F482279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 627 | 1642 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_012026|Ga0500643_012026_1703_2788 |
| Length | 361 |
| Sequence | MVIFAKLFGGLRTKRQAGTVFPELPSICLQVPIRLGLAAQLRYLPGWYRQINNRVGAGPREVTPMTSVSFDKLDGFIWMNGEFVKWADAKIHVLTHGLHYASAVFEGERAYGGEIFKLTEHTERLHESARILGFKIPYSVEEIDDACRTLLKKQGFKDAYVRPIAWRGSEQMGVSAQNNRINCAVAIWQWPSYFDPAQKLKGIRLDIAEYRRPDPRTAPSKSKAAGLYMICTISKHAAEAKGYADALMYDWREQVAEATGANVFFVKDGKIHTPKPDCFLDGITRRTAIDLAKRRGIEVIERAIMPEELEGFEQCFLTGTAAEVTPVSEIGPYKFTVGKIAETLMNDYSAEVQPKHAIAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 70 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 71 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 111 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 135 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 136 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 137 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 138 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 139 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 140 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 141 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 142 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 143 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 144 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 145 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 195 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 196 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 197 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 198 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 199 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 200 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 201 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 202 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 203 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 222 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 228 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 229 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 230 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 231 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 232 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 233 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 234 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 237 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 239 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 244 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 245 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 246 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 247 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 248 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 249 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 250 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 251 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 252 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 253 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 254 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 255 | 2512875024 | |||
| 256 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 257 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 258 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 259 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 260 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 261 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 262 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 263 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 264 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 265 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 266 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 267 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 268 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 269 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 270 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 271 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 272 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 273 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 274 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 275 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 276 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 277 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 278 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 279 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 280 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 281 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 282 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 283 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 284 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 285 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 286 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 287 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 288 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 289 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 290 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 291 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 292 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 293 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 294 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 295 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 296 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 297 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 298 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 299 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 300 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 301 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 302 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 303 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 304 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 305 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 306 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 307 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 308 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 309 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 310 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 311 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 312 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 313 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 314 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 315 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 316 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 317 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 318 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 319 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 320 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 321 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 322 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 323 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 324 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 325 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 326 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 327 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 328 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 329 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 330 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 331 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 332 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 333 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 334 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 335 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 336 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 337 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 338 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 339 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 340 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 341 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 342 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 343 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 344 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 345 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 346 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 347 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 348 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 349 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 350 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 351 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 352 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 353 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 354 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 355 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 356 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 357 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 358 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 359 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 360 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 361 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 362 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 363 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 364 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 365 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 366 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 367 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 368 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 369 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 370 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 371 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 372 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 373 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 374 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 375 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 376 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 377 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 378 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 379 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 380 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 381 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 382 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 383 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 384 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 385 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 386 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 387 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 388 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 389 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 390 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 391 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 392 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 393 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 394 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 395 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 396 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 397 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 398 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 399 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 400 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 401 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 402 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 403 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 404 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 405 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 406 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 407 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 408 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 409 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 410 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 411 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 412 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 413 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 414 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 415 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 416 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 417 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 418 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 419 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 420 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 421 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 422 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 423 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 424 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 425 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 426 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 427 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 428 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 429 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 430 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 431 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 432 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 433 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 434 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 435 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 436 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 437 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 438 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 439 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 440 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 441 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 442 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 443 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 444 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 445 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 446 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 447 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 448 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 449 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 450 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 451 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 452 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 453 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 454 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 455 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 456 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 457 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 458 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 459 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 460 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 461 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 462 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 463 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 464 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 465 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 466 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 467 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 468 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 469 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 470 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 471 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 472 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 473 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 474 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 475 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 476 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 477 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 478 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 479 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 480 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 481 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 482 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 483 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 484 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 485 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 486 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 487 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 488 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 489 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 490 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 491 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 492 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 493 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 494 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 495 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 496 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 497 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 498 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 499 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 500 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 501 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 502 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 503 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 504 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 505 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 506 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 507 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 508 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 509 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 510 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 511 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 512 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 513 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 514 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 515 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 516 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 517 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 518 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 519 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 520 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 521 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 522 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 523 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 524 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 525 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 526 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 527 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 528 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 529 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 530 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 531 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 532 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 533 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 534 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 535 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 536 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 537 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 538 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 539 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 540 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 541 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 542 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 543 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 544 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 545 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 546 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 547 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 548 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 549 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 550 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 551 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 552 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 553 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 554 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 555 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 556 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 557 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 558 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 559 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 560 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 561 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 562 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 563 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 564 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 565 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 566 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 567 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 568 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 569 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 570 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 571 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 572 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 573 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 574 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 575 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 576 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 577 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 578 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 579 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 580 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 581 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 582 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 583 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 584 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 585 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 586 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 587 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 588 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 589 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 590 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 591 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 592 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 593 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 594 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 595 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 596 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 597 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 598 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 599 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 600 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 601 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 602 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 603 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 604 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 605 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 606 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 607 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 608 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 609 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 610 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 611 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 612 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 613 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 614 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 615 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 616 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 617 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 618 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 619 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 620 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 621 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 622 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 623 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 624 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 625 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 626 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 627 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.5 |
| Metatranscriptomes | 0.49 |
| Isolates | 47.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.62 |
| Nodule | 31.67 |
| Rhizoplane | 2.8 |
| Rhizosphere | 40.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500643_012026 | 3300053087 | Bacteria | 3119 |
| 2 | JGI25158J39367_1002269 | 3300002739 | Bacteria | 3181 |
| 3 | JGI25157J39369_1000755 | 3300002741 | Bacteria | 16931 |
| 4 | JGI25159J45721_1000004 | 3300002987 | Bacteria | 215789 |
| 5 | JGI25159J45721_1000877 | 3300002987 | Bacteria | 13071 |
| 6 | JGI25151J46595_10031663 | 3300003187 | Bacteria | 2062 |
| 7 | JGI25406J46586_10043244 | 3300003203 | Bacteria | 1570 |
| 8 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 9 | JGI25160J50197_1000021 | 3300003354 | Bacteria | 215789 |
| 10 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 11 | JGI25161J50226_1000218 | 3300003374 | Bacteria | 36216 |
| 12 | Ga0055529_1007706 | 3300003763 | Bacteria | 1455 |
| 13 | Ga0055526_1001649 | 3300003771 | Bacteria | 15665 |
| 14 | Ga0055526_1008803 | 3300003771 | Bacteria | 4965 |
| 15 | Ga0055524_1002001 | 3300003775 | Bacteria | 10883 |
| 16 | Ga0055524_1012328 | 3300003775 | Bacteria | 3284 |
| 17 | Ga0055536_1000269 | 3300003781 | Bacteria | 39889 |
| 18 | Ga0055530_10007403 | 3300003791 | Bacteria | 4633 |
| 19 | Ga0055540_1028635 | 3300003792 | Bacteria | 1315 |
| 20 | Ga0055531_10045958 | 3300003794 | Bacteria | 1205 |
| 21 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 22 | Ga0055543_1000164 | 3300004625 | Bacteria | 55304 |
| 23 | Ga0058862_12092097 | 3300004803 | Bacteria | 1137 |
| 24 | Ga0065165_1000033 | 3300005262 | Bacteria | 215827 |
| 25 | Ga0070658_10003684 | 3300005327 | Bacteria | 12537 |
| 26 | Ga0070658_10062316 | 3300005327 | Bacteria | 3039 |
| 27 | Ga0070658_10505614 | 3300005327 | Bacteria | 1044 |
| 28 | Ga0070680_100114357 | 3300005336 | Bacteria | 2248 |
| 29 | Ga0070682_100133534 | 3300005337 | Bacteria | 1683 |
| 30 | Ga0070660_100045115 | 3300005339 | Bacteria | 3373 |
| 31 | Ga0070660_100082638 | 3300005339 | Bacteria | 2522 |
| 32 | Ga0070691_10003400 | 3300005341 | Bacteria | 7154 |
| 33 | Ga0070661_100000441 | 3300005344 | Bacteria | 31826 |
| 34 | Ga0070668_100310689 | 3300005347 | Bacteria | 1324 |
| 35 | Ga0070674_100154839 | 3300005356 | Bacteria | 1733 |
| 36 | Ga0070659_100036819 | 3300005366 | Bacteria | 3815 |
| 37 | Ga0070667_100214422 | 3300005367 | Bacteria | 1712 |
| 38 | Ga0070663_100025697 | 3300005455 | Bacteria | 3979 |
| 39 | Ga0070681_10081574 | 3300005458 | Bacteria | 3190 |
| 40 | Ga0068867_100089377 | 3300005459 | Bacteria | 2336 |
| 41 | Ga0068853_100013522 | 3300005539 | Bacteria | 6667 |
| 42 | Ga0068853_100253604 | 3300005539 | Bacteria | 1615 |
| 43 | Ga0070665_100142655 | 3300005548 | Bacteria | 2398 |
| 44 | Ga0070665_100259649 | 3300005548 | Bacteria | 1738 |
| 45 | Ga0068855_100013981 | 3300005563 | Bacteria | 9677 |
| 46 | Ga0068857_100082668 | 3300005577 | Bacteria | 2869 |
| 47 | Ga0068854_100178894 | 3300005578 | Bacteria | 1656 |
| 48 | Ga0068856_100257097 | 3300005614 | Bacteria | 1762 |
| 49 | Ga0068852_100026482 | 3300005616 | Bacteria | 4714 |
| 50 | Ga0081455_10238712 | 3300005937 | Bacteria | 1337 |
| 51 | Ga0081540_1033222 | 3300005983 | Bacteria | 2805 |
| 52 | Ga0081539_10000991 | 3300005985 | Bacteria | 52737 |
| 53 | Ga0075365_10005021 | 3300006038 | Bacteria | 7093 |
| 54 | Ga0075365_10009125 | 3300006038 | Bacteria | 5680 |
| 55 | Ga0075365_10023064 | 3300006038 | Bacteria | 3909 |
| 56 | Ga0075365_10027527 | 3300006038 | Bacteria | 3619 |
| 57 | Ga0075365_10050322 | 3300006038 | Bacteria | 2748 |
| 58 | Ga0075365_10065433 | 3300006038 | Bacteria | 2436 |
| 59 | Ga0075368_10084191 | 3300006042 | Bacteria | 1296 |
| 60 | Ga0075364_10004345 | 3300006051 | Bacteria | 8133 |
| 61 | Ga0075364_10025915 | 3300006051 | Bacteria | 3736 |
| 62 | Ga0075364_10037873 | 3300006051 | Bacteria | 3124 |
| 63 | Ga0075362_10028402 | 3300006177 | Bacteria | 2402 |
| 64 | Ga0075367_10000307 | 3300006178 | Bacteria | 17312 |
| 65 | Ga0075369_10091584 | 3300006186 | Bacteria | 1357 |
| 66 | Ga0075366_10162675 | 3300006195 | Bacteria | 1352 |
| 67 | Ga0075370_10017438 | 3300006353 | Bacteria | 3880 |
| 68 | Ga0075370_10135090 | 3300006353 | Bacteria | 1441 |
| 69 | Ga0105240_10002462 | 3300009093 | Bacteria | 29759 |
| 70 | Ga0105240_10078667 | 3300009093 | Bacteria | 4060 |
| 71 | Ga0105240_10207364 | 3300009093 | Bacteria | 2293 |
| 72 | Ga0105240_10478269 | 3300009093 | Bacteria | 1389 |
| 73 | Ga0105240_10608489 | 3300009093 | Bacteria | 1202 |
| 74 | Ga0105243_10087363 | 3300009148 | Bacteria | 2559 |
| 75 | Ga0105237_10003177 | 3300009545 | Bacteria | 19715 |
| 76 | Ga0105237_10306985 | 3300009545 | Bacteria | 1590 |
| 77 | Ga0105238_10012189 | 3300009551 | Bacteria | 8665 |
| 78 | Ga0105238_10094938 | 3300009551 | Bacteria | 2970 |
| 79 | Ga0105239_10202768 | 3300010375 | Bacteria | 2222 |
| 80 | Ga0105239_10501933 | 3300010375 | Bacteria | 1379 |
| 81 | Ga0157373_10032787 | 3300013100 | Bacteria | 3738 |
| 82 | Ga0157371_10119488 | 3300013102 | Bacteria | 1873 |
| 83 | Ga0157370_10005189 | 3300013104 | Bacteria | 14674 |
| 84 | Ga0157370_10135644 | 3300013104 | Bacteria | 2294 |
| 85 | Ga0157369_10047367 | 3300013105 | Bacteria | 4668 |
| 86 | Ga0157369_10576446 | 3300013105 | Bacteria | 1162 |
| 87 | Ga0171463_1017 | 3300013249 | Bacteria | 48649 |
| 88 | Ga0157372_10039780 | 3300013307 | Bacteria | 5190 |
| 89 | Ga0157372_10417303 | 3300013307 | Bacteria | 1564 |
| 90 | Ga0157375_10564256 | 3300013308 | Bacteria | 1299 |
| 91 | Ga0163163_10022780 | 3300014325 | Bacteria | 5936 |
| 92 | Ga0157379_10003397 | 3300014968 | Bacteria | 13466 |
| 93 | Ga0182006_1017059 | 3300015261 | Bacteria | 3091 |
| 94 | Ga0182007_10036984 | 3300015262 | Bacteria | 1640 |
| 95 | Ga0182005_1006094 | 3300015265 | Bacteria | 3715 |
| 96 | Ga0183363_1050 | 3300015690 | Bacteria | 38817 |
| 97 | Ga0163161_10327398 | 3300017792 | Bacteria | 1213 |
| 98 | Ga0213874_10005742 | 3300021377 | Bacteria | 2906 |
| 99 | Ga0213876_10000410 | 3300021384 | Bacteria | 35997 |
| 100 | Ga0213876_10003699 | 3300021384 | Bacteria | 8674 |
| 101 | Ga0209436_100276 | 3300025208 | Bacteria | 23572 |
| 102 | Ga0209436_105791 | 3300025208 | Bacteria | 2790 |
| 103 | Ga0207425_1020966 | 3300025245 | Bacteria | 1390 |
| 104 | Ga0209026_1000089 | 3300025250 | Bacteria | 175907 |
| 105 | Ga0209148_1000124 | 3300025254 | Bacteria | 185123 |
| 106 | Ga0209759_1000903 | 3300025256 | Bacteria | 22112 |
| 107 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 108 | Ga0209455_1000062 | 3300025272 | Bacteria | 335169 |
| 109 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 110 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 111 | Ga0209130_1005979 | 3300025284 | Bacteria | 4064 |
| 112 | Ga0209676_1000876 | 3300025292 | Bacteria | 38530 |
| 113 | Ga0209025_1000161 | 3300025294 | Bacteria | 166506 |
| 114 | Ga0209025_1000171 | 3300025294 | Bacteria | 160478 |
| 115 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 116 | Ga0209758_1023159 | 3300025297 | Bacteria | 2818 |
| 117 | Ga0209050_1006499 | 3300025298 | Bacteria | 6896 |
| 118 | Ga0209256_1000153 | 3300025299 | Bacteria | 144736 |
| 119 | Ga0209256_1002058 | 3300025299 | Bacteria | 17780 |
| 120 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 121 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 122 | Ga0209051_1003752 | 3300025303 | Bacteria | 9766 |
| 123 | Ga0207647_10046819 | 3300025904 | Bacteria | 2693 |
| 124 | Ga0207645_10174448 | 3300025907 | Bacteria | 1410 |
| 125 | Ga0207705_10000364 | 3300025909 | Bacteria | 41147 |
| 126 | Ga0207705_10075867 | 3300025909 | Bacteria | 2443 |
| 127 | Ga0207654_10121712 | 3300025911 | Bacteria | 1639 |
| 128 | Ga0207707_10001430 | 3300025912 | Bacteria | 22073 |
| 129 | Ga0207695_10001222 | 3300025913 | Bacteria | 44042 |
| 130 | Ga0207695_10119740 | 3300025913 | Bacteria | 2602 |
| 131 | Ga0207695_10223077 | 3300025913 | Bacteria | 1792 |
| 132 | Ga0207671_10002469 | 3300025914 | Bacteria | 19748 |
| 133 | Ga0207671_10020709 | 3300025914 | Bacteria | 5003 |
| 134 | Ga0207660_10003724 | 3300025917 | Bacteria | 9937 |
| 135 | Ga0207657_10000762 | 3300025919 | Bacteria | 34172 |
| 136 | Ga0207657_10052274 | 3300025919 | Bacteria | 3547 |
| 137 | Ga0207649_10000497 | 3300025920 | Bacteria | 27895 |
| 138 | Ga0207652_10002976 | 3300025921 | Bacteria | 14158 |
| 139 | Ga0207694_10010487 | 3300025924 | Bacteria | 6989 |
| 140 | Ga0207690_10048947 | 3300025932 | Bacteria | 2814 |
| 141 | Ga0207669_10040766 | 3300025937 | Bacteria | 2697 |
| 142 | Ga0207669_10190603 | 3300025937 | Bacteria | 1479 |
| 143 | Ga0207667_10187878 | 3300025949 | Bacteria | 2120 |
| 144 | Ga0207667_10254975 | 3300025949 | Bacteria | 1794 |
| 145 | Ga0207668_10013045 | 3300025972 | Bacteria | 5105 |
| 146 | Ga0207640_10209220 | 3300025981 | Bacteria | 1484 |
| 147 | Ga0207639_10048569 | 3300026041 | Bacteria | 3213 |
| 148 | Ga0207678_10046895 | 3300026067 | Bacteria | 3737 |
| 149 | Ga0207678_10379667 | 3300026067 | Bacteria | 1222 |
| 150 | Ga0207678_10409154 | 3300026067 | Bacteria | 1175 |
| 151 | Ga0207674_10044684 | 3300026116 | Bacteria | 4562 |
| 152 | Ga0207674_10240224 | 3300026116 | Bacteria | 1758 |
| 153 | Ga0207683_10196277 | 3300026121 | Bacteria | 1834 |
| 154 | Ga0209813_10050583 | 3300027866 | Bacteria | 1297 |
| 155 | Ga0268266_10030466 | 3300028379 | Bacteria | 4584 |
| 156 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 157 | Ga0307515_10001903 | 3300028794 | Bacteria | 46429 |
| 158 | Ga0307515_10016193 | 3300028794 | Bacteria | 13668 |
| 159 | Ga0265338_10091621 | 3300028800 | Bacteria | 2510 |
| 160 | Ga0265324_10002198 | 3300029957 | Bacteria | 10199 |
| 161 | Ga0265328_10006035 | 3300031239 | Bacteria | 5158 |
| 162 | Ga0265325_10006313 | 3300031241 | Bacteria | 7213 |
| 163 | Ga0265339_10025804 | 3300031249 | Bacteria | 3369 |
| 164 | Ga0265331_10000019 | 3300031250 | Bacteria | 258837 |
| 165 | Ga0265331_10000080 | 3300031250 | Bacteria | 137743 |
| 166 | Ga0265327_10000454 | 3300031251 | Bacteria | 73503 |
| 167 | Ga0265327_10027230 | 3300031251 | Bacteria | 3294 |
| 168 | Ga0265316_10014590 | 3300031344 | Bacteria | 6908 |
| 169 | Ga0307513_10002030 | 3300031456 | Bacteria | 28510 |
| 170 | Ga0307513_10183207 | 3300031456 | Bacteria | 1954 |
| 171 | Ga0307408_100123653 | 3300031548 | Bacteria | 2008 |
| 172 | Ga0265314_10040241 | 3300031711 | Bacteria | 3356 |
| 173 | Ga0265314_10130882 | 3300031711 | Bacteria | 1565 |
| 174 | Ga0307409_100542804 | 3300031995 | Bacteria | 1140 |
| 175 | Ga0316053_103587 | 3300032120 | Bacteria | 926 |
| 176 | Ga0373927_0005801 | 3300035695 | Bacteria | 8473 |
| 177 | Ga0373925_0007826 | 3300037068 | Bacteria | 7782 |
| 178 | Ga0395900_0000318 | 3300037418 | Bacteria | 71328 |
| 179 | Ga0395900_0177761 | 3300037418 | Bacteria | 2164 |
| 180 | Ga0395900_0586506 | 3300037418 | Bacteria | 1056 |
| 181 | Ga0395898_0000547 | 3300037466 | Bacteria | 71322 |
| 182 | Ga0395898_0048465 | 3300037466 | Bacteria | 4166 |
| 183 | Ga0395905_0000305 | 3300037471 | Bacteria | 71315 |
| 184 | Ga0395905_0000571 | 3300037471 | Bacteria | 49947 |
| 185 | Ga0395905_0007862 | 3300037471 | Bacteria | 10560 |
| 186 | Ga0395905_0033095 | 3300037471 | Bacteria | 4859 |
| 187 | Ga0395905_0040245 | 3300037471 | Bacteria | 4384 |
| 188 | Ga0395905_0046561 | 3300037471 | Bacteria | 4067 |
| 189 | Ga0395905_0103674 | 3300037471 | Bacteria | 2670 |
| 190 | Ga0436364_0194000 | 3300037853 | Bacteria | 2867 |
| 191 | Ga0395901_0000093 | 3300038443 | Bacteria | 120300 |
| 192 | Ga0395901_0027220 | 3300038443 | Bacteria | 5873 |
| 193 | Ga0395901_0118786 | 3300038443 | Bacteria | 2778 |
| 194 | Ga0395901_0140178 | 3300038443 | Bacteria | 2541 |
| 195 | Ga0395901_0175338 | 3300038443 | Bacteria | 2249 |
| 196 | Ga0395901_0393133 | 3300038443 | Bacteria | 1425 |
| 197 | Ga0400485_05700 | 3300038735 | Bacteria | 1442 |
| 198 | Ga0436365_0053390 | 3300039437 | Bacteria | 8756 |
| 199 | Ga0436365_1238706 | 3300039437 | Bacteria | 138652 |
| 200 | Ga0436361_0301911 | 3300039447 | Bacteria | 1855 |
| 201 | Ga0436363_0105350 | 3300039450 | Bacteria | 3172 |
| 202 | Ga0439436_0000675 | 3300041404 | Bacteria | 9161 |
| 203 | Ga0439438_019223 | 3300041405 | Bacteria | 1933 |
| 204 | Ga0439438_025738 | 3300041405 | Bacteria | 1600 |
| 205 | Ga0439447_009157 | 3300041407 | Bacteria | 3018 |
| 206 | Ga0439466_0053595 | 3300041411 | Bacteria | 1315 |
| 207 | Ga0439465_0001295 | 3300041413 | Bacteria | 8044 |
| 208 | Ga0439465_0003165 | 3300041413 | Bacteria | 5369 |
| 209 | Ga0439465_0013380 | 3300041413 | Bacteria | 2560 |
| 210 | Ga0439465_0020602 | 3300041413 | Bacteria | 2067 |
| 211 | Ga0439465_0042638 | 3300041413 | Bacteria | 1471 |
| 212 | Ga0439449_0020546 | 3300042007 | Bacteria | 2474 |
| 213 | Ga0439456_011381 | 3300042013 | Bacteria | 1840 |
| 214 | Ga0450906_000779 | 3300042145 | Bacteria | 6947 |
| 215 | Ga0439434_0015284 | 3300042435 | Bacteria | 2288 |
| 216 | Ga0453684_0020194 | 3300044712 | Bacteria | 10075 |
| 217 | Ga0466960_0003996 | 3300044901 | Bacteria | 5733 |
| 218 | Ga0466959_0017433 | 3300045049 | Bacteria | 5264 |
| 219 | Ga0451576_0005584 | 3300045051 | Bacteria | 15714 |
| 220 | Ga0495638_0000679 | 3300046460 | Bacteria | 36986 |
| 221 | Ga0495638_0011460 | 3300046460 | Bacteria | 6108 |
| 222 | Ga0495638_0033393 | 3300046460 | Bacteria | 3291 |
| 223 | Ga0495580_0002971 | 3300046472 | Bacteria | 14554 |
| 224 | Ga0495605_0001576 | 3300046474 | Bacteria | 14807 |
| 225 | Ga0495662_0005789 | 3300046476 | Bacteria | 6185 |
| 226 | Ga0495585_0011315 | 3300046492 | Bacteria | 5284 |
| 227 | Ga0495585_0146189 | 3300046492 | Bacteria | 1235 |
| 228 | Ga0495583_0001761 | 3300046506 | Bacteria | 20650 |
| 229 | Ga0495583_0055184 | 3300046506 | Bacteria | 1796 |
| 230 | Ga0495606_0001738 | 3300046507 | Bacteria | 27981 |
| 231 | Ga0495606_0175510 | 3300046507 | Bacteria | 1240 |
| 232 | Ga0495610_0108185 | 3300046512 | Bacteria | 1235 |
| 233 | Ga0495610_0108302 | 3300046512 | Bacteria | 1234 |
| 234 | Ga0495616_0020450 | 3300046513 | Bacteria | 3600 |
| 235 | Ga0495620_0067235 | 3300046515 | Bacteria | 1475 |
| 236 | Ga0495631_0000730 | 3300046518 | Bacteria | 21123 |
| 237 | Ga0495632_0013426 | 3300046519 | Bacteria | 4675 |
| 238 | Ga0495643_0010833 | 3300046522 | Bacteria | 5589 |
| 239 | Ga0495643_0060060 | 3300046522 | Bacteria | 2019 |
| 240 | Ga0495587_0084674 | 3300046536 | Bacteria | 1836 |
| 241 | Ga0495609_0011369 | 3300046538 | Bacteria | 4241 |
| 242 | Ga0495597_0140982 | 3300046542 | Bacteria | 994 |
| 243 | Ga0495633_0031225 | 3300046558 | Bacteria | 2585 |
| 244 | Ga0495656_0110228 | 3300046615 | Bacteria | 1286 |
| 245 | Ga0495668_0008861 | 3300046616 | Bacteria | 6234 |
| 246 | Ga0495611_0013690 | 3300046648 | Bacteria | 3457 |
| 247 | Ga0495625_0002939 | 3300046660 | Bacteria | 17768 |
| 248 | Ga0495625_0087967 | 3300046660 | Bacteria | 2153 |
| 249 | Ga0495625_0240197 | 3300046660 | Bacteria | 1180 |
| 250 | Ga0495588_0004788 | 3300046674 | Bacteria | 5988 |
| 251 | Ga0495588_0085964 | 3300046674 | Bacteria | 1645 |
| 252 | Ga0495588_0139954 | 3300046674 | Bacteria | 1278 |
| 253 | Ga0495657_0027610 | 3300046675 | Bacteria | 4003 |
| 254 | Ga0495658_0003511 | 3300046683 | Bacteria | 7758 |
| 255 | Ga0495649_0143104 | 3300046694 | Bacteria | 1258 |
| 256 | Ga0495600_0039364 | 3300046809 | Bacteria | 3078 |
| 257 | Ga0495604_0009407 | 3300047317 | Bacteria | 7728 |
| 258 | Ga0495672_0008168 | 3300047320 | Bacteria | 7764 |
| 259 | Ga0495676_0056828 | 3300047321 | Bacteria | 3092 |
| 260 | Ga0495687_059507 | 3300047443 | Bacteria | 1580 |
| 261 | Ga0495686_0002387 | 3300047472 | Bacteria | 17834 |
| 262 | Ga0495626_0046945 | 3300048091 | Bacteria | 2009 |
| 263 | Ga0496100_0057774 | 3300048903 | Bacteria | 2543 |
| 264 | Ga0496101_0052347 | 3300048904 | Bacteria | 2944 |
| 265 | Ga0496101_0253222 | 3300048904 | Bacteria | 1372 |
| 266 | Ga0496101_0379156 | 3300048904 | Bacteria | 1113 |
| 267 | Ga0496102_0101991 | 3300048905 | Bacteria | 2667 |
| 268 | Ga0496104_0006266 | 3300048907 | Bacteria | 10455 |
| 269 | Ga0496105_0005288 | 3300048908 | Bacteria | 9785 |
| 270 | Ga0496107_0033482 | 3300048910 | Bacteria | 3677 |
| 271 | Ga0496108_0002415 | 3300048911 | Bacteria | 14924 |
| 272 | Ga0496109_0005060 | 3300048912 | Bacteria | 11012 |
| 273 | Ga0496110_0123495 | 3300048913 | Bacteria | 2334 |
| 274 | Ga0496111_0000899 | 3300048914 | Bacteria | 16197 |
| 275 | Ga0496112_0004003 | 3300048915 | Bacteria | 12351 |
| 276 | Ga0496113_0009963 | 3300048916 | Bacteria | 6262 |
| 277 | Ga0496114_0337304 | 3300048917 | Bacteria | 1333 |
| 278 | Ga0496115_0060534 | 3300048918 | Bacteria | 3051 |
| 279 | Ga0496115_0062146 | 3300048918 | Bacteria | 3012 |
| 280 | Ga0496115_0191444 | 3300048918 | Bacteria | 1690 |
| 281 | Ga0496115_0288731 | 3300048918 | Bacteria | 1346 |
| 282 | Ga0496117_0001837 | 3300048920 | Bacteria | 28723 |
| 283 | Ga0496119_0000597 | 3300048922 | Bacteria | 48924 |
| 284 | Ga0496119_0009875 | 3300048922 | Bacteria | 8108 |
| 285 | Ga0496119_0067815 | 3300048922 | Bacteria | 2102 |
| 286 | Ga0496119_0084268 | 3300048922 | Bacteria | 1823 |
| 287 | Ga0496120_0004279 | 3300048923 | Bacteria | 12121 |
| 288 | Ga0496120_0046021 | 3300048923 | Bacteria | 2524 |
| 289 | Ga0496121_0014899 | 3300048924 | Bacteria | 8196 |
| 290 | Ga0496121_0093552 | 3300048924 | Bacteria | 2340 |
| 291 | Ga0496121_0099702 | 3300048924 | Bacteria | 2244 |
| 292 | Ga0496122_0000464 | 3300048925 | Bacteria | 84473 |
| 293 | Ga0496122_0001337 | 3300048925 | Bacteria | 40284 |
| 294 | Ga0496123_0000147 | 3300048926 | Bacteria | 143834 |
| 295 | Ga0496123_0001933 | 3300048926 | Bacteria | 27009 |
| 296 | Ga0496124_0001975 | 3300048927 | Bacteria | 27965 |
| 297 | Ga0496125_0003542 | 3300048928 | Bacteria | 18812 |
| 298 | Ga0496125_0042303 | 3300048928 | Bacteria | 3882 |
| 299 | Ga0496125_0042682 | 3300048928 | Bacteria | 3859 |
| 300 | Ga0496125_0057957 | 3300048928 | Bacteria | 3132 |
| 301 | Ga0496126_0000159 | 3300048929 | Bacteria | 155348 |
| 302 | Ga0496126_0000601 | 3300048929 | Bacteria | 67983 |
| 303 | Ga0496126_0040671 | 3300048929 | Bacteria | 4309 |
| 304 | Ga0496126_0372352 | 3300048929 | Bacteria | 1164 |
| 305 | Ga0495678_007759 | 3300049459 | Bacteria | 5526 |
| 306 | Ga0501031_0037769 | 3300049568 | Bacteria | 3152 |
| 307 | Ga0501031_0040544 | 3300049568 | Bacteria | 3040 |
| 308 | Ga0501031_0158152 | 3300049568 | Bacteria | 1481 |
| 309 | Ga0501032_0000024 | 3300049569 | Bacteria | 143876 |
| 310 | Ga0501032_0025428 | 3300049569 | Bacteria | 4081 |
| 311 | Ga0501032_0059597 | 3300049569 | Bacteria | 2562 |
| 312 | Ga0501033_0000391 | 3300049570 | Bacteria | 42136 |
| 313 | Ga0501033_0000761 | 3300049570 | Bacteria | 29642 |
| 314 | Ga0501033_0026641 | 3300049570 | Bacteria | 4350 |
| 315 | Ga0501033_0077922 | 3300049570 | Bacteria | 2432 |
| 316 | Ga0501033_0085303 | 3300049570 | Bacteria | 2313 |
| 317 | Ga0501033_0170294 | 3300049570 | Bacteria | 1564 |
| 318 | Ga0501033_0293658 | 3300049570 | Bacteria | 1146 |
| 319 | Ga0501034_0000140 | 3300049571 | Bacteria | 134996 |
| 320 | Ga0501034_0001662 | 3300049571 | Bacteria | 28665 |
| 321 | Ga0501034_0012775 | 3300049571 | Bacteria | 8660 |
| 322 | Ga0501034_0032089 | 3300049571 | Bacteria | 5336 |
| 323 | Ga0501034_0046132 | 3300049571 | Bacteria | 4403 |
| 324 | Ga0501034_0110748 | 3300049571 | Bacteria | 2736 |
| 325 | Ga0501034_0126770 | 3300049571 | Bacteria | 2537 |
| 326 | Ga0501034_0133499 | 3300049571 | Bacteria | 2465 |
| 327 | Ga0501034_0321635 | 3300049571 | Bacteria | 1480 |
| 328 | Ga0501036_0000443 | 3300049572 | Bacteria | 29542 |
| 329 | Ga0501037_0000024 | 3300049573 | Bacteria | 146046 |
| 330 | Ga0501037_0000818 | 3300049573 | Bacteria | 23265 |
| 331 | Ga0501037_0085127 | 3300049573 | Bacteria | 2289 |
| 332 | Ga0501037_0107988 | 3300049573 | Bacteria | 2005 |
| 333 | Ga0501037_0134238 | 3300049573 | Bacteria | 1773 |
| 334 | Ga0501037_0192105 | 3300049573 | Bacteria | 1445 |
| 335 | Ga0501038_0000064 | 3300049574 | Bacteria | 87975 |
| 336 | Ga0501038_0035848 | 3300049574 | Bacteria | 4355 |
| 337 | Ga0501038_0071828 | 3300049574 | Bacteria | 2935 |
| 338 | Ga0501038_0114276 | 3300049574 | Bacteria | 2233 |
| 339 | Ga0501038_0199300 | 3300049574 | Bacteria | 1607 |
| 340 | Ga0501039_0000017 | 3300049575 | Bacteria | 189412 |
| 341 | Ga0501039_0102757 | 3300049575 | Bacteria | 2231 |
| 342 | Ga0501043_0000050 | 3300049579 | Bacteria | 107465 |
| 343 | Ga0501043_0000124 | 3300049579 | Bacteria | 70977 |
| 344 | Ga0501043_0003156 | 3300049579 | Bacteria | 13634 |
| 345 | Ga0501043_0045975 | 3300049579 | Bacteria | 3432 |
| 346 | Ga0501043_0162767 | 3300049579 | Bacteria | 1743 |
| 347 | Ga0501047_0002344 | 3300049581 | Bacteria | 18111 |
| 348 | Ga0501047_0130263 | 3300049581 | Bacteria | 2396 |
| 349 | Ga0501047_0223423 | 3300049581 | Bacteria | 1739 |
| 350 | Ga0501047_0278230 | 3300049581 | Bacteria | 1519 |
| 351 | Ga0501068_0164490 | 3300049584 | Bacteria | 1399 |
| 352 | Ga0501069_0000004 | 3300049585 | Bacteria | 192353 |
| 353 | Ga0501069_0029583 | 3300049585 | Bacteria | 3006 |
| 354 | Ga0501069_0041303 | 3300049585 | Bacteria | 2549 |
| 355 | Ga0501069_0191142 | 3300049585 | Bacteria | 1184 |
| 356 | Ga0501070_0000031 | 3300049586 | Bacteria | 138137 |
| 357 | Ga0501070_0000148 | 3300049586 | Bacteria | 64874 |
| 358 | Ga0501070_0000694 | 3300049586 | Bacteria | 30882 |
| 359 | Ga0501070_0001919 | 3300049586 | Bacteria | 18354 |
| 360 | Ga0501070_0017646 | 3300049586 | Bacteria | 5992 |
| 361 | Ga0501070_0052822 | 3300049586 | Bacteria | 3372 |
| 362 | Ga0501070_0241825 | 3300049586 | Bacteria | 1477 |
| 363 | Ga0501073_0031453 | 3300049589 | Bacteria | 3787 |
| 364 | Ga0501073_0112523 | 3300049589 | Bacteria | 1888 |
| 365 | Ga0501074_0000006 | 3300049590 | Bacteria | 112293 |
| 366 | Ga0501074_0020074 | 3300049590 | Bacteria | 4856 |
| 367 | Ga0501074_0098200 | 3300049590 | Bacteria | 2096 |
| 368 | Ga0501074_0230576 | 3300049590 | Bacteria | 1318 |
| 369 | Ga0501074_0243704 | 3300049590 | Bacteria | 1278 |
| 370 | Ga0501080_0000693 | 3300049742 | Bacteria | 27033 |
| 371 | Ga0501080_0003339 | 3300049742 | Bacteria | 14170 |
| 372 | Ga0501080_0005406 | 3300049742 | Bacteria | 11390 |
| 373 | Ga0501080_0132306 | 3300049742 | Bacteria | 2309 |
| 374 | Ga0501080_0148412 | 3300049742 | Bacteria | 2168 |
| 375 | Ga0501080_0388074 | 3300049742 | Bacteria | 1257 |
| 376 | Ga0501083_0000066 | 3300049744 | Bacteria | 71496 |
| 377 | Ga0501083_0011927 | 3300049744 | Bacteria | 6089 |
| 378 | Ga0501273_014424 | 3300049770 | Bacteria | 1017 |
| 379 | Ga0501035_0000011 | 3300049822 | Bacteria | 305794 |
| 380 | Ga0501035_0000021 | 3300049822 | Bacteria | 209085 |
| 381 | Ga0501035_0000593 | 3300049822 | Bacteria | 39882 |
| 382 | Ga0501035_0001755 | 3300049822 | Bacteria | 21897 |
| 383 | Ga0501035_0003715 | 3300049822 | Bacteria | 14551 |
| 384 | Ga0501035_0005312 | 3300049822 | Bacteria | 12184 |
| 385 | Ga0501035_0006966 | 3300049822 | Bacteria | 10558 |
| 386 | Ga0501035_0035511 | 3300049822 | Bacteria | 4523 |
| 387 | Ga0501035_0087852 | 3300049822 | Bacteria | 2740 |
| 388 | Ga0501035_0176204 | 3300049822 | Bacteria | 1844 |
| 389 | Ga0501035_0258932 | 3300049822 | Bacteria | 1475 |
| 390 | Ga0501044_0000588 | 3300049823 | Bacteria | 44117 |
| 391 | Ga0501044_0000803 | 3300049823 | Bacteria | 37863 |
| 392 | Ga0501044_0002607 | 3300049823 | Bacteria | 20483 |
| 393 | Ga0501044_0006574 | 3300049823 | Bacteria | 12830 |
| 394 | Ga0501044_0012369 | 3300049823 | Bacteria | 9238 |
| 395 | Ga0501044_0014696 | 3300049823 | Bacteria | 8442 |
| 396 | Ga0501044_0035448 | 3300049823 | Bacteria | 5225 |
| 397 | Ga0501044_0051016 | 3300049823 | Bacteria | 4267 |
| 398 | Ga0501044_0064037 | 3300049823 | Bacteria | 3754 |
| 399 | Ga0501044_0083723 | 3300049823 | Bacteria | 3225 |
| 400 | Ga0501044_0124050 | 3300049823 | Bacteria | 2581 |
| 401 | Ga0501044_0174053 | 3300049823 | Bacteria | 2122 |
| 402 | Ga0501044_0180460 | 3300049823 | Bacteria | 2078 |
| 403 | Ga0501044_0184173 | 3300049823 | Bacteria | 2054 |
| 404 | Ga0501044_0189219 | 3300049823 | Bacteria | 2022 |
| 405 | Ga0501044_0217547 | 3300049823 | Bacteria | 1862 |
| 406 | Ga0501044_0297099 | 3300049823 | Bacteria | 1545 |
| 407 | Ga0501044_0365018 | 3300049823 | Bacteria | 1361 |
| 408 | nmdc:mga03683_19775_c1 | 3300050489 | Bacteria | 2574 |
| 409 | nmdc:mga00v17_10499_c1 | 3300050491 | Bacteria | 5058 |
| 410 | nmdc:mga0yw44_16779_c1 | 3300050492 | Bacteria | 3966 |
| 411 | nmdc:mga07m45_12959_c1 | 3300050496 | Bacteria | 4411 |
| 412 | nmdc:mga07m45_45525_c2 | 3300050496 | Bacteria | 2088 |
| 413 | Ga0500610_0001958 | 3300053079 | Bacteria | 7335 |
| 414 | Ga0500643_015186 | 3300053087 | Bacteria | 2648 |
| 415 | Ga0500556_0000290 | 3300053104 | Bacteria | 39103 |
| 416 | Ga0500557_000475 | 3300053105 | Bacteria | 5336 |
| 417 | Ga0500594_0003391 | 3300053118 | Bacteria | 3493 |
| 418 | Ga0500595_011555 | 3300053119 | Bacteria | 3450 |
| 419 | Ga0500652_007639 | 3300053131 | Bacteria | 3553 |
| 420 | Ga0500568_0000353 | 3300053139 | Bacteria | 35729 |
| 421 | Ga0500568_0000963 | 3300053139 | Bacteria | 19793 |
| 422 | Ga0500616_0000577 | 3300053153 | Bacteria | 44621 |
| 423 | Ga0500616_0024660 | 3300053153 | Bacteria | 3340 |
| 424 | Ga0500616_0067490 | 3300053153 | Bacteria | 1834 |
| 425 | Ga0500616_0097589 | 3300053153 | Bacteria | 1442 |
| 426 | Ga0500620_002422 | 3300053155 | Bacteria | 3756 |
| 427 | Ga0500636_0034146 | 3300053177 | Bacteria | 3011 |
| 428 | Ga0500645_022807 | 3300053730 | Bacteria | 1921 |
| 429 | Ga0501084_0175458 | 3300054114 | Bacteria | 1809 |
| 430 | Ga0587080_020673 | 3300059503 | Bacteria | 1077 |
| 431 | Ga0587106_009420 | 3300059605 | Bacteria | 1241 |
| 432 | Ga0501082_0063528 | 3300060353 | Bacteria | 3179 |
| 433 | Ga0501082_0136418 | 3300060353 | Bacteria | 2129 |
| 434 | Ga0501082_0204825 | 3300060353 | Bacteria | 1716 |
| 435 | Ga0530510_0020554 | 3300061734 | Bacteria | 4694 |
| 436 | 2503200336 | 2503198000 | Bacteria | 6884444 |
| 437 | 2509115035 | 2508501123 | Bacteria | 6283661 |
| 438 | 2509139563 | 2508501127 | Bacteria | 7037543 |
| 439 | 2509373788 | 2509276018 | Bacteria | 6910194 |
| 440 | 2509395142 | 2509276022 | Bacteria | 6200534 |
| 441 | 2510314124 | 2510065059 | Bacteria | 6847884 |
| 442 | 2510895535 | 2510461076 | Bacteria | 8618824 |
| 443 | 2511122246 | 2510917020 | Bacteria | 5657507 |
| 444 | 2511182554 | 2510917028 | Bacteria | 6185411 |
| 445 | 2511390104 | 2511231027 | Bacteria | 5013807 |
| 446 | 2512932298 | 2512875016 | Bacteria | 6529530 |
| 447 | 2512960305 | 2512875024 | Bacteria | 7195110 |
| 448 | 2513614237 | 2513237090 | Bacteria | 7096802 |
| 449 | 2513865843 | 2513237138 | Bacteria | 7368160 |
| 450 | 2513908669 | 2513237144 | Bacteria | 7530820 |
| 451 | 2513925255 | 2513237146 | Bacteria | 7166346 |
| 452 | 2513997747 | 2513237159 | Bacteria | 6810126 |
| 453 | 2514034613 | 2513237164 | Bacteria | 7563725 |
| 454 | 2514419411 | 2513237305 | Bacteria | 7293571 |
| 455 | 2514587748 | 2513237351 | Bacteria | 6968952 |
| 456 | 2524458774 | 2524023209 | Bacteria | 6679728 |
| 457 | 2585153002 | 2582581280 | Bacteria | 5994497 |
| 458 | 2585167379 | 2582581283 | Bacteria | 6030556 |
| 459 | 2585195039 | 2582581293 | Bacteria | 5907401 |
| 460 | 2585228442 | 2582581299 | Bacteria | 6518058 |
| 461 | 2585265600 | 2582581306 | Bacteria | 6450535 |
| 462 | 2585388805 | 2582581865 | Bacteria | 6644329 |
| 463 | 2585395491 | 2582581866 | Bacteria | 6859583 |
| 464 | 2585400876 | 2582581867 | Bacteria | 7184437 |
| 465 | 2585822222 | 2585427590 | Bacteria | 6824633 |
| 466 | 2588518362 | 2588253730 | Bacteria | 6881675 |
| 467 | 2597812333 | 2597489875 | Bacteria | 7010078 |
| 468 | 2599417165 | 2599185170 | Bacteria | 7295545 |
| 469 | 2599936185 | 2599185301 | Bacteria | 6161860 |
| 470 | 2600194770 | 2599185352 | Bacteria | 7228948 |
| 471 | 2643730053 | 2643221541 | Bacteria | 5498788 |
| 472 | 2643747166 | 2643221545 | Bacteria | 5083237 |
| 473 | 2643770805 | 2643221550 | Bacteria | 4619371 |
| 474 | 2643776326 | 2643221551 | Bacteria | 3750538 |
| 475 | 2643781202 | 2643221552 | Bacteria | 5708754 |
| 476 | 2643794773 | 2643221555 | Bacteria | 3749717 |
| 477 | 2643804270 | 2643221557 | Bacteria | 7184309 |
| 478 | 2643839233 | 2643221564 | Bacteria | 4193379 |
| 479 | 2643927214 | 2643221584 | Bacteria | 5511711 |
| 480 | 2643998425 | 2643221598 | Bacteria | 4578346 |
| 481 | 2644045539 | 2643221606 | Bacteria | 5588032 |
| 482 | 2644050298 | 2643221607 | Bacteria | 6314006 |
| 483 | 2644064956 | 2643221610 | Bacteria | 7480339 |
| 484 | 2644086708 | 2643221614 | Bacteria | 4260023 |
| 485 | 2644106982 | 2643221618 | Bacteria | 7717186 |
| 486 | 2644129670 | 2643221623 | Bacteria | 5239945 |
| 487 | 2644148726 | 2643221626 | Bacteria | 8069654 |
| 488 | 2644158281 | 2643221627 | Bacteria | 6761570 |
| 489 | 2644193670 | 2643221634 | Bacteria | 6705461 |
| 490 | 2644204640 | 2643221636 | Bacteria | 6583769 |
| 491 | 2644208853 | 2643221637 | Bacteria | 5345260 |
| 492 | 2644242488 | 2643221643 | Bacteria | 5749658 |
| 493 | 2644309942 | 2643221655 | Bacteria | 7722067 |
| 494 | 2644331088 | 2643221659 | Bacteria | 7890716 |
| 495 | 2644341662 | 2643221661 | Bacteria | 4267604 |
| 496 | 2644367949 | 2643221666 | Bacteria | 4265935 |
| 497 | 2644376635 | 2643221668 | Bacteria | 7306521 |
| 498 | 2644392835 | 2643221671 | Bacteria | 5496681 |
| 499 | 2644416629 | 2643221675 | Bacteria | 7473456 |
| 500 | 2644449669 | 2643221680 | Bacteria | 7473610 |
| 501 | 2644483218 | 2643221686 | Bacteria | 6310811 |
| 502 | 2644494365 | 2643221688 | Bacteria | 5260751 |
| 503 | 2644499776 | 2643221689 | Bacteria | 6042950 |
| 504 | 2644507638 | 2643221691 | Bacteria | 5093099 |
| 505 | 2644543818 | 2643221698 | Bacteria | 7756764 |
| 506 | 2644616397 | 2643221712 | Bacteria | 7729434 |
| 507 | 2644652383 | 2643221718 | Bacteria | 5345506 |
| 508 | 2644675898 | 2643221723 | Bacteria | 7095460 |
| 509 | 2644689801 | 2643221726 | Bacteria | 7455827 |
| 510 | 2644745202 | 2643221736 | Bacteria | 6608466 |
| 511 | 2688597506 | 2687453392 | Bacteria | 6880454 |
| 512 | 2694631257 | 2693429783 | Bacteria | 7019804 |
| 513 | 2694638739 | 2693429784 | Bacteria | 7241525 |
| 514 | 2723574738 | 2721755686 | Bacteria | 7343952 |
| 515 | 2739310111 | 2738543024 | Bacteria | 5603683 |
| 516 | 2753359855 | 2751185800 | Bacteria | 5467370 |
| 517 | 2756671800 | 2756170246 | Bacteria | 7451806 |
| 518 | 2757571648 | 2757320392 | Bacteria | 3737298 |
| 519 | 2758642177 | 2758568016 | Bacteria | 5645291 |
| 520 | 2765466565 | 2765235802 | Bacteria | 5618596 |
| 521 | 2770196921 | 2767802442 | Bacteria | 5747986 |
| 522 | 2776270470 | 2775506902 | Bacteria | 6208009 |
| 523 | 2776281611 | 2775506904 | Bacteria | 5954060 |
| 524 | 2792752000 | 2791355123 | Bacteria | 8049106 |
| 525 | 2819537562 | 2818991435 | Bacteria | 5433759 |
| 526 | 2819646376 | 2818991454 | Bacteria | 5563326 |
| 527 | 2837680529 | 2837678835 | Bacteria | 5252418 |
| 528 | 2838038631 | 2838035591 | Bacteria | 7166484 |
| 529 | 2838076711 | 2838074704 | Bacteria | 6785777 |
| 530 | 2838661449 | 2838661181 | Bacteria | 7385261 |
| 531 | 2839997457 | 2839993093 | Bacteria | 5512535 |
| 532 | 2840768930 | 2840764183 | Bacteria | 6358399 |
| 533 | 2841738341 | 2841734538 | Bacteria | 6784580 |
| 534 | 2841915798 | 2841911363 | Bacteria | 6173697 |
| 535 | 2841921821 | 2841917233 | Bacteria | 6173500 |
| 536 | 2842298122 | 2842298080 | Bacteria | 6123127 |
| 537 | 2842360278 | 2842357229 | Bacteria | 6485165 |
| 538 | 2842510958 | 2842509118 | Bacteria | 6850950 |
| 539 | 2842522005 | 2842521101 | Bacteria | 6569494 |
| 540 | 2842872094 | 2842871566 | Bacteria | 4827117 |
| 541 | 2844008266 | 2844002411 | Bacteria | 7168230 |
| 542 | 2844012885 | 2844009547 | Bacteria | 6728125 |
| 543 | 2844164096 | 2844163670 | Bacteria | 7266046 |
| 544 | 2847675235 | 2847670302 | Bacteria | 6165597 |
| 545 | 2847691417 | 2847686936 | Bacteria | 6278406 |
| 546 | 2852390398 | 2852387548 | Bacteria | 8025568 |
| 547 | 2854912512 | 2854911287 | Bacteria | 5582813 |
| 548 | 2856314957 | 2856314179 | Bacteria | 6477897 |
| 549 | 2856323411 | 2856320880 | Bacteria | 7263508 |
| 550 | 2856329282 | 2856328259 | Bacteria | 6528202 |
| 551 | 2856336391 | 2856334872 | Bacteria | 7037011 |
| 552 | 2856342081 | 2856342000 | Bacteria | 7176905 |
| 553 | 2856368296 | 2856364286 | Bacteria | 6939991 |
| 554 | 2857351513 | 2857349434 | Bacteria | 7926032 |
| 555 | 2857375484 | 2857367948 | Bacteria | 6965560 |
| 556 | 2869163973 | 2869162929 | Bacteria | 6399702 |
| 557 | 2869174044 | 2869169390 | Bacteria | 6659796 |
| 558 | 2869241297 | 2869234852 | Bacteria | 6654993 |
| 559 | 2869255180 | 2869249662 | Bacteria | 6868783 |
| 560 | 2869261878 | 2869256925 | Bacteria | 6981691 |
| 561 | 2869266493 | 2869264136 | Bacteria | 6880765 |
| 562 | 2869275395 | 2869271264 | Bacteria | 6908218 |
| 563 | 2869282890 | 2869278585 | Bacteria | 7077053 |
| 564 | 2869290085 | 2869285874 | Bacteria | 6901219 |
| 565 | 2871432369 | 2871429161 | Bacteria | 6547891 |
| 566 | 2871436727 | 2871435913 | Bacteria | 6880295 |
| 567 | 2871450983 | 2871444079 | Bacteria | 6423508 |
| 568 | 2871456655 | 2871451962 | Bacteria | 7336357 |
| 569 | 2871462033 | 2871459585 | Bacteria | 6866887 |
| 570 | 2871472872 | 2871466892 | Bacteria | 6923287 |
| 571 | 2871474891 | 2871474448 | Bacteria | 6806570 |
| 572 | 2871481509 | 2871481445 | Bacteria | 6700002 |
| 573 | 2871492991 | 2871488783 | Bacteria | 6929816 |
| 574 | 2871502552 | 2871495908 | Bacteria | 6935695 |
| 575 | 2874105624 | 2874102143 | Bacteria | 6342645 |
| 576 | 2874110766 | 2874109183 | Bacteria | 6517025 |
| 577 | 2874117021 | 2874116593 | Bacteria | 6674494 |
| 578 | 2874127031 | 2874123672 | Bacteria | 7238285 |
| 579 | 2874133965 | 2874131515 | Bacteria | 6820270 |
| 580 | 2874142551 | 2874139085 | Bacteria | 7021506 |
| 581 | 2874152333 | 2874146452 | Bacteria | 7533118 |
| 582 | 2874159736 | 2874155637 | Bacteria | 6724144 |
| 583 | 2874162852 | 2874162495 | Bacteria | 6174670 |
| 584 | 2874168945 | 2874168670 | Bacteria | 8062617 |
| 585 | 2876367669 | 2876363079 | Bacteria | 6544991 |
| 586 | 2876374921 | 2876369609 | Bacteria | 6807521 |
| 587 | 2876378656 | 2876377896 | Bacteria | 6565995 |
| 588 | 2876389097 | 2876386047 | Bacteria | 6698674 |
| 589 | 2876393970 | 2876392853 | Bacteria | 6660880 |
| 590 | 2876404159 | 2876399893 | Bacteria | 6927900 |
| 591 | 2876409067 | 2876406927 | Bacteria | 6191900 |
| 592 | 2876418252 | 2876413966 | Bacteria | 6831344 |
| 593 | 2876424244 | 2876420981 | Bacteria | 6687741 |
| 594 | 2878042200 | 2878035449 | Bacteria | 6555736 |
| 595 | 2878739207 | 2878738818 | Bacteria | 7136951 |
| 596 | 2878749982 | 2878745973 | Bacteria | 6867388 |
| 597 | 2878757037 | 2878753008 | Bacteria | 6922523 |
| 598 | 2878766444 | 2878760144 | Bacteria | 6823465 |
| 599 | 2878773640 | 2878767105 | Bacteria | 6898628 |
| 600 | 2878779257 | 2878774303 | Bacteria | 6108671 |
| 601 | 2878783695 | 2878781027 | Bacteria | 6834456 |
| 602 | 2878795545 | 2878788777 | Bacteria | 6567085 |
| 603 | 2881150813 | 2881147464 | Bacteria | 7779814 |
| 604 | 2881161346 | 2881155292 | Bacteria | 6461656 |
| 605 | 2881167086 | 2881161766 | Bacteria | 7127907 |
| 606 | 2881849981 | 2881845957 | Bacteria | 6611900 |
| 607 | 2881853858 | 2881853255 | Bacteria | 6698367 |
| 608 | 2881866633 | 2881861095 | Bacteria | 7128710 |
| 609 | 2882640703 | 2882632389 | Bacteria | 8154593 |
| 610 | 2882919576 | 2882912400 | Bacteria | 6801539 |
| 611 | 2885308595 | 2885305155 | Bacteria | 7348390 |
| 612 | 2885312640 | 2885312484 | Bacteria | 6415165 |
| 613 | 2885321460 | 2885318864 | Bacteria | 6729568 |
| 614 | 2885335784 | 2885334103 | Bacteria | 7216818 |
| 615 | 2885349060 | 2885342637 | Bacteria | 7011821 |
| 616 | 2885351614 | 2885350715 | Bacteria | 6787678 |
| 617 | 2888338572 | 2888337043 | Bacteria | 6629336 |
| 618 | 2888346077 | 2888343758 | Bacteria | 6611049 |
| 619 | 2888355395 | 2888350351 | Bacteria | 7372807 |
| 620 | 2889010374 | 2889010040 | Bacteria | 6749192 |
| 621 | 2889017961 | 2889016732 | Bacteria | 6700763 |
| 622 | 2889796024 | 2889790730 | Bacteria | 5689708 |
| 623 | 2889919826 | 2889914905 | Bacteria | 5702301 |
| 624 | 2891373506 | 2891373044 | Bacteria | 5202277 |
| 625 | 2894655777 | 2894652903 | Bacteria | 4587256 |
| 626 | 2894820464 | 2894817345 | Bacteria | 4892941 |
| 627 | 2896392152 | 2896384573 | Bacteria | 7700774 |
| 628 | 2903450447 | 2903448605 | Bacteria | 7357801 |
| 629 | 2903500763 | 2903492973 | Bacteria | 13473544 |
| 630 | 2903503287 | 2903492973 | Bacteria | 13473544 |
| 631 | 2903515401 | 2903513507 | Bacteria | 6344008 |
| 632 | 2903521814 | 2903521522 | Bacteria | 6525694 |
| 633 | 2903528191 | 2903528002 | Bacteria | 6586099 |
| 634 | 2903547593 | 2903540706 | Bacteria | 7062119 |
| 635 | 2904582038 | 2904578770 | Bacteria | 5302906 |
| 636 | 2904660301 | 2904659560 | Bacteria | 6685615 |
| 637 | 2906312341 | 2906308376 | Bacteria | 6841989 |
| 638 | 2906325050 | 2906321335 | Bacteria | 6579571 |
| 639 | 2906330401 | 2906328253 | Bacteria | 6585166 |
| 640 | 2906356570 | 2906354277 | Bacteria | 6991324 |
| 641 | 2906365953 | 2906363423 | Bacteria | 6856682 |
| 642 | 2906376402 | 2906370794 | Bacteria | 6881062 |
| 643 | 2906378929 | 2906378014 | Bacteria | 6911440 |
| 644 | 2906392062 | 2906386501 | Bacteria | 5977019 |
| 645 | 2906398037 | 2906393657 | Bacteria | 6790866 |
| 646 | 2906405944 | 2906401398 | Bacteria | 6693206 |
| 647 | 2906411934 | 2906408224 | Bacteria | 6162342 |
| 648 | 2906419601 | 2906414383 | Bacteria | 6580790 |
| 649 | 2909043156 | 2909042592 | Bacteria | 6499737 |
| 650 | 2915653239 | 2915650412 | Bacteria | 4288180 |
| 651 | 2917556695 | 2917554339 | Bacteria | 4987857 |
| 652 | 2919123184 | 2919119836 | Bacteria | 5208557 |
| 653 | 2919451946 | 2919450847 | Bacteria | 5631160 |
| 654 | 2920761371 | 2920760137 | Bacteria | 7427611 |
| 655 | 2920825414 | 2920822456 | Bacteria | 6897201 |
| 656 | 2922133852 | 2922130491 | Bacteria | 7173936 |
| 657 | 2922155617 | 2922151315 | Bacteria | 6902399 |
| 658 | 2922164924 | 2922158528 | Bacteria | 6573167 |
| 659 | 2922173630 | 2922172374 | Bacteria | 6167644 |
| 660 | 2922180775 | 2922178524 | Bacteria | 6025201 |
| 661 | 2922187206 | 2922185730 | Bacteria | 7113964 |
| 662 | 2923559251 | 2923556063 | Bacteria | 6793593 |
| 663 | 2924718510 | 2924710171 | Bacteria | 6752351 |
| 664 | 2924720480 | 2924718760 | Bacteria | 6331356 |
| 665 | 2924732240 | 2924726620 | Bacteria | 6271473 |
| 666 | 2924740608 | 2924733363 | Bacteria | 7574837 |
| 667 | 2924744951 | 2924741084 | Bacteria | 6661321 |
| 668 | 2924753355 | 2924748358 | Bacteria | 6154725 |
| 669 | 2924755895 | 2924754689 | Bacteria | 6774424 |
| 670 | 2924763735 | 2924762789 | Bacteria | 6561353 |
| 671 | 2924776672 | 2924776078 | Bacteria | 7492003 |
| 672 | 2924786340 | 2924784321 | Bacteria | 7416538 |
| 673 | 2928524032 | 2928521798 | Bacteria | 4960112 |
| 674 | 2933023238 | 2933016740 | Bacteria | 6355406 |
| 675 | 2937819517 | 2937813078 | Bacteria | 7783518 |
| 676 | 2937829011 | 2937822353 | Bacteria | 7290551 |
| 677 | 2937839603 | 2937836603 | Bacteria | 6811263 |
| 678 | 2937844354 | 2937843397 | Bacteria | 5256375 |
| 679 | 2937850945 | 2937848649 | Bacteria | 6983481 |
| 680 | 2937863499 | 2937861824 | Bacteria | 6660327 |
| 681 | 2937873427 | 2937868953 | Bacteria | 6639878 |
| 682 | 2937880832 | 2937877337 | Bacteria | 7246526 |
| 683 | 2937897460 | 2937891427 | Bacteria | 6357007 |
| 684 | 2937977024 | 2937972304 | Bacteria | 7532020 |
| 685 | 2937984996 | 2937980651 | Bacteria | 6517427 |
| 686 | 2938001468 | 2937994558 | Bacteria | 7036190 |
| 687 | 2938015512 | 2938014810 | Bacteria | 6700592 |
| 688 | 2939671825 | 2939669807 | Bacteria | 5028511 |
| 689 | 2941504806 | 2941499720 | Bacteria | 7599444 |
| 690 | 2954012977 | 2954011201 | Bacteria | 4762601 |
| 691 | 2958039673 | 2958034702 | Bacteria | 6989922 |
| 692 | 2958042770 | 2958041894 | Bacteria | 13082850 |
| 693 | 2958052698 | 2958041894 | Bacteria | 13082850 |
| 694 | 2958069382 | 2958064165 | Bacteria | 7158582 |
| 695 | 2958073974 | 2958071322 | Bacteria | 6815895 |
| 696 | 2958088612 | 2958084443 | Bacteria | 7312792 |
| 697 | 2958097978 | 2958092219 | Bacteria | 6861151 |
| 698 | 2958107917 | 2958100919 | Bacteria | 6800575 |
| 699 | 2958109774 | 2958108152 | Bacteria | 6681128 |
| 700 | 2958116434 | 2958115193 | Bacteria | 6923548 |
| 701 | 2958125694 | 2958122699 | Bacteria | 7280457 |
| 702 | 2958134472 | 2958130278 | Bacteria | 6897202 |
| 703 | 2958139159 | 2958137437 | Bacteria | 6050276 |
| 704 | 2958159341 | 2958158011 | Bacteria | 6058449 |
| 705 | 2958171622 | 2958165035 | Bacteria | 6906348 |
| 706 | 2958178081 | 2958172287 | Bacteria | 6716688 |
| 707 | 2958180953 | 2958179912 | Bacteria | 6874908 |
| 708 | 2961078790 | 2961077736 | Bacteria | 7079850 |
| 709 | 2961115625 | 2961114664 | Bacteria | 6680456 |
| 710 | 2961131373 | 2961127735 | Bacteria | 7196641 |
| 711 | 2961137959 | 2961136820 | Bacteria | 6775228 |
| 712 | 2961170063 | 2961163497 | Bacteria | 6901077 |
| 713 | 2961175635 | 2961170736 | Bacteria | 7072258 |
| 714 | 2961186912 | 2961183825 | Bacteria | 6688536 |
| 715 | 2963646906 | 2963644680 | Bacteria | 6530403 |
| 716 | 2965024814 | 2965018300 | Bacteria | 6883036 |
| 717 | 2965029747 | 2965025482 | Bacteria | 6532201 |
| 718 | 2965032299 | 2965032056 | Bacteria | 6887443 |
| 719 | 2965045928 | 2965040258 | Bacteria | 6855979 |
| 720 | 2965055373 | 2965047637 | Bacteria | 6623551 |
| 721 | 2965065224 | 2965062239 | Bacteria | 7412989 |
| 722 | 2965093326 | 2965089291 | Bacteria | 6866420 |
| 723 | 2965107040 | 2965102966 | Bacteria | 6800987 |
| 724 | 2965119546 | 2965119406 | Bacteria | 6956431 |
| 725 | 2967999308 | 2967996073 | Bacteria | 6787468 |
| 726 | 2968007721 | 2968003550 | Bacteria | 6929263 |
| 727 | 2968021003 | 2968016561 | Bacteria | 7022047 |
| 728 | 2968088293 | 2968083720 | Bacteria | 7351627 |
| 729 | 2968095054 | 2968091066 | Bacteria | 6052692 |
| 730 | 2968101481 | 2968097103 | Bacteria | 6107094 |
| 731 | 2968111358 | 2968110612 | Bacteria | 6814636 |
| 732 | 2968119625 | 2968117919 | Bacteria | 6536078 |
| 733 | 2968130612 | 2968128360 | Bacteria | 6270294 |
| 734 | 2968144723 | 2968138860 | Bacteria | 6605449 |
| 735 | 2968178455 | 2968171901 | Bacteria | 6894245 |
| 736 | 2970474300 | 2970469710 | Bacteria | 6969209 |
| 737 | 2970494463 | 2970489779 | Bacteria | 6517260 |
| 738 | 2970508223 | 2970503327 | Bacteria | 7099517 |
| 739 | 2970511454 | 2970510686 | Bacteria | 7006402 |
| 740 | 2970527594 | 2970524798 | Bacteria | 6840927 |
| 741 | 2970534907 | 2970532167 | Bacteria | 6553173 |
| 742 | 2970544208 | 2970540015 | Bacteria | 6977556 |
| 743 | 2970554175 | 2970547951 | Bacteria | 6931819 |
| 744 | 2970561300 | 2970554993 | Bacteria | 6814252 |
| 745 | 2970597499 | 2970593180 | Bacteria | 7073582 |
| 746 | 2970624419 | 2970619444 | Bacteria | 6986144 |
| 747 | 2970628594 | 2970627176 | Bacteria | 6680862 |
| 748 | 2977826196 | 2977821940 | Bacteria | 6906439 |
| 749 | 2977834981 | 2977828996 | Bacteria | 7007971 |
| 750 | 2977848129 | 2977843712 | Bacteria | 6753583 |
| 751 | 2977853695 | 2977851361 | Bacteria | 6694324 |
| 752 | 2977864638 | 2977858184 | Bacteria | 6215359 |
| 753 | 2977869077 | 2977864932 | Bacteria | 7534097 |
| 754 | 2977878067 | 2977872689 | Bacteria | 7270173 |
| 755 | 2977899273 | 2977898635 | Bacteria | 6675551 |
| 756 | 2977909752 | 2977907340 | Bacteria | 6577984 |
| 757 | 2977919952 | 2977915119 | Bacteria | 6829656 |
| 758 | 2977923627 | 2977922695 | Bacteria | 6956781 |
| 759 | 2977936537 | 2977935797 | Bacteria | 6252826 |
| 760 | 2977944498 | 2977942078 | Bacteria | 7570577 |
| 761 | 2977952787 | 2977950692 | Bacteria | 6893264 |
| 762 | 2977959183 | 2977957713 | Bacteria | 6877875 |
| 763 | 2977976518 | 2977971508 | Bacteria | 7472917 |
| 764 | 2977990466 | 2977986579 | Bacteria | 6581278 |
| 765 | 2979710594 | 2979710463 | Bacteria | 6785254 |
| 766 | 2979745889 | 2979742915 | Bacteria | 7301278 |
| 767 | 2979771303 | 2979764755 | Bacteria | 6610066 |
| 768 | 2979774868 | 2979772303 | Bacteria | 6618277 |
| 769 | 2979795835 | 2979793036 | Bacteria | 6808957 |
| 770 | 2979813407 | 2979808191 | Bacteria | 7179355 |
| 771 | 2987638697 | 2987636660 | Bacteria | 8088555 |
| 772 | 2987646517 | 2987645492 | Bacteria | 6117018 |
| 773 | 2987654268 | 2987652177 | Bacteria | 6969023 |
| 774 | 2987666304 | 2987659509 | Bacteria | 6966464 |
| 775 | 2987669908 | 2987666974 | Bacteria | 6509233 |
| 776 | 2987676205 | 2987673487 | Bacteria | 6884027 |
| 777 | 2989349978 | 2989349275 | Bacteria | 6349068 |
| 778 | 2989775727 | 2989771324 | Bacteria | 5605128 |
| 779 | 2996314390 | 2996310559 | Bacteria | 6357320 |
| 780 | 2996339898 | 2996336353 | Bacteria | 5511628 |
| 781 | 2996345002 | 2996341866 | Bacteria | 6643098 |
| 782 | 2996352364 | 2996348954 | Bacteria | 7239054 |
| 783 | 2996390295 | 2996386984 | Bacteria | 6978667 |
| 784 | 3000139878 | 3000135777 | Bacteria | 6891109 |
| 785 | 3002144920 | 3002141150 | Bacteria | 5254435 |
| 786 | 3004167937 | 3004167301 | Bacteria | 8330599 |
| 787 | 3004195310 | 3004188549 | Bacteria | 6952365 |
| 788 | 3004203624 | 3004195979 | Bacteria | 6776956 |
| 789 | 3004205060 | 3004203850 | Bacteria | 7307914 |
| 790 | 3004215314 | 3004211236 | Bacteria | 7417683 |
| 791 | 3004225843 | 3004218560 | Bacteria | 7421728 |
| 792 | 3004236683 | 3004232784 | Bacteria | 6662140 |
| 793 | 3004255535 | 3004248173 | Bacteria | 6563236 |
| 794 | 3004275558 | 3004268573 | Bacteria | 7043476 |
| 795 | 3004279046 | 3004275668 | Bacteria | 7114440 |
| 796 | 3004335424 | 3004334049 | Bacteria | 8449246 |
| 797 | 3005414419 | 3005409236 | Bacteria | 7188837 |
| 798 | 637075398 | 637000159 | Bacteria | 7596297 |
| 799 | 649872055 | 649633066 | Bacteria | 6690028 |
| 800 | 8001849964 | 8001845381 | Bacteria | 5804942 |
| 801 | 8002289309 | 8002285264 | Bacteria | 6717907 |
| 802 | 8004301125 | 8004300914 | Bacteria | 6132239 |
| 803 | 8004367719 | 8004361976 | Bacteria | 6858373 |
| 804 | 8004378612 | 8004374579 | Bacteria | 6898112 |
| 805 | 8004392290 | 8004387939 | Bacteria | 7049250 |
| 806 | 8004403178 | 8004395343 | Bacteria | 6620908 |
| 807 | 8004449205 | 8004445564 | Bacteria | 6322258 |
| 808 | 8004638698 | 8004633249 | Bacteria | 6723080 |
| 809 | 8004641131 | 8004640170 | Bacteria | 6723001 |
| 810 | 8004708875 | 8004703790 | Bacteria | 8006957 |
| 811 | 8004718600 | 8004714634 | Bacteria | 6776161 |
| 812 | 8004733551 | 8004727605 | Bacteria | 6643904 |
| 813 | 8005303282 | 8005301065 | Bacteria | 6614431 |
| 814 | 8005691946 | 8005688590 | Bacteria | 6610080 |
| 815 | 8024488171 | 8024486573 | Bacteria | 6540512 |
| 816 | 8045864513 | 8045864390 | Bacteria | 5043873 |
| 817 | 8046771800 | 8046767195 | Bacteria | 7547379 |
| 818 | 8054561074 | 8054558443 | Bacteria | 5204801 |
| 819 | 8054563843 | 8054563764 | Bacteria | 5592885 |
| 820 | 8055619806 | 8055617313 | Bacteria | 7548464 |
| 821 | 8057575558 | 8057575449 | Bacteria | 7367519 |
| 822 | Ga0500643_012026 | |||
| 823 | JGI25158J39367_1002269 | |||
| 824 | JGI25157J39369_1000755 | |||
| 825 | JGI25159J45721_1000004 | |||
| 826 | JGI25159J45721_1000877 | |||
| 827 | JGI25151J46595_10031663 | |||
| 828 | JGI25406J46586_10043244 | |||
| 829 | JGI25160J50197_1000001 | |||
| 830 | JGI25160J50197_1000021 | |||
| 831 | JGI25161J50226_1000001 | |||
| 832 | JGI25161J50226_1000218 | |||
| 833 | Ga0055529_1007706 | |||
| 834 | Ga0055526_1001649 | |||
| 835 | Ga0055526_1008803 | |||
| 836 | Ga0055524_1002001 | |||
| 837 | Ga0055524_1012328 | |||
| 838 | Ga0055536_1000269 | |||
| 839 | Ga0055530_10007403 | |||
| 840 | Ga0055540_1028635 | |||
| 841 | Ga0055531_10045958 | |||
| 842 | Ga0055543_1000003 | |||
| 843 | Ga0055543_1000164 | |||
| 844 | Ga0058862_12092097 | |||
| 845 | Ga0065165_1000033 | |||
| 846 | Ga0070658_10003684 | |||
| 847 | Ga0070658_10062316 | |||
| 848 | Ga0070658_10505614 | |||
| 849 | Ga0070680_100114357 | |||
| 850 | Ga0070682_100133534 | |||
| 851 | Ga0070660_100045115 | |||
| 852 | Ga0070660_100082638 | |||
| 853 | Ga0070691_10003400 | |||
| 854 | Ga0070661_100000441 | |||
| 855 | Ga0070668_100310689 | |||
| 856 | Ga0070674_100154839 | |||
| 857 | Ga0070659_100036819 | |||
| 858 | Ga0070667_100214422 | |||
| 859 | Ga0070663_100025697 | |||
| 860 | Ga0070681_10081574 | |||
| 861 | Ga0068867_100089377 | |||
| 862 | Ga0068853_100013522 | |||
| 863 | Ga0068853_100253604 | |||
| 864 | Ga0070665_100142655 | |||
| 865 | Ga0070665_100259649 | |||
| 866 | Ga0068855_100013981 | |||
| 867 | Ga0068857_100082668 | |||
| 868 | Ga0068854_100178894 | |||
| 869 | Ga0068856_100257097 | |||
| 870 | Ga0068852_100026482 | |||
| 871 | Ga0081455_10238712 | |||
| 872 | Ga0081540_1033222 | |||
| 873 | Ga0081539_10000991 | |||
| 874 | Ga0075365_10005021 | |||
| 875 | Ga0075365_10009125 | |||
| 876 | Ga0075365_10023064 | |||
| 877 | Ga0075365_10027527 | |||
| 878 | Ga0075365_10050322 | |||
| 879 | Ga0075365_10065433 | |||
| 880 | Ga0075368_10084191 | |||
| 881 | Ga0075364_10004345 | |||
| 882 | Ga0075364_10025915 | |||
| 883 | Ga0075364_10037873 | |||
| 884 | Ga0075362_10028402 | |||
| 885 | Ga0075367_10000307 | |||
| 886 | Ga0075369_10091584 | |||
| 887 | Ga0075366_10162675 | |||
| 888 | Ga0075370_10017438 | |||
| 889 | Ga0075370_10135090 | |||
| 890 | Ga0105240_10002462 | |||
| 891 | Ga0105240_10078667 | |||
| 892 | Ga0105240_10207364 | |||
| 893 | Ga0105240_10478269 | |||
| 894 | Ga0105240_10608489 | |||
| 895 | Ga0105243_10087363 | |||
| 896 | Ga0105237_10003177 | |||
| 897 | Ga0105237_10306985 | |||
| 898 | Ga0105238_10012189 | |||
| 899 | Ga0105238_10094938 | |||
| 900 | Ga0105239_10202768 | |||
| 901 | Ga0105239_10501933 | |||
| 902 | Ga0157373_10032787 | |||
| 903 | Ga0157371_10119488 | |||
| 904 | Ga0157370_10005189 | |||
| 905 | Ga0157370_10135644 | |||
| 906 | Ga0157369_10047367 | |||
| 907 | Ga0157369_10576446 | |||
| 908 | Ga0171463_1017 | |||
| 909 | Ga0157372_10039780 | |||
| 910 | Ga0157372_10417303 | |||
| 911 | Ga0157375_10564256 | |||
| 912 | Ga0163163_10022780 | |||
| 913 | Ga0157379_10003397 | |||
| 914 | Ga0182006_1017059 | |||
| 915 | Ga0182007_10036984 | |||
| 916 | Ga0182005_1006094 | |||
| 917 | Ga0183363_1050 | |||
| 918 | Ga0163161_10327398 | |||
| 919 | Ga0213874_10005742 | |||
| 920 | Ga0213876_10000410 | |||
| 921 | Ga0213876_10003699 | |||
| 922 | Ga0209436_100276 | |||
| 923 | Ga0209436_105791 | |||
| 924 | Ga0207425_1020966 | |||
| 925 | Ga0209026_1000089 | |||
| 926 | Ga0209148_1000124 | |||
| 927 | Ga0209759_1000903 | |||
| 928 | Ga0209233_1000010 | |||
| 929 | Ga0209455_1000062 | |||
| 930 | Ga0209130_1000003 | |||
| 931 | Ga0209130_1000017 | |||
| 932 | Ga0209130_1005979 | |||
| 933 | Ga0209676_1000876 | |||
| 934 | Ga0209025_1000161 | |||
| 935 | Ga0209025_1000171 | |||
| 936 | Ga0209564_1000013 | |||
| 937 | Ga0209758_1023159 | |||
| 938 | Ga0209050_1006499 | |||
| 939 | Ga0209256_1000153 | |||
| 940 | Ga0209256_1002058 | |||
| 941 | Ga0207426_1000006 | |||
| 942 | Ga0207426_1000011 | |||
| 943 | Ga0209051_1003752 | |||
| 944 | Ga0207647_10046819 | |||
| 945 | Ga0207645_10174448 | |||
| 946 | Ga0207705_10000364 | |||
| 947 | Ga0207705_10075867 | |||
| 948 | Ga0207654_10121712 | |||
| 949 | Ga0207707_10001430 | |||
| 950 | Ga0207695_10001222 | |||
| 951 | Ga0207695_10119740 | |||
| 952 | Ga0207695_10223077 | |||
| 953 | Ga0207671_10002469 | |||
| 954 | Ga0207671_10020709 | |||
| 955 | Ga0207660_10003724 | |||
| 956 | Ga0207657_10000762 | |||
| 957 | Ga0207657_10052274 | |||
| 958 | Ga0207649_10000497 | |||
| 959 | Ga0207652_10002976 | |||
| 960 | Ga0207694_10010487 | |||
| 961 | Ga0207690_10048947 | |||
| 962 | Ga0207669_10040766 | |||
| 963 | Ga0207669_10190603 | |||
| 964 | Ga0207667_10187878 | |||
| 965 | Ga0207667_10254975 | |||
| 966 | Ga0207668_10013045 | |||
| 967 | Ga0207640_10209220 | |||
| 968 | Ga0207639_10048569 | |||
| 969 | Ga0207678_10046895 | |||
| 970 | Ga0207678_10379667 | |||
| 971 | Ga0207678_10409154 | |||
| 972 | Ga0207674_10044684 | |||
| 973 | Ga0207674_10240224 | |||
| 974 | Ga0207683_10196277 | |||
| 975 | Ga0209813_10050583 | |||
| 976 | Ga0268266_10030466 | |||
| 977 | Ga0307515_10000017 | |||
| 978 | Ga0307515_10001903 | |||
| 979 | Ga0307515_10016193 | |||
| 980 | Ga0265338_10091621 | |||
| 981 | Ga0265324_10002198 | |||
| 982 | Ga0265328_10006035 | |||
| 983 | Ga0265325_10006313 | |||
| 984 | Ga0265339_10025804 | |||
| 985 | Ga0265331_10000019 | |||
| 986 | Ga0265331_10000080 | |||
| 987 | Ga0265327_10000454 | |||
| 988 | Ga0265327_10027230 | |||
| 989 | Ga0265316_10014590 | |||
| 990 | Ga0307513_10002030 | |||
| 991 | Ga0307513_10183207 | |||
| 992 | Ga0307408_100123653 | |||
| 993 | Ga0265314_10040241 | |||
| 994 | Ga0265314_10130882 | |||
| 995 | Ga0307409_100542804 | |||
| 996 | Ga0316053_103587 | |||
| 997 | Ga0373927_0005801 | |||
| 998 | Ga0373925_0007826 | |||
| 999 | Ga0395900_0000318 | |||
| 1000 | Ga0395900_0177761 | |||
| 1001 | Ga0395900_0586506 | |||
| 1002 | Ga0395898_0000547 | |||
| 1003 | Ga0395898_0048465 | |||
| 1004 | Ga0395905_0000305 | |||
| 1005 | Ga0395905_0000571 | |||
| 1006 | Ga0395905_0007862 | |||
| 1007 | Ga0395905_0033095 | |||
| 1008 | Ga0395905_0040245 | |||
| 1009 | Ga0395905_0046561 | |||
| 1010 | Ga0395905_0103674 | |||
| 1011 | Ga0436364_0194000 | |||
| 1012 | Ga0395901_0000093 | |||
| 1013 | Ga0395901_0027220 | |||
| 1014 | Ga0395901_0118786 | |||
| 1015 | Ga0395901_0140178 | |||
| 1016 | Ga0395901_0175338 | |||
| 1017 | Ga0395901_0393133 | |||
| 1018 | Ga0400485_05700 | |||
| 1019 | Ga0436365_0053390 | |||
| 1020 | Ga0436365_1238706 | |||
| 1021 | Ga0436361_0301911 | |||
| 1022 | Ga0436363_0105350 | |||
| 1023 | Ga0439436_0000675 | |||
| 1024 | Ga0439438_019223 | |||
| 1025 | Ga0439438_025738 | |||
| 1026 | Ga0439447_009157 | |||
| 1027 | Ga0439466_0053595 | |||
| 1028 | Ga0439465_0001295 | |||
| 1029 | Ga0439465_0003165 | |||
| 1030 | Ga0439465_0013380 | |||
| 1031 | Ga0439465_0020602 | |||
| 1032 | Ga0439465_0042638 | |||
| 1033 | Ga0439449_0020546 | |||
| 1034 | Ga0439456_011381 | |||
| 1035 | Ga0450906_000779 | |||
| 1036 | Ga0439434_0015284 | |||
| 1037 | Ga0453684_0020194 | |||
| 1038 | Ga0466960_0003996 | |||
| 1039 | Ga0466959_0017433 | |||
| 1040 | Ga0451576_0005584 | |||
| 1041 | Ga0495638_0000679 | |||
| 1042 | Ga0495638_0011460 | |||
| 1043 | Ga0495638_0033393 | |||
| 1044 | Ga0495580_0002971 | |||
| 1045 | Ga0495605_0001576 | |||
| 1046 | Ga0495662_0005789 | |||
| 1047 | Ga0495585_0011315 | |||
| 1048 | Ga0495585_0146189 | |||
| 1049 | Ga0495583_0001761 | |||
| 1050 | Ga0495583_0055184 | |||
| 1051 | Ga0495606_0001738 | |||
| 1052 | Ga0495606_0175510 | |||
| 1053 | Ga0495610_0108185 | |||
| 1054 | Ga0495610_0108302 | |||
| 1055 | Ga0495616_0020450 | |||
| 1056 | Ga0495620_0067235 | |||
| 1057 | Ga0495631_0000730 | |||
| 1058 | Ga0495632_0013426 | |||
| 1059 | Ga0495643_0010833 | |||
| 1060 | Ga0495643_0060060 | |||
| 1061 | Ga0495587_0084674 | |||
| 1062 | Ga0495609_0011369 | |||
| 1063 | Ga0495597_0140982 | |||
| 1064 | Ga0495633_0031225 | |||
| 1065 | Ga0495656_0110228 | |||
| 1066 | Ga0495668_0008861 | |||
| 1067 | Ga0495611_0013690 | |||
| 1068 | Ga0495625_0002939 | |||
| 1069 | Ga0495625_0087967 | |||
| 1070 | Ga0495625_0240197 | |||
| 1071 | Ga0495588_0004788 | |||
| 1072 | Ga0495588_0085964 | |||
| 1073 | Ga0495588_0139954 | |||
| 1074 | Ga0495657_0027610 | |||
| 1075 | Ga0495658_0003511 | |||
| 1076 | Ga0495649_0143104 | |||
| 1077 | Ga0495600_0039364 | |||
| 1078 | Ga0495604_0009407 | |||
| 1079 | Ga0495672_0008168 | |||
| 1080 | Ga0495676_0056828 | |||
| 1081 | Ga0495687_059507 | |||
| 1082 | Ga0495686_0002387 | |||
| 1083 | Ga0495626_0046945 | |||
| 1084 | Ga0496100_0057774 | |||
| 1085 | Ga0496101_0052347 | |||
| 1086 | Ga0496101_0253222 | |||
| 1087 | Ga0496101_0379156 | |||
| 1088 | Ga0496102_0101991 | |||
| 1089 | Ga0496104_0006266 | |||
| 1090 | Ga0496105_0005288 | |||
| 1091 | Ga0496107_0033482 | |||
| 1092 | Ga0496108_0002415 | |||
| 1093 | Ga0496109_0005060 | |||
| 1094 | Ga0496110_0123495 | |||
| 1095 | Ga0496111_0000899 | |||
| 1096 | Ga0496112_0004003 | |||
| 1097 | Ga0496113_0009963 | |||
| 1098 | Ga0496114_0337304 | |||
| 1099 | Ga0496115_0060534 | |||
| 1100 | Ga0496115_0062146 | |||
| 1101 | Ga0496115_0191444 | |||
| 1102 | Ga0496115_0288731 | |||
| 1103 | Ga0496117_0001837 | |||
| 1104 | Ga0496119_0000597 | |||
| 1105 | Ga0496119_0009875 | |||
| 1106 | Ga0496119_0067815 | |||
| 1107 | Ga0496119_0084268 | |||
| 1108 | Ga0496120_0004279 | |||
| 1109 | Ga0496120_0046021 | |||
| 1110 | Ga0496121_0014899 | |||
| 1111 | Ga0496121_0093552 | |||
| 1112 | Ga0496121_0099702 | |||
| 1113 | Ga0496122_0000464 | |||
| 1114 | Ga0496122_0001337 | |||
| 1115 | Ga0496123_0000147 | |||
| 1116 | Ga0496123_0001933 | |||
| 1117 | Ga0496124_0001975 | |||
| 1118 | Ga0496125_0003542 | |||
| 1119 | Ga0496125_0042303 | |||
| 1120 | Ga0496125_0042682 | |||
| 1121 | Ga0496125_0057957 | |||
| 1122 | Ga0496126_0000159 | |||
| 1123 | Ga0496126_0000601 | |||
| 1124 | Ga0496126_0040671 | |||
| 1125 | Ga0496126_0372352 | |||
| 1126 | Ga0495678_007759 | |||
| 1127 | Ga0501031_0037769 | |||
| 1128 | Ga0501031_0040544 | |||
| 1129 | Ga0501031_0158152 | |||
| 1130 | Ga0501032_0000024 | |||
| 1131 | Ga0501032_0025428 | |||
| 1132 | Ga0501032_0059597 | |||
| 1133 | Ga0501033_0000391 | |||
| 1134 | Ga0501033_0000761 | |||
| 1135 | Ga0501033_0026641 | |||
| 1136 | Ga0501033_0077922 | |||
| 1137 | Ga0501033_0085303 | |||
| 1138 | Ga0501033_0170294 | |||
| 1139 | Ga0501033_0293658 | |||
| 1140 | Ga0501034_0000140 | |||
| 1141 | Ga0501034_0001662 | |||
| 1142 | Ga0501034_0012775 | |||
| 1143 | Ga0501034_0032089 | |||
| 1144 | Ga0501034_0046132 | |||
| 1145 | Ga0501034_0110748 | |||
| 1146 | Ga0501034_0126770 | |||
| 1147 | Ga0501034_0133499 | |||
| 1148 | Ga0501034_0321635 | |||
| 1149 | Ga0501036_0000443 | |||
| 1150 | Ga0501037_0000024 | |||
| 1151 | Ga0501037_0000818 | |||
| 1152 | Ga0501037_0085127 | |||
| 1153 | Ga0501037_0107988 | |||
| 1154 | Ga0501037_0134238 | |||
| 1155 | Ga0501037_0192105 | |||
| 1156 | Ga0501038_0000064 | |||
| 1157 | Ga0501038_0035848 | |||
| 1158 | Ga0501038_0071828 | |||
| 1159 | Ga0501038_0114276 | |||
| 1160 | Ga0501038_0199300 | |||
| 1161 | Ga0501039_0000017 | |||
| 1162 | Ga0501039_0102757 | |||
| 1163 | Ga0501043_0000050 | |||
| 1164 | Ga0501043_0000124 | |||
| 1165 | Ga0501043_0003156 | |||
| 1166 | Ga0501043_0045975 | |||
| 1167 | Ga0501043_0162767 | |||
| 1168 | Ga0501047_0002344 | |||
| 1169 | Ga0501047_0130263 | |||
| 1170 | Ga0501047_0223423 | |||
| 1171 | Ga0501047_0278230 | |||
| 1172 | Ga0501068_0164490 | |||
| 1173 | Ga0501069_0000004 | |||
| 1174 | Ga0501069_0029583 | |||
| 1175 | Ga0501069_0041303 | |||
| 1176 | Ga0501069_0191142 | |||
| 1177 | Ga0501070_0000031 | |||
| 1178 | Ga0501070_0000148 | |||
| 1179 | Ga0501070_0000694 | |||
| 1180 | Ga0501070_0001919 | |||
| 1181 | Ga0501070_0017646 | |||
| 1182 | Ga0501070_0052822 | |||
| 1183 | Ga0501070_0241825 | |||
| 1184 | Ga0501073_0031453 | |||
| 1185 | Ga0501073_0112523 | |||
| 1186 | Ga0501074_0000006 | |||
| 1187 | Ga0501074_0020074 | |||
| 1188 | Ga0501074_0098200 | |||
| 1189 | Ga0501074_0230576 | |||
| 1190 | Ga0501074_0243704 | |||
| 1191 | Ga0501080_0000693 | |||
| 1192 | Ga0501080_0003339 | |||
| 1193 | Ga0501080_0005406 | |||
| 1194 | Ga0501080_0132306 | |||
| 1195 | Ga0501080_0148412 | |||
| 1196 | Ga0501080_0388074 | |||
| 1197 | Ga0501083_0000066 | |||
| 1198 | Ga0501083_0011927 | |||
| 1199 | Ga0501273_014424 | |||
| 1200 | Ga0501035_0000011 | |||
| 1201 | Ga0501035_0000021 | |||
| 1202 | Ga0501035_0000593 | |||
| 1203 | Ga0501035_0001755 | |||
| 1204 | Ga0501035_0003715 | |||
| 1205 | Ga0501035_0005312 | |||
| 1206 | Ga0501035_0006966 | |||
| 1207 | Ga0501035_0035511 | |||
| 1208 | Ga0501035_0087852 | |||
| 1209 | Ga0501035_0176204 | |||
| 1210 | Ga0501035_0258932 | |||
| 1211 | Ga0501044_0000588 | |||
| 1212 | Ga0501044_0000803 | |||
| 1213 | Ga0501044_0002607 | |||
| 1214 | Ga0501044_0006574 | |||
| 1215 | Ga0501044_0012369 | |||
| 1216 | Ga0501044_0014696 | |||
| 1217 | Ga0501044_0035448 | |||
| 1218 | Ga0501044_0051016 | |||
| 1219 | Ga0501044_0064037 | |||
| 1220 | Ga0501044_0083723 | |||
| 1221 | Ga0501044_0124050 | |||
| 1222 | Ga0501044_0174053 | |||
| 1223 | Ga0501044_0180460 | |||
| 1224 | Ga0501044_0184173 | |||
| 1225 | Ga0501044_0189219 | |||
| 1226 | Ga0501044_0217547 | |||
| 1227 | Ga0501044_0297099 | |||
| 1228 | Ga0501044_0365018 | |||
| 1229 | nmdc:mga03683_19775_c1 | |||
| 1230 | nmdc:mga00v17_10499_c1 | |||
| 1231 | nmdc:mga0yw44_16779_c1 | |||
| 1232 | nmdc:mga07m45_12959_c1 | |||
| 1233 | nmdc:mga07m45_45525_c2 | |||
| 1234 | Ga0500610_0001958 | |||
| 1235 | Ga0500643_015186 | |||
| 1236 | Ga0500556_0000290 | |||
| 1237 | Ga0500557_000475 | |||
| 1238 | Ga0500594_0003391 | |||
| 1239 | Ga0500595_011555 | |||
| 1240 | Ga0500652_007639 | |||
| 1241 | Ga0500568_0000353 | |||
| 1242 | Ga0500568_0000963 | |||
| 1243 | Ga0500616_0000577 | |||
| 1244 | Ga0500616_0024660 | |||
| 1245 | Ga0500616_0067490 | |||
| 1246 | Ga0500616_0097589 | |||
| 1247 | Ga0500620_002422 | |||
| 1248 | Ga0500636_0034146 | |||
| 1249 | Ga0500645_022807 | |||
| 1250 | Ga0501084_0175458 | |||
| 1251 | Ga0587080_020673 | |||
| 1252 | Ga0587106_009420 | |||
| 1253 | Ga0501082_0063528 | |||
| 1254 | Ga0501082_0136418 | |||
| 1255 | Ga0501082_0204825 | |||
| 1256 | Ga0530510_0020554 | |||
| 1257 | 2503200336 | |||
| 1258 | 2509115035 | |||
| 1259 | 2509139563 | |||
| 1260 | 2509373788 | |||
| 1261 | 2509395142 | |||
| 1262 | 2510314124 | |||
| 1263 | 2510895535 | |||
| 1264 | 2511122246 | |||
| 1265 | 2511182554 | |||
| 1266 | 2511390104 | |||
| 1267 | 2512932298 | |||
| 1268 | 2512960305 | |||
| 1269 | 2513614237 | |||
| 1270 | 2513865843 | |||
| 1271 | 2513908669 | |||
| 1272 | 2513925255 | |||
| 1273 | 2513997747 | |||
| 1274 | 2514034613 | |||
| 1275 | 2514419411 | |||
| 1276 | 2514587748 | |||
| 1277 | 2524458774 | |||
| 1278 | 2585153002 | |||
| 1279 | 2585167379 | |||
| 1280 | 2585195039 | |||
| 1281 | 2585228442 | |||
| 1282 | 2585265600 | |||
| 1283 | 2585388805 | |||
| 1284 | 2585395491 | |||
| 1285 | 2585400876 | |||
| 1286 | 2585822222 | |||
| 1287 | 2588518362 | |||
| 1288 | 2597812333 | |||
| 1289 | 2599417165 | |||
| 1290 | 2599936185 | |||
| 1291 | 2600194770 | |||
| 1292 | 2643730053 | |||
| 1293 | 2643747166 | |||
| 1294 | 2643770805 | |||
| 1295 | 2643776326 | |||
| 1296 | 2643781202 | |||
| 1297 | 2643794773 | |||
| 1298 | 2643804270 | |||
| 1299 | 2643839233 | |||
| 1300 | 2643927214 | |||
| 1301 | 2643998425 | |||
| 1302 | 2644045539 | |||
| 1303 | 2644050298 | |||
| 1304 | 2644064956 | |||
| 1305 | 2644086708 | |||
| 1306 | 2644106982 | |||
| 1307 | 2644129670 | |||
| 1308 | 2644148726 | |||
| 1309 | 2644158281 | |||
| 1310 | 2644193670 | |||
| 1311 | 2644204640 | |||
| 1312 | 2644208853 | |||
| 1313 | 2644242488 | |||
| 1314 | 2644309942 | |||
| 1315 | 2644331088 | |||
| 1316 | 2644341662 | |||
| 1317 | 2644367949 | |||
| 1318 | 2644376635 | |||
| 1319 | 2644392835 | |||
| 1320 | 2644416629 | |||
| 1321 | 2644449669 | |||
| 1322 | 2644483218 | |||
| 1323 | 2644494365 | |||
| 1324 | 2644499776 | |||
| 1325 | 2644507638 | |||
| 1326 | 2644543818 | |||
| 1327 | 2644616397 | |||
| 1328 | 2644652383 | |||
| 1329 | 2644675898 | |||
| 1330 | 2644689801 | |||
| 1331 | 2644745202 | |||
| 1332 | 2688597506 | |||
| 1333 | 2694631257 | |||
| 1334 | 2694638739 | |||
| 1335 | 2723574738 | |||
| 1336 | 2739310111 | |||
| 1337 | 2753359855 | |||
| 1338 | 2756671800 | |||
| 1339 | 2757571648 | |||
| 1340 | 2758642177 | |||
| 1341 | 2765466565 | |||
| 1342 | 2770196921 | |||
| 1343 | 2776270470 | |||
| 1344 | 2776281611 | |||
| 1345 | 2792752000 | |||
| 1346 | 2819537562 | |||
| 1347 | 2819646376 | |||
| 1348 | 2837680529 | |||
| 1349 | 2838038631 | |||
| 1350 | 2838076711 | |||
| 1351 | 2838661449 | |||
| 1352 | 2839997457 | |||
| 1353 | 2840768930 | |||
| 1354 | 2841738341 | |||
| 1355 | 2841915798 | |||
| 1356 | 2841921821 | |||
| 1357 | 2842298122 | |||
| 1358 | 2842360278 | |||
| 1359 | 2842510958 | |||
| 1360 | 2842522005 | |||
| 1361 | 2842872094 | |||
| 1362 | 2844008266 | |||
| 1363 | 2844012885 | |||
| 1364 | 2844164096 | |||
| 1365 | 2847675235 | |||
| 1366 | 2847691417 | |||
| 1367 | 2852390398 | |||
| 1368 | 2854912512 | |||
| 1369 | 2856314957 | |||
| 1370 | 2856323411 | |||
| 1371 | 2856329282 | |||
| 1372 | 2856336391 | |||
| 1373 | 2856342081 | |||
| 1374 | 2856368296 | |||
| 1375 | 2857351513 | |||
| 1376 | 2857375484 | |||
| 1377 | 2869163973 | |||
| 1378 | 2869174044 | |||
| 1379 | 2869241297 | |||
| 1380 | 2869255180 | |||
| 1381 | 2869261878 | |||
| 1382 | 2869266493 | |||
| 1383 | 2869275395 | |||
| 1384 | 2869282890 | |||
| 1385 | 2869290085 | |||
| 1386 | 2871432369 | |||
| 1387 | 2871436727 | |||
| 1388 | 2871450983 | |||
| 1389 | 2871456655 | |||
| 1390 | 2871462033 | |||
| 1391 | 2871472872 | |||
| 1392 | 2871474891 | |||
| 1393 | 2871481509 | |||
| 1394 | 2871492991 | |||
| 1395 | 2871502552 | |||
| 1396 | 2874105624 | |||
| 1397 | 2874110766 | |||
| 1398 | 2874117021 | |||
| 1399 | 2874127031 | |||
| 1400 | 2874133965 | |||
| 1401 | 2874142551 | |||
| 1402 | 2874152333 | |||
| 1403 | 2874159736 | |||
| 1404 | 2874162852 | |||
| 1405 | 2874168945 | |||
| 1406 | 2876367669 | |||
| 1407 | 2876374921 | |||
| 1408 | 2876378656 | |||
| 1409 | 2876389097 | |||
| 1410 | 2876393970 | |||
| 1411 | 2876404159 | |||
| 1412 | 2876409067 | |||
| 1413 | 2876418252 | |||
| 1414 | 2876424244 | |||
| 1415 | 2878042200 | |||
| 1416 | 2878739207 | |||
| 1417 | 2878749982 | |||
| 1418 | 2878757037 | |||
| 1419 | 2878766444 | |||
| 1420 | 2878773640 | |||
| 1421 | 2878779257 | |||
| 1422 | 2878783695 | |||
| 1423 | 2878795545 | |||
| 1424 | 2881150813 | |||
| 1425 | 2881161346 | |||
| 1426 | 2881167086 | |||
| 1427 | 2881849981 | |||
| 1428 | 2881853858 | |||
| 1429 | 2881866633 | |||
| 1430 | 2882640703 | |||
| 1431 | 2882919576 | |||
| 1432 | 2885308595 | |||
| 1433 | 2885312640 | |||
| 1434 | 2885321460 | |||
| 1435 | 2885335784 | |||
| 1436 | 2885349060 | |||
| 1437 | 2885351614 | |||
| 1438 | 2888338572 | |||
| 1439 | 2888346077 | |||
| 1440 | 2888355395 | |||
| 1441 | 2889010374 | |||
| 1442 | 2889017961 | |||
| 1443 | 2889796024 | |||
| 1444 | 2889919826 | |||
| 1445 | 2891373506 | |||
| 1446 | 2894655777 | |||
| 1447 | 2894820464 | |||
| 1448 | 2896392152 | |||
| 1449 | 2903450447 | |||
| 1450 | 2903500763 | |||
| 1451 | 2903503287 | |||
| 1452 | 2903515401 | |||
| 1453 | 2903521814 | |||
| 1454 | 2903528191 | |||
| 1455 | 2903547593 | |||
| 1456 | 2904582038 | |||
| 1457 | 2904660301 | |||
| 1458 | 2906312341 | |||
| 1459 | 2906325050 | |||
| 1460 | 2906330401 | |||
| 1461 | 2906356570 | |||
| 1462 | 2906365953 | |||
| 1463 | 2906376402 | |||
| 1464 | 2906378929 | |||
| 1465 | 2906392062 | |||
| 1466 | 2906398037 | |||
| 1467 | 2906405944 | |||
| 1468 | 2906411934 | |||
| 1469 | 2906419601 | |||
| 1470 | 2909043156 | |||
| 1471 | 2915653239 | |||
| 1472 | 2917556695 | |||
| 1473 | 2919123184 | |||
| 1474 | 2919451946 | |||
| 1475 | 2920761371 | |||
| 1476 | 2920825414 | |||
| 1477 | 2922133852 | |||
| 1478 | 2922155617 | |||
| 1479 | 2922164924 | |||
| 1480 | 2922173630 | |||
| 1481 | 2922180775 | |||
| 1482 | 2922187206 | |||
| 1483 | 2923559251 | |||
| 1484 | 2924718510 | |||
| 1485 | 2924720480 | |||
| 1486 | 2924732240 | |||
| 1487 | 2924740608 | |||
| 1488 | 2924744951 | |||
| 1489 | 2924753355 | |||
| 1490 | 2924755895 | |||
| 1491 | 2924763735 | |||
| 1492 | 2924776672 | |||
| 1493 | 2924786340 | |||
| 1494 | 2928524032 | |||
| 1495 | 2933023238 | |||
| 1496 | 2937819517 | |||
| 1497 | 2937829011 | |||
| 1498 | 2937839603 | |||
| 1499 | 2937844354 | |||
| 1500 | 2937850945 | |||
| 1501 | 2937863499 | |||
| 1502 | 2937873427 | |||
| 1503 | 2937880832 | |||
| 1504 | 2937897460 | |||
| 1505 | 2937977024 | |||
| 1506 | 2937984996 | |||
| 1507 | 2938001468 | |||
| 1508 | 2938015512 | |||
| 1509 | 2939671825 | |||
| 1510 | 2941504806 | |||
| 1511 | 2954012977 | |||
| 1512 | 2958039673 | |||
| 1513 | 2958042770 | |||
| 1514 | 2958052698 | |||
| 1515 | 2958069382 | |||
| 1516 | 2958073974 | |||
| 1517 | 2958088612 | |||
| 1518 | 2958097978 | |||
| 1519 | 2958107917 | |||
| 1520 | 2958109774 | |||
| 1521 | 2958116434 | |||
| 1522 | 2958125694 | |||
| 1523 | 2958134472 | |||
| 1524 | 2958139159 | |||
| 1525 | 2958159341 | |||
| 1526 | 2958171622 | |||
| 1527 | 2958178081 | |||
| 1528 | 2958180953 | |||
| 1529 | 2961078790 | |||
| 1530 | 2961115625 | |||
| 1531 | 2961131373 | |||
| 1532 | 2961137959 | |||
| 1533 | 2961170063 | |||
| 1534 | 2961175635 | |||
| 1535 | 2961186912 | |||
| 1536 | 2963646906 | |||
| 1537 | 2965024814 | |||
| 1538 | 2965029747 | |||
| 1539 | 2965032299 | |||
| 1540 | 2965045928 | |||
| 1541 | 2965055373 | |||
| 1542 | 2965065224 | |||
| 1543 | 2965093326 | |||
| 1544 | 2965107040 | |||
| 1545 | 2965119546 | |||
| 1546 | 2967999308 | |||
| 1547 | 2968007721 | |||
| 1548 | 2968021003 | |||
| 1549 | 2968088293 | |||
| 1550 | 2968095054 | |||
| 1551 | 2968101481 | |||
| 1552 | 2968111358 | |||
| 1553 | 2968119625 | |||
| 1554 | 2968130612 | |||
| 1555 | 2968144723 | |||
| 1556 | 2968178455 | |||
| 1557 | 2970474300 | |||
| 1558 | 2970494463 | |||
| 1559 | 2970508223 | |||
| 1560 | 2970511454 | |||
| 1561 | 2970527594 | |||
| 1562 | 2970534907 | |||
| 1563 | 2970544208 | |||
| 1564 | 2970554175 | |||
| 1565 | 2970561300 | |||
| 1566 | 2970597499 | |||
| 1567 | 2970624419 | |||
| 1568 | 2970628594 | |||
| 1569 | 2977826196 | |||
| 1570 | 2977834981 | |||
| 1571 | 2977848129 | |||
| 1572 | 2977853695 | |||
| 1573 | 2977864638 | |||
| 1574 | 2977869077 | |||
| 1575 | 2977878067 | |||
| 1576 | 2977899273 | |||
| 1577 | 2977909752 | |||
| 1578 | 2977919952 | |||
| 1579 | 2977923627 | |||
| 1580 | 2977936537 | |||
| 1581 | 2977944498 | |||
| 1582 | 2977952787 | |||
| 1583 | 2977959183 | |||
| 1584 | 2977976518 | |||
| 1585 | 2977990466 | |||
| 1586 | 2979710594 | |||
| 1587 | 2979745889 | |||
| 1588 | 2979771303 | |||
| 1589 | 2979774868 | |||
| 1590 | 2979795835 | |||
| 1591 | 2979813407 | |||
| 1592 | 2987638697 | |||
| 1593 | 2987646517 | |||
| 1594 | 2987654268 | |||
| 1595 | 2987666304 | |||
| 1596 | 2987669908 | |||
| 1597 | 2987676205 | |||
| 1598 | 2989349978 | |||
| 1599 | 2989775727 | |||
| 1600 | 2996314390 | |||
| 1601 | 2996339898 | |||
| 1602 | 2996345002 | |||
| 1603 | 2996352364 | |||
| 1604 | 2996390295 | |||
| 1605 | 3000139878 | |||
| 1606 | 3002144920 | |||
| 1607 | 3004167937 | |||
| 1608 | 3004195310 | |||
| 1609 | 3004203624 | |||
| 1610 | 3004205060 | |||
| 1611 | 3004215314 | |||
| 1612 | 3004225843 | |||
| 1613 | 3004236683 | |||
| 1614 | 3004255535 | |||
| 1615 | 3004275558 | |||
| 1616 | 3004279046 | |||
| 1617 | 3004335424 | |||
| 1618 | 3005414419 | |||
| 1619 | 637075398 | |||
| 1620 | 649872055 | |||
| 1621 | 8001849964 | |||
| 1622 | 8002289309 | |||
| 1623 | 8004301125 | |||
| 1624 | 8004367719 | |||
| 1625 | 8004378612 | |||
| 1626 | 8004392290 | |||
| 1627 | 8004403178 | |||
| 1628 | 8004449205 | |||
| 1629 | 8004638698 | |||
| 1630 | 8004641131 | |||
| 1631 | 8004708875 | |||
| 1632 | 8004718600 | |||
| 1633 | 8004733551 | |||
| 1634 | 8005303282 | |||
| 1635 | 8005691946 | |||
| 1636 | 8024488171 | |||
| 1637 | 8045864513 | |||
| 1638 | 8046771800 | |||
| 1639 | 8054561074 | |||
| 1640 | 8054563843 | |||
| 1641 | 8055619806 | |||
| 1642 | 8057575558 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wrv-assembly1.cif.gz_B | crystal structure of t.th.hb8 branched-chain amino acid aminotransferase | 0.9711 | 10 | 288 |
| 4whx-assembly1.cif.gz_E | x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate | 0.9685 | 5 | 288 |
| 3u0g-assembly4.cif.gz_E | crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei | 0.9618 | 5 | 288 |
| 6nst-assembly1.cif.gz_B | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9601 | 5 | 289 |
| 5e25-assembly2.cif.gz_B-2 | crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate | 0.9585 | 10 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u0gF02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9771 | 139 | 288 | 3.20.10.10 |
| 6h65B02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9587 | 138 | 287 | 3.20.10.10 |
| 6gkrB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9561 | 138 | 288 | 3.20.10.10 |
| 1a0gA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9551 | 11 | 126 | 3.30.470.10 |
| 5mr0A02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9537 | 138 | 287 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9DK24-F1-model_v4 | deleted | 0.9911 | 110 | 288 |
|
| AF-A0A7C9GEA6-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.989 | 1 | 295 |
GO:0004084
GO:0005829 GO:0009097 GO:0009098 GO:0009099 |
| AF-A0A6L6WVE5-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9852 | 1 | 291 |
GO:0004084
GO:0005829 GO:0009097 GO:0009098 GO:0009099 |
| AF-C4WFD8-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.985 | 1 | 296 |
GO:0008168
GO:0009097 GO:0009098 GO:0009099 GO:0032259 GO:0052655 GO:0052656 |
| AF-F7XVU9-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9828 | 5 | 288 |
GO:0009097
GO:0009098 GO:0009099 GO:0052655 GO:0052656 |