteria 1708
768 nmdc:mga0qj67_33516_c1 3300050509 Bacteria 4008
769 nmdc:mga0qj67_400226_c1 3300050509 Unclassified 1108
770 nmdc:mga0qj67_430558_c1 3300050509 Bacteria 1063
771 nmdc:mga0qj67_55384_c1 3300050509 Bacteria 3142
772 nmdc:mga06r32_198310_c1 3300050510 Bacteria 1995
773 nmdc:mga06r32_273347_c1 3300050510 Bacteria 1677
774 nmdc:mga06r32_396366_c1 3300050510 Bacteria 1363
775 nmdc:mga06r32_77335_c1 3300050510 Bacteria 3232
776 nmdc:mga06r32_98488_c1 3300050510 Bacteria 2866
777 nmdc:mga08y16_170117_c1 3300050511 Bacteria 2263
778 nmdc:mga08y16_180873_c1 3300050511 Bacteria 2190
779 nmdc:mga08y16_189372_c1 3300050511 Bacteria 2134
780 nmdc:mga08y16_346951_c1 3300050511 Bacteria 1525
781 nmdc:mga08y16_734048_c1 3300050511 Bacteria 985
782 nmdc:mga08y16_805632_c1 3300050511 Bacteria 932
783 nmdc:mga08y16_8540_c1 3300050511 Bacteria 10729
784 nmdc:mga0n895_126690_c1 3300050512 Unclassified 2577
785 nmdc:mga0n895_1268511_c1 3300050512 Bacteria 709
786 nmdc:mga0n895_139421_c1 3300050512 Bacteria 2453
787 nmdc:mga0n895_18896_c1 3300050512 Bacteria 6391
788 nmdc:mga0n895_2066763_c1 3300050512 Bacteria 527
789 nmdc:mga0n895_26982_c1 3300050512 Bacteria 5449
790 nmdc:mga0n895_323155_c1 3300050512 Bacteria 1564
791 nmdc:mga0n895_3306_c1 3300050512 Bacteria 12944
792 nmdc:mga0n895_429_c1 3300050512 Bacteria 28206
793 nmdc:mga0n895_629469_c1 3300050512 Bacteria 1073
794 nmdc:mga0n895_79585_c1 3300050512 Bacteria 3264
795 nmdc:mga0rr50_564959_c1 3300050513 Bacteria 969
796 nmdc:mga0rr50_82415_c1 3300050513 Bacteria 2484
797 nmdc:mga0rr50_8697_c1 3300050513 Bacteria 6330
798 nmdc:mga08x19_101042_c1 3300050514 Unclassified 1914
799 nmdc:mga08x19_1182136_c1 3300050514 Bacteria 542
800 nmdc:mga08x19_156502_c1 3300050514 Bacteria 1546
801 nmdc:mga08x19_37004_c1 3300050514 Bacteria 3095
802 nmdc:mga0a205_1684_c1 3300050515 Bacteria 19076
803 nmdc:mga0a205_179418_c1 3300050515 Bacteria 2012
804 nmdc:mga0a205_222029_c1 3300050515 Bacteria 1775
805 nmdc:mga0a205_309780_c1 3300050515 Bacteria 1451
806 nmdc:mga0a205_417275_c1 3300050515 Bacteria 1204
807 nmdc:mga0a205_45241_c1 3300050515 Unclassified 4244
808 nmdc:mga0a205_574036_c1 3300050515 Bacteria 982
809 nmdc:mga0a205_5976_c1 3300050515 Bacteria 10970
810 nmdc:mga0a205_5997_c1 3300050515 Bacteria 10955
811 nmdc:mga0a205_700868_c1 3300050515 Bacteria 862
812 nmdc:mga0a205_728372_c1 3300050515 Unclassified 841
813 nmdc:mga0a205_8622_c1 3300050515 Bacteria 9277
814 Ga0495619_0094686 3300053085 Bacteria 2026
815 Ga0500596_069325 3300053735 Unclassified 600
816 Ga0501084_0210398 3300054114 Unclassified 1641
817 Ga0501084_1806343 3300054114 Bacteria 510
818 Ga0501082_0247904 3300060353 Unclassified 1550
819 Ga0501082_1283266 3300060353 Unclassified 640
820 Ga0530510_0195283 3300061734 Unclassified 1503
821 Ga0530510_0308051 3300061734 Bacteria 1186

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10410123 Ga0157369_104101232 122
2 3300049743 Ga0501081_0879707 Ga0501081_0879707_223_639 122
3 3300007076 Ga0075435_100938945 Ga0075435_1009389451 130
4 3300050512 nmdc:mga0n895_2066763_c1 nmdc:mga0n895_2066763_c1_26_433 130
5 3300050515 nmdc:mga0a205_574036_c1 nmdc:mga0a205_574036_c1_161_568 130
6 3300006846 Ga0075430_100125114 Ga0075430_1001251142 131
7 3300042436 Ga0439435_0187600 Ga0439435_0187600_143_547 131
8 3300042439 Ga0439464_0255048 Ga0439464_0255048_103_507 131
9 3300050509 nmdc:mga0qj67_181777_c1 nmdc:mga0qj67_181777_c1_330_734 131
10 3300005290 Ga0065712_10179213 Ga0065712_101792131 132
11 3300005329 Ga0070683_100022077 Ga0070683_1000220776 132
12 3300005331 Ga0070670_100139832 Ga0070670_1001398322 132
13 3300005334 Ga0068869_100642302 Ga0068869_1006423022 132
14 3300005338 Ga0068868_101520780 Ga0068868_1015207801 132
15 3300005364 Ga0070673_100029315 Ga0070673_1000293152 132
16 3300005530 Ga0070679_100000924 Ga0070679_10000092420 132
17 3300005535 Ga0070684_100282863 Ga0070684_1002828632 132
18 3300005564 Ga0070664_100135458 Ga0070664_1001354582 132
19 3300006358 Ga0068871_100163873 Ga0068871_1001638732 132
20 3300006844 Ga0075428_101426050 Ga0075428_1014260502 132
21 3300009094 Ga0111539_11766176 Ga0111539_117661761 132
22 3300025912 Ga0207707_10180764 Ga0207707_101807641 132
23 3300025917 Ga0207660_10068958 Ga0207660_100689584 132
24 3300025921 Ga0207652_10007095 Ga0207652_100070958 132
25 3300025925 Ga0207650_10140751 Ga0207650_101407512 132
26 3300025936 Ga0207670_10301509 Ga0207670_103015092 132
27 3300025938 Ga0207704_10363145 Ga0207704_103631451 132
28 3300025942 Ga0207689_10549402 Ga0207689_105494022 132
29 3300025945 Ga0207679_10252834 Ga0207679_102528342 132
30 3300025986 Ga0207658_10646539 Ga0207658_106465392 132
31 3300026023 Ga0207677_11400862 Ga0207677_114008622 132
32 3300035116 Ga0373945_0543322 Ga0373945_0543322_47_445 132
33 3300035725 Ga0373947_1062700 Ga0373947_1062700_71_469 132
34 3300036401 Ga0373937_0561838 Ga0373937_0561838_478_876 132
35 3300049590 Ga0501074_0354091 Ga0501074_0354091_588_986 132
36 3300049592 Ga0501076_0354472 Ga0501076_0354472_232_630 132
37 3300050507 nmdc:mga05p37_1242900_c1 nmdc:mga05p37_1242900_c1_257_658 132
38 3300050512 nmdc:mga0n895_26982_c1 nmdc:mga0n895_26982_c1_682_1083 132
39 3300050515 nmdc:mga0a205_1684_c1 nmdc:mga0a205_1684_c1_4367_4768 132
40 3300050515 nmdc:mga0a205_700868_c1 nmdc:mga0a205_700868_c1_381_779 132
41 3300060353 Ga0501082_0247904 Ga0501082_0247904_367_765 132
42 3300005336 Ga0070680_100005979 Ga0070680_1000059794 133
43 3300005353 Ga0070669_100195133 Ga0070669_1001951332 133
44 3300005354 Ga0070675_100562422 Ga0070675_1005624222 133
45 3300005440 Ga0070705_101943172 Ga0070705_1019431721 133
46 3300005445 Ga0070708_100002004 Ga0070708_10000200414 133
47 3300005458 Ga0070681_10268187 Ga0070681_102681874 133
48 3300005468 Ga0070707_100074613 Ga0070707_1000746132 133
49 3300005518 Ga0070699_101878236 Ga0070699_1018782361 133
50 3300005530 Ga0070679_100023377 Ga0070679_1000233773 133
51 3300005535 Ga0070684_100044553 Ga0070684_1000445533 133
52 3300005543 Ga0070672_100554576 Ga0070672_1005545762 133
53 3300005563 Ga0068855_100127202 Ga0068855_1001272022 133
54 3300005563 Ga0068855_101249569 Ga0068855_1012495692 133
55 3300005577 Ga0068857_100034089 Ga0068857_1000340892 133
56 3300005577 Ga0068857_100224213 Ga0068857_1002242132 133
57 3300005578 Ga0068854_100023851 Ga0068854_1000238514 133
58 3300005616 Ga0068852_100296547 Ga0068852_1002965472 133
59 3300005616 Ga0068852_100721904 Ga0068852_1007219042 133
60 3300005618 Ga0068864_100000808 Ga0068864_10000080819 133
61 3300005840 Ga0068870_10008802 Ga0068870_100088025 133
62 3300006846 Ga0075430_100268252 Ga0075430_1002682521 133
63 3300006914 Ga0075436_100017379 Ga0075436_1000173795 133
64 3300007076 Ga0075435_100496263 Ga0075435_1004962632 133
65 3300009093 Ga0105240_10397314 Ga0105240_103973141 133
66 3300009093 Ga0105240_11341500 Ga0105240_113415001 133
67 3300009093 Ga0105240_11516081 Ga0105240_115160811 133
68 3300009093 Ga0105240_11620829 Ga0105240_116208292 133
69 3300009174 Ga0105241_10341291 Ga0105241_103412912 133
70 3300009174 Ga0105241_11412751 Ga0105241_114127511 133
71 3300009545 Ga0105237_12164916 Ga0105237_121649161 133
72 3300009545 Ga0105237_12474661 Ga0105237_124746611 133
73 3300009551 Ga0105238_10370067 Ga0105238_103700673 133
74 3300010375 Ga0105239_11030392 Ga0105239_110303922 133
75 3300011119 Ga0105246_10009650 Ga0105246_100096503 133
76 3300013100 Ga0157373_10008139 Ga0157373_100081398 133
77 3300013104 Ga0157370_10082090 Ga0157370_100820905 133
78 3300013104 Ga0157370_10532707 Ga0157370_105327071 133
79 3300013104 Ga0157370_11162709 Ga0157370_111627092 133
80 3300013105 Ga0157369_10300046 Ga0157369_103000462 133
81 3300013307 Ga0157372_10471837 Ga0157372_104718373 133
82 3300013308 Ga0157375_10498405 Ga0157375_104984052 133
83 3300020070 Ga0206356_10206487 Ga0206356_102064873 133
84 3300020082 Ga0206353_10366391 Ga0206353_103663912 133
85 3300021384 Ga0213876_10254517 Ga0213876_102545172 133
86 3300025908 Ga0207643_10008047 Ga0207643_100080476 133
87 3300025910 Ga0207684_10031113 Ga0207684_100311133 133
88 3300025911 Ga0207654_10025951 Ga0207654_100259512 133
89 3300025912 Ga0207707_10270175 Ga0207707_102701751 133
90 3300025912 Ga0207707_10725595 Ga0207707_107255951 133
91 3300025913 Ga0207695_10043911 Ga0207695_100439112 133
92 3300025913 Ga0207695_10056696 Ga0207695_100566963 133
93 3300025913 Ga0207695_10351933 Ga0207695_103519331 133
94 3300025914 Ga0207671_10682758 Ga0207671_106827582 133
95 3300025919 Ga0207657_10118678 Ga0207657_101186782 133
96 3300025920 Ga0207649_10111178 Ga0207649_101111782 133
97 3300025922 Ga0207646_10097986 Ga0207646_100979863 133
98 3300025924 Ga0207694_10432399 Ga0207694_104323991 133
99 3300025925 Ga0207650_10350029 Ga0207650_103500292 133
100 3300025926 Ga0207659_10635235 Ga0207659_106352352 133
101 3300025949 Ga0207667_10992843 Ga0207667_109928432 133
102 3300025981 Ga0207640_10252595 Ga0207640_102525951 133
103 3300026095 Ga0207676_10051603 Ga0207676_100516032 133
104 3300026116 Ga0207674_10005320 Ga0207674_100053202 133
105 3300026116 Ga0207674_10499006 Ga0207674_104990062 133
106 3300026142 Ga0207698_10412916 Ga0207698_104129162 133
107 3300031911 Ga0307412_11635896 Ga0307412_116358961 133
108 3300039437 Ga0436365_0615410 Ga0436365_0615410_288_689 133
109 3300044694 Ga0466963_0037445 Ga0466963_0037445_2218_2622 133
110 3300044842 Ga0466957_0110110 Ga0466957_0110110_1079_1525 133
111 3300044842 Ga0466957_0123233 Ga0466957_0123233_826_1230 133
112 3300045976 Ga0466967_1059398 Ga0466967_1059398_301_711 133
113 3300046472 Ga0495580_0269569 Ga0495580_0269569_99_512 133
114 3300050513 nmdc:mga0rr50_564959_c1 nmdc:mga0rr50_564959_c1_86_487 133
115 3300050514 nmdc:mga08x19_37004_c1 nmdc:mga08x19_37004_c1_310_711 133
116 2162886007 SwRhRL2b_contig_3090340 SwRhRL2b_0837.00003090 134
117 2162886011 MRS1b_contig_7347823 MRS1b_0915.00001840 134
118 3300001977 JGI24746J21847_1005903 JGI24746J21847_10059032 134
119 3300001977 JGI24746J21847_1018795 JGI24746J21847_10187952 134
120 3300002244 JGI24742J22300_10037705 JGI24742J22300_100377051 134
121 3300005289 Ga0065704_10107681 Ga0065704_101076812 134
122 3300005289 Ga0065704_10475771 Ga0065704_104757711 134
123 3300005290 Ga0065712_10309829 Ga0065712_103098292 134
124 3300005293 Ga0065715_10017516 Ga0065715_100175162 134
125 3300005293 Ga0065715_10934425 Ga0065715_109344251 134
126 3300005295 Ga0065707_10085184 Ga0065707_100851842 134
127 3300005295 Ga0065707_10280353 Ga0065707_102803531 134
128 3300005295 Ga0065707_10290541 Ga0065707_102905411 134
129 3300005295 Ga0065707_10953746 Ga0065707_109537461 134
130 3300005327 Ga0070658_10816169 Ga0070658_108161691 134
131 3300005328 Ga0070676_10016381 Ga0070676_100163813 134
132 3300005328 Ga0070676_10044388 Ga0070676_100443881 134
133 3300005328 Ga0070676_11056818 Ga0070676_110568181 134
134 3300005329 Ga0070683_100025311 Ga0070683_1000253113 134
135 3300005329 Ga0070683_100111540 Ga0070683_1001115402 134
136 3300005330 Ga0070690_100023916 Ga0070690_1000239163 134
137 3300005330 Ga0070690_100546691 Ga0070690_1005466912 134
138 3300005331 Ga0070670_100251587 Ga0070670_1002515872 134
139 3300005331 Ga0070670_100718420 Ga0070670_1007184202 134
140 3300005333 Ga0070677_10005078 Ga0070677_100050784 134
141 3300005334 Ga0068869_100050215 Ga0068869_1000502152 134
142 3300005334 Ga0068869_100198356 Ga0068869_1001983563 134
143 3300005335 Ga0070666_10100761 Ga0070666_101007613 134
144 3300005335 Ga0070666_10191581 Ga0070666_101915812 134
145 3300005336 Ga0070680_100100134 Ga0070680_1001001344 134
146 3300005336 Ga0070680_100101289 Ga0070680_1001012892 134
147 3300005337 Ga0070682_100099187 Ga0070682_1000991872 134
148 3300005338 Ga0068868_100034062 Ga0068868_1000340624 134
149 3300005338 Ga0068868_100324062 Ga0068868_1003240622 134
150 3300005339 Ga0070660_100096997 Ga0070660_1000969973 134
151 3300005340 Ga0070689_100072634 Ga0070689_1000726343 134
152 3300005340 Ga0070689_100781988 Ga0070689_1007819882 134
153 3300005341 Ga0070691_10014882 Ga0070691_100148822 134
154 3300005341 Ga0070691_10066612 Ga0070691_100666123 134
155 3300005341 Ga0070691_10234061 Ga0070691_102340612 134
156 3300005343 Ga0070687_100008622 Ga0070687_1000086222 134
157 3300005344 Ga0070661_100007509 Ga0070661_1000075093 134
158 3300005344 Ga0070661_100026282 Ga0070661_1000262823 134
159 3300005344 Ga0070661_100431631 Ga0070661_1004316312 134
160 3300005344 Ga0070661_100941603 Ga0070661_1009416032 134
161 3300005347 Ga0070668_100106234 Ga0070668_1001062342 134
162 3300005347 Ga0070668_100107386 Ga0070668_1001073862 134
163 3300005347 Ga0070668_101042892 Ga0070668_1010428922 134
164 3300005353 Ga0070669_100017310 Ga0070669_1000173101 134
165 3300005353 Ga0070669_100058948 Ga0070669_1000589481 134
166 3300005353 Ga0070669_100309091 Ga0070669_1003090911 134
167 3300005353 Ga0070669_100969604 Ga0070669_1009696042 134
168 3300005353 Ga0070669_101491412 Ga0070669_1014914121 134
169 3300005354 Ga0070675_100869661 Ga0070675_1008696611 134
170 3300005354 Ga0070675_101275816 Ga0070675_1012758162 134
171 3300005355 Ga0070671_100207954 Ga0070671_1002079541 134
172 3300005356 Ga0070674_100004735 Ga0070674_1000047356 134
173 3300005356 Ga0070674_100006894 Ga0070674_1000068947 134
174 3300005356 Ga0070674_100588467 Ga0070674_1005884672 134
175 3300005364 Ga0070673_100100980 Ga0070673_1001009803 134
176 3300005365 Ga0070688_100000962 Ga0070688_10000096216 134
177 3300005365 Ga0070688_100056301 Ga0070688_1000563012 134
178 3300005365 Ga0070688_101035351 Ga0070688_1010353511 134
179 3300005365 Ga0070688_101240837 Ga0070688_1012408372 134
180 3300005366 Ga0070659_100009099 Ga0070659_1000090995 134
181 3300005366 Ga0070659_100345311 Ga0070659_1003453111 134
182 3300005367 Ga0070667_100031981 Ga0070667_1000319812 134
183 3300005367 Ga0070667_101177264 Ga0070667_1011772641 134
184 3300005406 Ga0070703_10058468 Ga0070703_100584682 134
185 3300005406 Ga0070703_10168449 Ga0070703_101684491 134
186 3300005434 Ga0070709_10001469 Ga0070709_1000146914 134
187 3300005434 Ga0070709_10387287 Ga0070709_103872872 134
188 3300005435 Ga0070714_100018344 Ga0070714_1000183443 134
189 3300005435 Ga0070714_100223076 Ga0070714_1002230762 134
190 3300005436 Ga0070713_100001501 Ga0070713_1000015012 134
191 3300005436 Ga0070713_100501893 Ga0070713_1005018932 134
192 3300005438 Ga0070701_10049952 Ga0070701_100499522 134
193 3300005439 Ga0070711_100000395 Ga0070711_10000039523 134
194 3300005439 Ga0070711_100624640 Ga0070711_1006246402 134
195 3300005440 Ga0070705_100007996 Ga0070705_1000079969 134
196 3300005440 Ga0070705_100063806 Ga0070705_1000638063 134
197 3300005440 Ga0070705_100333440 Ga0070705_1003334402 134
198 3300005440 Ga0070705_100701326 Ga0070705_1007013262 134
199 3300005441 Ga0070700_100558259 Ga0070700_1005582592 134
200 3300005444 Ga0070694_100004758 Ga0070694_1000047587 134
201 3300005444 Ga0070694_100181736 Ga0070694_1001817362 134
202 3300005444 Ga0070694_100260372 Ga0070694_1002603723 134
203 3300005444 Ga0070694_100336162 Ga0070694_1003361622 134
204 3300005445 Ga0070708_100970972 Ga0070708_1009709721 134
205 3300005445 Ga0070708_100977370 Ga0070708_1009773702 134
206 3300005445 Ga0070708_101411936 Ga0070708_1014119362 134
207 3300005445 Ga0070708_101544986 Ga0070708_1015449861 134
208 3300005456 Ga0070678_100008983 Ga0070678_1000089832 134
209 3300005456 Ga0070678_100242567 Ga0070678_1002425671 134
210 3300005456 Ga0070678_100886985 Ga0070678_1008869852 134
211 3300005456 Ga0070678_101285479 Ga0070678_1012854792 134
212 3300005457 Ga0070662_100004071 Ga0070662_10000407110 134
213 3300005457 Ga0070662_101510244 Ga0070662_1015102442 134
214 3300005458 Ga0070681_10000857 Ga0070681_100008575 134
215 3300005458 Ga0070681_10002670 Ga0070681_100026701 134
216 3300005458 Ga0070681_10659412 Ga0070681_106594121 134
217 3300005459 Ga0068867_100018446 Ga0068867_1000184465 134
218 3300005459 Ga0068867_100271215 Ga0068867_1002712151 134
219 3300005459 Ga0068867_100772484 Ga0068867_1007724842 134
220 3300005466 Ga0070685_10396735 Ga0070685_103967352 134
221 3300005468 Ga0070707_100052251 Ga0070707_1000522512 134
222 3300005468 Ga0070707_102014512 Ga0070707_1020145121 134
223 3300005471 Ga0070698_100119735 Ga0070698_1001197354 134
224 3300005471 Ga0070698_100190385 Ga0070698_1001903852 134
225 3300005471 Ga0070698_100235724 Ga0070698_1002357244 134
226 3300005471 Ga0070698_100399011 Ga0070698_1003990112 134
227 3300005471 Ga0070698_101181702 Ga0070698_1011817022 134
228 3300005471 Ga0070698_101327485 Ga0070698_1013274851 134
229 3300005518 Ga0070699_100113259 Ga0070699_1001132592 134
230 3300005530 Ga0070679_100007124 Ga0070679_10000712413 134
231 3300005530 Ga0070679_100010037 Ga0070679_1000100379 134
232 3300005535 Ga0070684_100005166 Ga0070684_1000051666 134
233 3300005535 Ga0070684_100005387 Ga0070684_1000053877 134
234 3300005535 Ga0070684_100095964 Ga0070684_1000959643 134
235 3300005536 Ga0070697_100135178 Ga0070697_1001351783 134
236 3300005536 Ga0070697_100387765 Ga0070697_1003877652 134
237 3300005539 Ga0068853_100244178 Ga0068853_1002441783 134
238 3300005543 Ga0070672_100039084 Ga0070672_1000390843 134
239 3300005543 Ga0070672_101966103 Ga0070672_1019661031 134
240 3300005545 Ga0070695_100009930 Ga0070695_1000099305 134
241 3300005545 Ga0070695_100016981 Ga0070695_1000169813 134
242 3300005545 Ga0070695_100091297 Ga0070695_1000912972 134
243 3300005546 Ga0070696_100041120 Ga0070696_1000411204 134
244 3300005546 Ga0070696_100096187 Ga0070696_1000961872 134
245 3300005547 Ga0070693_100041763 Ga0070693_1000417631 134
246 3300005548 Ga0070665_100474274 Ga0070665_1004742742 134
247 3300005548 Ga0070665_101085792 Ga0070665_1010857922 134
248 3300005549 Ga0070704_100110008 Ga0070704_1001100082 134
249 3300005549 Ga0070704_101761225 Ga0070704_1017612251 134
250 3300005549 Ga0070704_101956123 Ga0070704_1019561231 134
251 3300005563 Ga0068855_100089330 Ga0068855_1000893302 134
252 3300005563 Ga0068855_100339396 Ga0068855_1003393962 134
253 3300005563 Ga0068855_100485257 Ga0068855_1004852573 134
254 3300005563 Ga0068855_100788143 Ga0068855_1007881432 134
255 3300005564 Ga0070664_100023271 Ga0070664_1000232715 134
256 3300005577 Ga0068857_100010501 Ga0068857_1000105012 134
257 3300005577 Ga0068857_100461313 Ga0068857_1004613132 134
258 3300005578 Ga0068854_100070969 Ga0068854_1000709692 134
259 3300005614 Ga0068856_100171932 Ga0068856_1001719322 134
260 3300005614 Ga0068856_100221555 Ga0068856_1002215552 134
261 3300005614 Ga0068856_100383410 Ga0068856_1003834101 134
262 3300005614 Ga0068856_100384463 Ga0068856_1003844633 134
263 3300005614 Ga0068856_100395308 Ga0068856_1003953082 134
264 3300005614 Ga0068856_100668769 Ga0068856_1006687692 134
265 3300005615 Ga0070702_100065981 Ga0070702_1000659813 134
266 3300005615 Ga0070702_101572413 Ga0070702_1015724131 134
267 3300005616 Ga0068852_100202518 Ga0068852_1002025183 134
268 3300005616 Ga0068852_102535176 Ga0068852_1025351761 134
269 3300005617 Ga0068859_100063067 Ga0068859_1000630673 134
270 3300005617 Ga0068859_100102931 Ga0068859_1001029314 134
271 3300005617 Ga0068859_100335684 Ga0068859_1003356842 134
272 3300005617 Ga0068859_100339909 Ga0068859_1003399092 134
273 3300005617 Ga0068859_100437093 Ga0068859_1004370933 134
274 3300005617 Ga0068859_100637673 Ga0068859_1006376732 134
275 3300005617 Ga0068859_101324515 Ga0068859_1013245151 134
276 3300005618 Ga0068864_100055483 Ga0068864_1000554835 134
277 3300005618 Ga0068864_100654107 Ga0068864_1006541072 134
278 3300005718 Ga0068866_10000622 Ga0068866_100006227 134
279 3300005719 Ga0068861_100088044 Ga0068861_1000880446 134
280 3300005719 Ga0068861_101480848 Ga0068861_1014808482 134
281 3300005834 Ga0068851_10039531 Ga0068851_100395314 134
282 3300005840 Ga0068870_10006745 Ga0068870_100067452 134
283 3300005840 Ga0068870_10040468 Ga0068870_100404683 134
284 3300005840 Ga0068870_10242642 Ga0068870_102426423 134
285 3300005841 Ga0068863_100824988 Ga0068863_1008249882 134
286 3300005841 Ga0068863_100991921 Ga0068863_1009919211 134
287 3300005842 Ga0068858_100005538 Ga0068858_1000055383 134
288 3300005842 Ga0068858_100028383 Ga0068858_1000283835 134
289 3300005842 Ga0068858_100161843 Ga0068858_1001618432 134
290 3300005842 Ga0068858_100437128 Ga0068858_1004371282 134
291 3300005843 Ga0068860_100047100 Ga0068860_1000471003 134
292 3300005843 Ga0068860_100048103 Ga0068860_1000481032 134
293 3300005843 Ga0068860_100723234 Ga0068860_1007232342 134
294 3300005843 Ga0068860_102424643 Ga0068860_1024246431 134
295 3300005844 Ga0068862_100081503 Ga0068862_1000815032 134
296 3300005844 Ga0068862_100154147 Ga0068862_1001541473 134
297 3300005844 Ga0068862_100159333 Ga0068862_1001593331 134
298 3300005844 Ga0068862_100216817 Ga0068862_1002168172 134
299 3300005844 Ga0068862_100746415 Ga0068862_1007464152 134
300 3300005844 Ga0068862_101218614 Ga0068862_1012186141 134
301 3300005844 Ga0068862_102160210 Ga0068862_1021602101 134
302 3300006028 Ga0070717_10009515 Ga0070717_100095152 134
303 3300006163 Ga0070715_10202067 Ga0070715_102020672 134
304 3300006237 Ga0097621_100083684 Ga0097621_1000836842 134
305 3300006237 Ga0097621_100151740 Ga0097621_1001517402 134
306 3300006237 Ga0097621_100168103 Ga0097621_1001681032 134
307 3300006358 Ga0068871_100164587 Ga0068871_1001645872 134
308 3300006358 Ga0068871_102145162 Ga0068871_1021451621 134
309 3300006844 Ga0075428_100008283 Ga0075428_1000082837 134
310 3300006844 Ga0075428_100026824 Ga0075428_1000268244 134
311 3300006844 Ga0075428_100410673 Ga0075428_1004106732 134
312 3300006846 Ga0075430_100004611 Ga0075430_1000046118 134
313 3300006846 Ga0075430_100017467 Ga0075430_1000174674 134
314 3300006847 Ga0075431_100016666 Ga0075431_1000166668 134
315 3300006847 Ga0075431_100201898 Ga0075431_1002018982 134
316 3300006852 Ga0075433_10004730 Ga0075433_100047303 134
317 3300006852 Ga0075433_10006512 Ga0075433_100065122 134
318 3300006852 Ga0075433_10119365 Ga0075433_101193653 134
319 3300006852 Ga0075433_10120871 Ga0075433_101208712 134
320 3300006852 Ga0075433_10129820 Ga0075433_101298202 134
321 3300006852 Ga0075433_10157465 Ga0075433_101574652 134
322 3300006852 Ga0075433_10180798 Ga0075433_101807982 134
323 3300006852 Ga0075433_10874776 Ga0075433_108747762 134
324 3300006871 Ga0075434_100003938 Ga0075434_1000039387 134
325 3300006871 Ga0075434_100015773 Ga0075434_1000157733 134
326 3300006871 Ga0075434_100041599 Ga0075434_1000415996 134
327 3300006871 Ga0075434_100054083 Ga0075434_1000540833 134
328 3300006871 Ga0075434_100484624 Ga0075434_1004846242 134
329 3300006871 Ga0075434_100585423 Ga0075434_1005854232 134
330 3300006871 Ga0075434_100701851 Ga0075434_1007018512 134
331 3300006871 Ga0075434_100745445 Ga0075434_1007454452 134
332 3300006871 Ga0075434_101313221 Ga0075434_1013132211 134
333 3300006871 Ga0075434_101320581 Ga0075434_1013205812 134
334 3300006871 Ga0075434_102333447 Ga0075434_1023334471 134
335 3300006880 Ga0075429_100038955 Ga0075429_1000389554 134
336 3300006880 Ga0075429_100112926 Ga0075429_1001129262 134
337 3300006880 Ga0075429_100115857 Ga0075429_1001158573 134
338 3300006881 Ga0068865_100004039 Ga0068865_1000040398 134
339 3300006881 Ga0068865_100991361 Ga0068865_1009913612 134
340 3300006914 Ga0075436_100068509 Ga0075436_1000685093 134
341 3300006914 Ga0075436_100259917 Ga0075436_1002599172 134
342 3300006931 Ga0097620_100063070 Ga0097620_1000630703 134
343 3300006931 Ga0097620_100102946 Ga0097620_1001029464 134
344 3300006931 Ga0097620_100335697 Ga0097620_1003356972 134
345 3300006931 Ga0097620_100339929 Ga0097620_1003399292 134
346 3300006931 Ga0097620_100437121 Ga0097620_1004371213 134
347 3300006931 Ga0097620_100637628 Ga0097620_1006376282 134
348 3300006931 Ga0097620_101324480 Ga0097620_1013244801 134
349 3300007076 Ga0075435_100114545 Ga0075435_1001145454 134
350 3300007076 Ga0075435_101005875 Ga0075435_1010058752 134
351 3300007265 Ga0099794_10111313 Ga0099794_101113132 134
352 3300009093 Ga0105240_10046309 Ga0105240_100463092 134
353 3300009093 Ga0105240_10059528 Ga0105240_100595282 134
354 3300009093 Ga0105240_10191668 Ga0105240_101916683 134
355 3300009093 Ga0105240_10208317 Ga0105240_102083172 134
356 3300009094 Ga0111539_10000538 Ga0111539_1000053840 134
357 3300009094 Ga0111539_10179483 Ga0111539_101794831 134
358 3300009098 Ga0105245_10229926 Ga0105245_102299262 134
359 3300009098 Ga0105245_11116699 Ga0105245_111166992 134
360 3300009098 Ga0105245_11764017 Ga0105245_117640172 134
361 3300009101 Ga0105247_10029435 Ga0105247_100294354 134
362 3300009101 Ga0105247_10342378 Ga0105247_103423782 134
363 3300009147 Ga0114129_10044723 Ga0114129_100447234 134
364 3300009147 Ga0114129_10241115 Ga0114129_102411152 134
365 3300009147 Ga0114129_10311196 Ga0114129_103111962 134
366 3300009147 Ga0114129_10663598 Ga0114129_106635981 134
367 3300009147 Ga0114129_12262037 Ga0114129_122620371 134
368 3300009148 Ga0105243_10146569 Ga0105243_101465692 134
369 3300009148 Ga0105243_10211014 Ga0105243_102110142 134
370 3300009148 Ga0105243_10538199 Ga0105243_105381991 134
371 3300009174 Ga0105241_10015144 Ga0105241_1001514410 134
372 3300009176 Ga0105242_10271682 Ga0105242_102716822 134
373 3300009176 Ga0105242_11566824 Ga0105242_115668241 134
374 3300009176 Ga0105242_13237381 Ga0105242_132373811 134
375 3300009177 Ga0105248_10015782 Ga0105248_100157828 134
376 3300009177 Ga0105248_10048596 Ga0105248_100485962 134
377 3300009177 Ga0105248_10358334 Ga0105248_103583342 134
378 3300009177 Ga0105248_10596299 Ga0105248_105962992 134
379 3300009177 Ga0105248_12247339 Ga0105248_122473391 134
380 3300009545 Ga0105237_10453565 Ga0105237_104535652 134
381 3300009545 Ga0105237_11348473 Ga0105237_113484732 134
382 3300009545 Ga0105237_11568470 Ga0105237_115684701 134
383 3300009551 Ga0105238_10150008 Ga0105238_101500082 134
384 3300009551 Ga0105238_11922225 Ga0105238_119222252 134
385 3300009553 Ga0105249_10086258 Ga0105249_100862583 134
386 3300009553 Ga0105249_10117150 Ga0105249_101171502 134
387 3300009553 Ga0105249_10209614 Ga0105249_102096142 134
388 3300009553 Ga0105249_10316566 Ga0105249_103165662 134
389 3300009553 Ga0105249_10737523 Ga0105249_107375231 134
390 3300009553 Ga0105249_10801055 Ga0105249_108010551 134
391 3300009553 Ga0105249_10903643 Ga0105249_109036433 134
392 3300010375 Ga0105239_10058947 Ga0105239_100589472 134
393 3300010375 Ga0105239_10296177 Ga0105239_102961772 134
394 3300011119 Ga0105246_10026634 Ga0105246_100266343 134
395 3300011119 Ga0105246_10287913 Ga0105246_102879132 134
396 3300011119 Ga0105246_10959677 Ga0105246_109596772 134
397 3300013100 Ga0157373_10006113 Ga0157373_1000611314 134
398 3300013100 Ga0157373_10592253 Ga0157373_105922532 134
399 3300013100 Ga0157373_10610590 Ga0157373_106105902 134
400 3300013104 Ga0157370_10036803 Ga0157370_100368032 134
401 3300013104 Ga0157370_10041048 Ga0157370_100410486 134
402 3300013104 Ga0157370_10139785 Ga0157370_101397852 134
403 3300013104 Ga0157370_10343630 Ga0157370_103436302 134
404 3300013104 Ga0157370_10482976 Ga0157370_104829761 134
405 3300013105 Ga0157369_10021262 Ga0157369_100212623 134
406 3300013105 Ga0157369_10022113 Ga0157369_100221138 134
407 3300013105 Ga0157369_10120701 Ga0157369_101207012 134
408 3300013105 Ga0157369_10262498 Ga0157369_102624983 134
409 3300013105 Ga0157369_10371513 Ga0157369_103715132 134
410 3300013105 Ga0157369_10600419 Ga0157369_106004191 134
411 3300013105 Ga0157369_12311297 Ga0157369_123112971 134
412 3300013296 Ga0157374_10439314 Ga0157374_104393142 134
413 3300013296 Ga0157374_11246992 Ga0157374_112469921 134
414 3300013296 Ga0157374_12528854 Ga0157374_125288541 134
415 3300013297 Ga0157378_10032881 Ga0157378_100328812 134
416 3300013306 Ga0163162_10036256 Ga0163162_100362562 134
417 3300013306 Ga0163162_10102699 Ga0163162_101026992 134
418 3300013306 Ga0163162_12402203 Ga0163162_124022031 134
419 3300013307 Ga0157372_10011579 Ga0157372_100115797 134
420 3300013307 Ga0157372_10012424 Ga0157372_100124245 134
421 3300013307 Ga0157372_10025733 Ga0157372_100257332 134
422 3300013307 Ga0157372_10044399 Ga0157372_1004439910 134
423 3300013308 Ga0157375_10091378 Ga0157375_100913782 134
424 3300013308 Ga0157375_10197222 Ga0157375_101972225 134
425 3300013308 Ga0157375_10920548 Ga0157375_109205482 134
426 3300014325 Ga0163163_10229071 Ga0163163_102290711 134
427 3300014326 Ga0157380_10007796 Ga0157380_100077964 134
428 3300014326 Ga0157380_10014458 Ga0157380_100144585 134
429 3300014326 Ga0157380_10021654 Ga0157380_100216544 134
430 3300014326 Ga0157380_10105668 Ga0157380_101056681 134
431 3300014326 Ga0157380_10598207 Ga0157380_105982072 134
432 3300014326 Ga0157380_11668258 Ga0157380_116682582 134
433 3300014497 Ga0182008_10458431 Ga0182008_104584311 134
434 3300014745 Ga0157377_10260657 Ga0157377_102606572 134
435 3300014968 Ga0157379_10028104 Ga0157379_100281047 134
436 3300014968 Ga0157379_10067008 Ga0157379_100670082 134
437 3300014969 Ga0157376_10277619 Ga0157376_102776192 134
438 3300014969 Ga0157376_10428804 Ga0157376_104288042 134
439 3300014969 Ga0157376_10491124 Ga0157376_104911241 134
440 3300017792 Ga0163161_10005896 Ga0163161_1000589615 134
441 3300017792 Ga0163161_10079041 Ga0163161_100790413 134
442 3300017792 Ga0163161_10715563 Ga0163161_107155631 134
443 3300017792 Ga0163161_11179949 Ga0163161_111799491 134
444 3300025315 Ga0207697_10001167 Ga0207697_1000116710 134
445 3300025321 Ga0207656_10027037 Ga0207656_100270373 134
446 3300025321 Ga0207656_10028196 Ga0207656_100281964 134
447 3300025885 Ga0207653_10000528 Ga0207653_100005284 134
448 3300025885 Ga0207653_10039485 Ga0207653_100394852 134
449 3300025885 Ga0207653_10261613 Ga0207653_102616132 134
450 3300025893 Ga0207682_10003279 Ga0207682_100032793 134
451 3300025893 Ga0207682_10019128 Ga0207682_100191284 134
452 3300025899 Ga0207642_10001495 Ga0207642_100014956 134
453 3300025899 Ga0207642_10664893 Ga0207642_106648931 134
454 3300025900 Ga0207710_10137492 Ga0207710_101374922 134
455 3300025901 Ga0207688_10004841 Ga0207688_100048416 134
456 3300025903 Ga0207680_10068497 Ga0207680_100684973 134
457 3300025903 Ga0207680_10205043 Ga0207680_102050432 134
458 3300025903 Ga0207680_10263434 Ga0207680_102634342 134
459 3300025904 Ga0207647_10286326 Ga0207647_102863261 134
460 3300025905 Ga0207685_10163786 Ga0207685_101637862 134
461 3300025906 Ga0207699_10021613 Ga0207699_100216134 134
462 3300025906 Ga0207699_10602461 Ga0207699_106024612 134
463 3300025907 Ga0207645_10003863 Ga0207645_100038632 134
464 3300025907 Ga0207645_10011601 Ga0207645_100116015 134
465 3300025908 Ga0207643_10001455 Ga0207643_100014554 134
466 3300025908 Ga0207643_10009672 Ga0207643_100096725 134
467 3300025908 Ga0207643_10081260 Ga0207643_100812603 134
468 3300025908 Ga0207643_10118306 Ga0207643_101183063 134
469 3300025908 Ga0207643_10127074 Ga0207643_101270741 134
470 3300025910 Ga0207684_10457109 Ga0207684_104571092 134
471 3300025910 Ga0207684_10644718 Ga0207684_106447182 134
472 3300025912 Ga0207707_10019304 Ga0207707_100193042 134
473 3300025912 Ga0207707_10728274 Ga0207707_107282741 134
474 3300025912 Ga0207707_10729336 Ga0207707_107293362 134
475 3300025913 Ga0207695_10016423 Ga0207695_1001642310 134
476 3300025913 Ga0207695_10021694 Ga0207695_100216942 134
477 3300025913 Ga0207695_10093519 Ga0207695_100935191 134
478 3300025913 Ga0207695_10177887 Ga0207695_101778873 134
479 3300025913 Ga0207695_10305110 Ga0207695_103051102 134
480 3300025914 Ga0207671_10541336 Ga0207671_105413362 134
481 3300025917 Ga0207660_10028143 Ga0207660_100281432 134
482 3300025917 Ga0207660_10087225 Ga0207660_100872252 134
483 3300025918 Ga0207662_10009327 Ga0207662_100093275 134
484 3300025918 Ga0207662_10015377 Ga0207662_100153774 134
485 3300025918 Ga0207662_11116726 Ga0207662_111167262 134
486 3300025919 Ga0207657_10104968 Ga0207657_101049683 134
487 3300025919 Ga0207657_10453211 Ga0207657_104532111 134
488 3300025920 Ga0207649_10007168 Ga0207649_100071685 134
489 3300025920 Ga0207649_10080026 Ga0207649_100800262 134
490 3300025920 Ga0207649_10258873 Ga0207649_102588731 134
491 3300025920 Ga0207649_10731697 Ga0207649_107316972 134
492 3300025921 Ga0207652_10177997 Ga0207652_101779972 134
493 3300025921 Ga0207652_10841185 Ga0207652_108411852 134
494 3300025921 Ga0207652_10970579 Ga0207652_109705791 134
495 3300025922 Ga0207646_10001564 Ga0207646_1000156410 134
496 3300025922 Ga0207646_11126822 Ga0207646_111268221 134
497 3300025922 Ga0207646_11663688 Ga0207646_116636882 134
498 3300025922 Ga0207646_11739667 Ga0207646_117396671 134
499 3300025923 Ga0207681_10068742 Ga0207681_100687422 134
500 3300025923 Ga0207681_10238544 Ga0207681_102385441 134
501 3300025923 Ga0207681_10460184 Ga0207681_104601841 134
502 3300025923 Ga0207681_10482698 Ga0207681_104826983 134
503 3300025923 Ga0207681_10570530 Ga0207681_105705301 134
504 3300025923 Ga0207681_11292550 Ga0207681_112925501 134
505 3300025924 Ga0207694_10044734 Ga0207694_100447343 134
506 3300025924 Ga0207694_10176592 Ga0207694_101765922 134
507 3300025924 Ga0207694_10940635 Ga0207694_109406352 134
508 3300025925 Ga0207650_10023723 Ga0207650_100237233 134
509 3300025925 Ga0207650_10095642 Ga0207650_100956422 134
510 3300025925 Ga0207650_10232895 Ga0207650_102328953 134
511 3300025925 Ga0207650_10515628 Ga0207650_105156281 134
512 3300025926 Ga0207659_10126749 Ga0207659_101267491 134
513 3300025926 Ga0207659_10395868 Ga0207659_103958682 134
514 3300025927 Ga0207687_10604142 Ga0207687_106041421 134
515 3300025928 Ga0207700_10017897 Ga0207700_100178972 134
516 3300025929 Ga0207664_10236792 Ga0207664_102367922 134
517 3300025929 Ga0207664_10838424 Ga0207664_108384242 134
518 3300025929 Ga0207664_10872239 Ga0207664_108722392 134
519 3300025931 Ga0207644_11353542 Ga0207644_113535422 134
520 3300025932 Ga0207690_10002601 Ga0207690_100026018 134
521 3300025932 Ga0207690_10591278 Ga0207690_105912781 134
522 3300025932 Ga0207690_10732238 Ga0207690_107322382 134
523 3300025932 Ga0207690_10976900 Ga0207690_109769001 134
524 3300025933 Ga0207706_10000218 Ga0207706_1000021811 134
525 3300025933 Ga0207706_10252509 Ga0207706_102525092 134
526 3300025934 Ga0207686_10002437 Ga0207686_100024376 134
527 3300025934 Ga0207686_10005688 Ga0207686_100056886 134
528 3300025934 Ga0207686_10626626 Ga0207686_106266261 134
529 3300025935 Ga0207709_10015176 Ga0207709_100151761 134
530 3300025935 Ga0207709_10115993 Ga0207709_101159932 134
531 3300025935 Ga0207709_10363511 Ga0207709_103635112 134
532 3300025936 Ga0207670_10013106 Ga0207670_100131065 134
533 3300025936 Ga0207670_10183131 Ga0207670_101831313 134
534 3300025936 Ga0207670_10387709 Ga0207670_103877092 134
535 3300025936 Ga0207670_10920000 Ga0207670_109200001 134
536 3300025937 Ga0207669_10000933 Ga0207669_100009332 134
537 3300025937 Ga0207669_10041790 Ga0207669_100417902 134
538 3300025937 Ga0207669_10727899 Ga0207669_107278992 134
539 3300025938 Ga0207704_10134275 Ga0207704_101342752 134
540 3300025939 Ga0207665_10007638 Ga0207665_100076385 134
541 3300025939 Ga0207665_10355486 Ga0207665_103554861 134
542 3300025940 Ga0207691_10007060 Ga0207691_100070608 134
543 3300025940 Ga0207691_10030230 Ga0207691_100302303 134
544 3300025940 Ga0207691_10246920 Ga0207691_102469202 134
545 3300025941 Ga0207711_10051808 Ga0207711_100518081 134
546 3300025941 Ga0207711_10069994 Ga0207711_100699948 134
547 3300025941 Ga0207711_10124465 Ga0207711_101244653 134
548 3300025941 Ga0207711_10242612 Ga0207711_102426122 134
549 3300025942 Ga0207689_10005269 Ga0207689_100052692 134
550 3300025942 Ga0207689_10035162 Ga0207689_100351622 134
551 3300025942 Ga0207689_10084992 Ga0207689_100849923 134
552 3300025942 Ga0207689_10105432 Ga0207689_101054324 134
553 3300025944 Ga0207661_10062543 Ga0207661_100625433 134
554 3300025944 Ga0207661_10065614 Ga0207661_100656143 134
555 3300025944 Ga0207661_10082900 Ga0207661_100829003 134
556 3300025944 Ga0207661_10344541 Ga0207661_103445412 134
557 3300025945 Ga0207679_10006327 Ga0207679_100063275 134
558 3300025949 Ga0207667_10207784 Ga0207667_102077842 134
559 3300025949 Ga0207667_10233112 Ga0207667_102331122 134
560 3300025949 Ga0207667_10368845 Ga0207667_103688452 134
561 3300025949 Ga0207667_10392228 Ga0207667_103922282 134
562 3300025960 Ga0207651_10014021 Ga0207651_100140213 134
563 3300025961 Ga0207712_10000775 Ga0207712_100007759 134
564 3300025961 Ga0207712_10002104 Ga0207712_100021047 134
565 3300025961 Ga0207712_10015131 Ga0207712_100151312 134
566 3300025961 Ga0207712_10062297 Ga0207712_100622975 134
567 3300025961 Ga0207712_10239722 Ga0207712_102397222 134
568 3300025961 Ga0207712_10294561 Ga0207712_102945612 134
569 3300025961 Ga0207712_10305393 Ga0207712_103053932 134
570 3300025961 Ga0207712_10625736 Ga0207712_106257361 134
571 3300025972 Ga0207668_10295135 Ga0207668_102951353 134
572 3300025981 Ga0207640_10180218 Ga0207640_101802182 134
573 3300025981 Ga0207640_10968394 Ga0207640_109683941 134
574 3300025986 Ga0207658_10078354 Ga0207658_100783543 134
575 3300025986 Ga0207658_11204486 Ga0207658_112044861 134
576 3300025986 Ga0207658_11469967 Ga0207658_114699671 134
577 3300026023 Ga0207677_10590463 Ga0207677_105904631 134
578 3300026023 Ga0207677_10843337 Ga0207677_108433372 134
579 3300026035 Ga0207703_10052362 Ga0207703_100523623 134
580 3300026035 Ga0207703_10151765 Ga0207703_101517654 134
581 3300026035 Ga0207703_10419100 Ga0207703_104191001 134
582 3300026035 Ga0207703_10442667 Ga0207703_104426673 134
583 3300026067 Ga0207678_10013214 Ga0207678_100132144 134
584 3300026075 Ga0207708_10023908 Ga0207708_100239082 134
585 3300026075 Ga0207708_10162139 Ga0207708_101621392 134
586 3300026075 Ga0207708_10186525 Ga0207708_101865252 134
587 3300026075 Ga0207708_10348212 Ga0207708_103482122 134
588 3300026075 Ga0207708_10441859 Ga0207708_104418591 134
589 3300026078 Ga0207702_10072027 Ga0207702_100720273 134
590 3300026078 Ga0207702_10289200 Ga0207702_102892001 134
591 3300026078 Ga0207702_10309578 Ga0207702_103095782 134
592 3300026078 Ga0207702_10741570 Ga0207702_107415702 134
593 3300026078 Ga0207702_11370257 Ga0207702_113702571 134
594 3300026078 Ga0207702_11451523 Ga0207702_114515232 134
595 3300026088 Ga0207641_10001235 Ga0207641_100012357 134
596 3300026088 Ga0207641_10011819 Ga0207641_100118193 134
597 3300026088 Ga0207641_10042331 Ga0207641_100423312 134
598 3300026088 Ga0207641_10321971 Ga0207641_103219713 134
599 3300026089 Ga0207648_10003314 Ga0207648_100033148 134
600 3300026089 Ga0207648_10028708 Ga0207648_100287081 134
601 3300026089 Ga0207648_10152251 Ga0207648_101522513 134
602 3300026089 Ga0207648_11080109 Ga0207648_110801091 134
603 3300026089 Ga0207648_11166577 Ga0207648_111665772 134
604 3300026095 Ga0207676_10026480 Ga0207676_100264802 134
605 3300026095 Ga0207676_10203391 Ga0207676_102033912 134
606 3300026095 Ga0207676_10495504 Ga0207676_104955042 134
607 3300026095 Ga0207676_11090265 Ga0207676_110902651 134
608 3300026116 Ga0207674_10001105 Ga0207674_1000110518 134
609 3300026116 Ga0207674_10093328 Ga0207674_100933284 134
610 3300026116 Ga0207674_10804200 Ga0207674_108042002 134
611 3300026116 Ga0207674_11218331 Ga0207674_112183312 134
612 3300026118 Ga0207675_100009956 Ga0207675_1000099563 134
613 3300026118 Ga0207675_100042433 Ga0207675_1000424335 134
614 3300026118 Ga0207675_100141120 Ga0207675_1001411202 134
615 3300026118 Ga0207675_100261617 Ga0207675_1002616171 134
616 3300026118 Ga0207675_101125594 Ga0207675_1011255941 134
617 3300026121 Ga0207683_10072473 Ga0207683_100724732 134
618 3300026121 Ga0207683_10120221 Ga0207683_101202215 134
619 3300026121 Ga0207683_10601172 Ga0207683_106011721 134
620 3300026142 Ga0207698_10453003 Ga0207698_104530031 134
621 3300026142 Ga0207698_11277820 Ga0207698_112778201 134
622 3300027671 Ga0209588_1025967 Ga0209588_10259672 134
623 3300027907 Ga0207428_10000413 Ga0207428_1000041342 134
624 3300027907 Ga0207428_10046079 Ga0207428_100460793 134
625 3300027907 Ga0207428_10432135 Ga0207428_104321352 134
626 3300027907 Ga0207428_10633861 Ga0207428_106338611 134
627 3300028379 Ga0268266_11174764 Ga0268266_111747641 134
628 3300028379 Ga0268266_11189189 Ga0268266_111891891 134
629 3300028380 Ga0268265_10043935 Ga0268265_100439354 134
630 3300028380 Ga0268265_10070052 Ga0268265_100700522 134
631 3300028380 Ga0268265_10125984 Ga0268265_101259842 134
632 3300028380 Ga0268265_10428404 Ga0268265_104284041 134
633 3300028380 Ga0268265_10700909 Ga0268265_107009092 134
634 3300028380 Ga0268265_10761037 Ga0268265_107610372 134
635 3300028381 Ga0268264_10025346 Ga0268264_100253464 134
636 3300028381 Ga0268264_10281833 Ga0268264_102818333 134
637 3300028381 Ga0268264_10742538 Ga0268264_107425382 134
638 3300031731 Ga0307405_11048789 Ga0307405_110487891 134
639 3300031852 Ga0307410_10101259 Ga0307410_101012591 134
640 3300031852 Ga0307410_11558810 Ga0307410_115588101 134
641 3300031903 Ga0307407_10567255 Ga0307407_105672552 134
642 3300031995 Ga0307409_100707007 Ga0307409_1007070071 134
643 3300032002 Ga0307416_100429599 Ga0307416_1004295992 134
644 3300032002 Ga0307416_101420413 Ga0307416_1014204132 134
645 3300032002 Ga0307416_102338677 Ga0307416_1023386771 134
646 3300032005 Ga0307411_10370259 Ga0307411_103702592 134
647 3300035084 Ga0373928_0019043 Ga0373928_0019043_690_1100 134
648 3300035086 Ga0373934_0025992 Ga0373934_0025992_1213_1620 134
649 3300035114 Ga0373939_0497241 Ga0373939_0497241_37_447 134
650 3300035115 Ga0373941_0305631 Ga0373941_0305631_133_543 134
651 3300035116 Ga0373945_0306214 Ga0373945_0306214_239_643 134
652 3300035117 Ga0373953_0238492 Ga0373953_0238492_109_516 134
653 3300035170 Ga0373943_0230162 Ga0373943_0230162_119_541 134
654 3300035170 Ga0373943_0245571 Ga0373943_0245571_442_846 134
655 3300035172 Ga0373955_0073794 Ga0373955_0073794_799_1206 134
656 3300035398 Ga0316574_0087116 Ga0316574_0087116_1263_1673 134
657 3300035398 Ga0316574_0139357 Ga0316574_0139357_464_871 134
658 3300035695 Ga0373927_0033214 Ga0373927_0033214_2484_2888 134
659 3300035724 Ga0373933_0155748 Ga0373933_0155748_755_1162 134
660 3300035725 Ga0373947_1236113 Ga0373947_1236113_14_418 134
661 3300036401 Ga0373937_0106882 Ga0373937_0106882_1895_2302 134
662 3300036712 Ga0316584_0732277 Ga0316584_0732277_38_445 134
663 3300037068 Ga0373925_0008740 Ga0373925_0008740_2078_2482 134
664 3300037068 Ga0373925_0092136 Ga0373925_0092136_1567_1971 134
665 3300037471 Ga0395905_0171347 Ga0395905_0171347_1292_1705 134
666 3300039437 Ga0436365_1265377 Ga0436365_1265377_256_663 134
667 3300041411 Ga0439466_0224634 Ga0439466_0224634_84_488 134
668 3300041460 Ga0451802_1169347 Ga0451802_1169347_108_515 134
669 3300041512 Ga0451853_3447544 Ga0451853_3447544_146_562 134
670 3300041999 Ga0439433_0003604 Ga0439433_0003604_564_989 134
671 3300042001 Ga0439441_014075 Ga0439441_014075_882_1289 134
672 3300042015 Ga0439462_0146830 Ga0439462_0146830_68_472 134
673 3300042435 Ga0439434_0087992 Ga0439434_0087992_459_863 134
674 3300042437 Ga0439444_0071870 Ga0439444_0071870_291_701 134
675 3300042439 Ga0439464_0180592 Ga0439464_0180592_111_524 134
676 3300042439 Ga0439464_0198468 Ga0439464_0198468_140_550 134
677 3300042531 Ga0450918_046349 Ga0450918_046349_251_658 134
678 3300042531 Ga0450918_125916 Ga0450918_125916_78_482 134
679 3300042876 Ga0451577_0810891 Ga0451577_0810891_410_814 134
680 3300044673 Ga0453683_0247526 Ga0453683_0247526_63_467 134
681 3300044673 Ga0453683_0622087 Ga0453683_0622087_106_516 134
682 3300044712 Ga0453684_0540312 Ga0453684_0540312_71_475 134
683 3300045051 Ga0451576_0012058 Ga0451576_0012058_7454_7861 134
684 3300045051 Ga0451576_0174738 Ga0451576_0174738_1280_1684 134
685 3300045051 Ga0451576_0240415 Ga0451576_0240415_1092_1502 134
686 3300045051 Ga0451576_0408910 Ga0451576_0408910_448_870 134
687 3300045051 Ga0451576_0484599 Ga0451576_0484599_287_691 134
688 3300045051 Ga0451576_0722391 Ga0451576_0722391_177_587 134
689 3300045976 Ga0466967_0084859 Ga0466967_0084859_2350_2754 134
690 3300046454 Ga0495592_0098553 Ga0495592_0098553_1570_1977 134
691 3300046462 Ga0495651_0006446 Ga0495651_0006446_5314_5721 134
692 3300046472 Ga0495580_0025669 Ga0495580_0025669_505_909 134
693 3300046473 Ga0495582_0170945 Ga0495582_0170945_75_479 134
694 3300046475 Ga0495639_0717609 Ga0495639_0717609_102_506 134
695 3300046477 Ga0495664_0034160 Ga0495664_0034160_1249_1656 134
696 3300046499 Ga0495594_0060961 Ga0495594_0060961_183_587 134
697 3300046499 Ga0495594_0100588 Ga0495594_0100588_149_565 134
698 3300046516 Ga0495628_0174963 Ga0495628_0174963_11_418 134
699 3300046517 Ga0495630_0029235 Ga0495630_0029235_47_451 134
700 3300046526 Ga0495666_0235260 Ga0495666_0235260_348_752 134
701 3300046529 Ga0495652_0018170 Ga0495652_0018170_1414_1821 134
702 3300046531 Ga0495665_0680592 Ga0495665_0680592_15_422 134
703 3300046535 Ga0495586_0033992 Ga0495586_0033992_1013_1420 134
704 3300046536 Ga0495587_0009958 Ga0495587_0009958_5196_5603 134
705 3300046539 Ga0495621_0124207 Ga0495621_0124207_498_905 134
706 3300046539 Ga0495621_0273706 Ga0495621_0273706_180_587 134
707 3300046543 Ga0495645_0003822 Ga0495645_0003822_6453_6860 134
708 3300046543 Ga0495645_0157246 Ga0495645_0157246_507_938 134
709 3300046557 Ga0495622_0058709 Ga0495622_0058709_396_812 134
710 3300046558 Ga0495633_0135743 Ga0495633_0135743_37_459 134
711 3300046559 Ga0495667_0038543 Ga0495667_0038543_1136_1543 134
712 3300046615 Ga0495656_0272123 Ga0495656_0272123_48_455 134
713 3300046642 Ga0495634_0732350 Ga0495634_0732350_46_453 134
714 3300046664 Ga0495659_0365017 Ga0495659_0365017_84_488 134
715 3300046664 Ga0495659_0524672 Ga0495659_0524672_13_420 134
716 3300046675 Ga0495657_0335776 Ga0495657_0335776_152_559 134
717 3300046678 Ga0495599_0047894 Ga0495599_0047894_332_739 134
718 3300046679 Ga0495623_0161334 Ga0495623_0161334_808_1215 134
719 3300046681 Ga0495647_0264227 Ga0495647_0264227_168_575 134
720 3300046809 Ga0495600_0006903 Ga0495600_0006903_458_865 134
721 3300046809 Ga0495600_0102040 Ga0495600_0102040_885_1289 134
722 3300047315 Ga0495581_0282060 Ga0495581_0282060_193_615 134
723 3300047317 Ga0495604_0575763 Ga0495604_0575763_205_612 134
724 3300047318 Ga0495636_0540280 Ga0495636_0540280_38_469 134
725 3300047320 Ga0495672_0003461 Ga0495672_0003461_253_660 134
726 3300047471 Ga0495684_0109941 Ga0495684_0109941_108_512 134
727 3300048088 Ga0495602_0327073 Ga0495602_0327073_122_529 134
728 3300048903 Ga0496100_1583314 Ga0496100_1583314_36_440 134
729 3300048905 Ga0496102_0576392 Ga0496102_0576392_165_569 134
730 3300048906 Ga0496103_0619129 Ga0496103_0619129_240_644 134
731 3300048907 Ga0496104_0535311 Ga0496104_0535311_24_428 134
732 3300048909 Ga0496106_0078456 Ga0496106_0078456_68_472 134
733 3300048911 Ga0496108_0835643 Ga0496108_0835643_143_547 134
734 3300048912 Ga0496109_1981475 Ga0496109_1981475_66_476 134
735 3300048917 Ga0496114_0309549 Ga0496114_0309549_458_862 134
736 3300049569 Ga0501032_0535554 Ga0501032_0535554_24_428 134
737 3300049575 Ga0501039_0018331 Ga0501039_0018331_164_568 134
738 3300049575 Ga0501039_1187743 Ga0501039_1187743_17_430 134
739 3300049576 Ga0501040_0362592 Ga0501040_0362592_524_940 134
740 3300049576 Ga0501040_1260270 Ga0501040_1260270_79_483 134
741 3300049578 Ga0501042_0067436 Ga0501042_0067436_1588_1992 134
742 3300049578 Ga0501042_0362979 Ga0501042_0362979_88_492 134
743 3300049579 Ga0501043_0020312 Ga0501043_0020312_1427_1849 134
744 3300049580 Ga0501046_0684129 Ga0501046_0684129_13_423 134
745 3300049581 Ga0501047_1200178 Ga0501047_1200178_28_450 134
746 3300049584 Ga0501068_0848532 Ga0501068_0848532_41_466 134
747 3300049587 Ga0501071_0065019 Ga0501071_0065019_154_582 134
748 3300049587 Ga0501071_0288847 Ga0501071_0288847_76_480 134
749 3300049588 Ga0501072_0185991 Ga0501072_0185991_43_447 134
750 3300049590 Ga0501074_0644776 Ga0501074_0644776_117_521 134
751 3300049591 Ga0501075_0947351 Ga0501075_0947351_216_620 134
752 3300049591 Ga0501075_1349242 Ga0501075_1349242_112_519 134
753 3300049592 Ga0501076_0174488 Ga0501076_0174488_1110_1514 134
754 3300049592 Ga0501076_1290911 Ga0501076_1290911_17_427 134
755 3300049649 Ga0501198_061380 Ga0501198_061380_78_488 134
756 3300049669 Ga0501235_227979 Ga0501235_227979_16_429 134
757 3300049687 Ga0501258_040272 Ga0501258_040272_185_595 134
758 3300049741 Ga0501079_0089327 Ga0501079_0089327_737_1141 134
759 3300049741 Ga0501079_0296192 Ga0501079_0296192_11_439 134
760 3300049743 Ga0501081_0033223 Ga0501081_0033223_1912_2340 134
761 3300049743 Ga0501081_0512572 Ga0501081_0512572_270_722 134
762 3300049743 Ga0501081_1191888 Ga0501081_1191888_94_504 134
763 3300049743 Ga0501081_1223252 Ga0501081_1223252_38_445 134
764 3300049760 Ga0501263_050209 Ga0501263_050209_32_442 134
765 3300049761 Ga0501264_026778 Ga0501264_026778_160_570 134
766 3300049822 Ga0501035_0114716 Ga0501035_0114716_684_1106 134
767 3300049823 Ga0501044_0190159 Ga0501044_0190159_366_788 134
768 3300049824 Ga0501045_0060520 Ga0501045_0060520_153_557 134
769 3300050507 nmdc:mga05p37_209039_c1 nmdc:mga05p37_209039_c1_502_906 134
770 3300050507 nmdc:mga05p37_358605_c1 nmdc:mga05p37_358605_c1_358_771 134
771 3300050507 nmdc:mga05p37_869252_c1 nmdc:mga05p37_869252_c1_419_829 134
772 3300050508 nmdc:mga09592_297687_c1 nmdc:mga09592_297687_c1_148_561 134
773 3300050508 nmdc:mga09592_37831_c1 nmdc:mga09592_37831_c1_3591_3998 134
774 3300050508 nmdc:mga09592_66660_c1 nmdc:mga09592_66660_c1_50_463 134
775 3300050509 nmdc:mga0qj67_1118289_c1 nmdc:mga0qj67_1118289_c1_143_550 134
776 3300050509 nmdc:mga0qj67_33516_c1 nmdc:mga0qj67_33516_c1_3419_3832 134
777 3300050509 nmdc:mga0qj67_400226_c1 nmdc:mga0qj67_400226_c1_654_1064 134
778 3300050509 nmdc:mga0qj67_430558_c1 nmdc:mga0qj67_430558_c1_449_856 134
779 3300050509 nmdc:mga0qj67_55384_c1 nmdc:mga0qj67_55384_c1_543_947 134
780 3300050510 nmdc:mga06r32_198310_c1 nmdc:mga06r32_198310_c1_670_1074 134
781 3300050510 nmdc:mga06r32_273347_c1 nmdc:mga06r32_273347_c1_1162_1569 134
782 3300050510 nmdc:mga06r32_396366_c1 nmdc:mga06r32_396366_c1_493_906 134
783 3300050510 nmdc:mga06r32_77335_c1 nmdc:mga06r32_77335_c1_2064_2477 134
784 3300050510 nmdc:mga06r32_98488_c1 nmdc:mga06r32_98488_c1_1701_2129 134
785 3300050511 nmdc:mga08y16_170117_c1 nmdc:mga08y16_170117_c1_919_1326 134
786 3300050511 nmdc:mga08y16_180873_c1 nmdc:mga08y16_180873_c1_1343_1753 134
787 3300050511 nmdc:mga08y16_189372_c1 nmdc:mga08y16_189372_c1_771_1178 134
788 3300050511 nmdc:mga08y16_346951_c1 nmdc:mga08y16_346951_c1_1042_1449 134
789 3300050511 nmdc:mga08y16_734048_c1 nmdc:mga08y16_734048_c1_48_455 134
790 3300050511 nmdc:mga08y16_805632_c1 nmdc:mga08y16_805632_c1_137_550 134
791 3300050511 nmdc:mga08y16_8540_c1 nmdc:mga08y16_8540_c1_6392_6805 134
792 3300050512 nmdc:mga0n895_126690_c1 nmdc:mga0n895_126690_c1_240_644 134
793 3300050512 nmdc:mga0n895_1268511_c1 nmdc:mga0n895_1268511_c1_172_579 134
794 3300050512 nmdc:mga0n895_139421_c1 nmdc:mga0n895_139421_c1_1821_2240 134
795 3300050512 nmdc:mga0n895_18896_c1 nmdc:mga0n895_18896_c1_5234_5644 134
796 3300050512 nmdc:mga0n895_323155_c1 nmdc:mga0n895_323155_c1_991_1401 134
797 3300050512 nmdc:mga0n895_3306_c1 nmdc:mga0n895_3306_c1_3344_3754 134
798 3300050512 nmdc:mga0n895_429_c1 nmdc:mga0n895_429_c1_26645_27055 134
799 3300050512 nmdc:mga0n895_629469_c1 nmdc:mga0n895_629469_c1_266_703 134
800 3300050512 nmdc:mga0n895_79585_c1 nmdc:mga0n895_79585_c1_28_525 134
801 3300050513 nmdc:mga0rr50_82415_c1 nmdc:mga0rr50_82415_c1_1979_2389 134
802 3300050513 nmdc:mga0rr50_8697_c1 nmdc:mga0rr50_8697_c1_350_760 134
803 3300050514 nmdc:mga08x19_101042_c1 nmdc:mga08x19_101042_c1_133_543 134
804 3300050514 nmdc:mga08x19_1182136_c1 nmdc:mga08x19_1182136_c1_15_428 134
805 3300050514 nmdc:mga08x19_156502_c1 nmdc:mga08x19_156502_c1_728_1135 134
806 3300050515 nmdc:mga0a205_179418_c1 nmdc:mga0a205_179418_c1_573_986 134
807 3300050515 nmdc:mga0a205_222029_c1 nmdc:mga0a205_222029_c1_432_842 134
808 3300050515 nmdc:mga0a205_309780_c1 nmdc:mga0a205_309780_c1_499_903 134
809 3300050515 nmdc:mga0a205_417275_c1 nmdc:mga0a205_417275_c1_707_1117 134
810 3300050515 nmdc:mga0a205_45241_c1 nmdc:mga0a205_45241_c1_2985_3389 134
811 3300050515 nmdc:mga0a205_5976_c1 nmdc:mga0a205_5976_c1_5291_5701 134
812 3300050515 nmdc:mga0a205_5997_c1 nmdc:mga0a205_5997_c1_3858_4268 134
813 3300050515 nmdc:mga0a205_728372_c1 nmdc:mga0a205_728372_c1_179_592 134
814 3300050515 nmdc:mga0a205_8622_c1 nmdc:mga0a205_8622_c1_2253_2663 134
815 3300053085 Ga0495619_0094686 Ga0495619_0094686_215_622 134
816 3300053735 Ga0500596_069325 Ga0500596_069325_109_513 134
817 3300054114 Ga0501084_0210398 Ga0501084_0210398_349_777 134
818 3300054114 Ga0501084_1806343 Ga0501084_1806343_59_472 134
819 3300060353 Ga0501082_1283266 Ga0501082_1283266_95_511 134
820 3300061734 Ga0530510_0195283 Ga0530510_0195283_229_642 134
821 3300061734 Ga0530510_0308051 Ga0530510_0308051_615_1022 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

6

123

0.91

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

10

127

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.95 2 131
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.9364 1 131
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9294 2 131
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.9254 2 133
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8994 2 133
ID Description Score Start End Superfamily
af_A0A2R8QPM6_23_166_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.965 1 132 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.95 2 131 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9364 1 131 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9294 2 131 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9254 2 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V7K448-F1-model_v4 Acyl dehydratase 1 3 134 GO:0006633
GO:0019171
AF-A0A2V6SY34-F1-model_v4 MaoC-like domain-containing protein 0.9935 3 134 GO:0006633
GO:0019171
AF-A0A2V6TUC0-F1-model_v4 Acyl dehydratase 0.9928 4 134 GO:0006633
GO:0019171
AF-A0A524J3D7-F1-model_v4 MaoC family dehydratase 0.9924 3 134 GO:0006633
GO:0019171
AF-A0A2V2SHK0-F1-model_v4 deleted 0.9912 3 134

Feature Viewer

pLDDT pTM Quality
97.05 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map