F482279

General Info

Members Datasets Scaffolds Average Seq Length
821 627 1642 296

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_012026|Ga0500643_012026_1703_2788
Length 361
Sequence MVIFAKLFGGLRTKRQAGTVFPELPSICLQVPIRLGLAAQLRYLPGWYRQINNRVGAGPREVTPMTSVSFDKLDGFIWMNGEFVKWADAKIHVLTHGLHYASAVFEGERAYGGEIFKLTEHTERLHESARILGFKIPYSVEEIDDACRTLLKKQGFKDAYVRPIAWRGSEQMGVSAQNNRINCAVAIWQWPSYFDPAQKLKGIRLDIAEYRRPDPRTAPSKSKAAGLYMICTISKHAAEAKGYADALMYDWREQVAEATGANVFFVKDGKIHTPKPDCFLDGITRRTAIDLAKRRGIEVIERAIMPEELEGFEQCFLTGTAAEVTPVSEIGPYKFTVGKIAETLMNDYSAEVQPKHAIAAE

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
137 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
142 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
245 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
246 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
247 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
248 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
249 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
250 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
251 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
252 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
253 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
254 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
255 2512875024
256 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
257 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
258 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
259 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
260 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
261 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
262 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
263 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
264 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
265 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
266 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
267 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
268 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
269 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
270 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
271 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
272 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
273 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
274 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
275 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
276 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
277 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
278 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
279 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
280 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
281 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
282 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
283 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
284 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
285 2643221557 Ensifer sp. Root558 Isolate Unclassified
286 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
287 2643221584 Caulobacter sp. Root656 Isolate Unclassified
288 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
289 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
290 2643221607 Rhizobium sp. Root73 Isolate Unclassified
291 2643221610 Ensifer sp. Root74 Isolate Unclassified
292 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
293 2643221618 Ensifer sp. Root231 Isolate Unclassified
294 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
295 2643221626 Ensifer sp. Root31 Isolate Unclassified
296 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
297 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
298 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
299 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
300 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
301 2643221655 Ensifer sp. Root1252 Isolate Unclassified
302 2643221659 Ensifer sp. Root127 Isolate Unclassified
303 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
304 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
305 2643221668 Ensifer sp. Root423 Isolate Unclassified
306 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
307 2643221675 Ensifer sp. Root1298 Isolate Unclassified
308 2643221680 Ensifer sp. Root1312 Isolate Unclassified
309 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
310 2643221688 Rhizobium sp. Root482 Isolate Unclassified
311 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
312 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
313 2643221698 Ensifer sp. Root142 Isolate Unclassified
314 2643221712 Ensifer sp. Root258 Isolate Unclassified
315 2643221718 Rhizobium sp. Root268 Isolate Unclassified
316 2643221723 Ensifer sp. Root278 Isolate Unclassified
317 2643221726 Ensifer sp. Root954 Isolate Unclassified
318 2643221736 Bosea sp. Root483D1 Isolate Unclassified
319 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
320 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
321 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
322 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
323 2738543024 Aminobacter sp. AP02 Isolate Unclassified
324 2751185800 Brucella pituitosa AA2 Isolate Unclassified
325 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
326 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
327 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
328 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
329 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
330 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
331 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
332 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
333 2818991435 Caulobacter henricii 536 Isolate Unclassified
334 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
335 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
336 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
337 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
338 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
339 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
340 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
341 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
342 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
343 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
344 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
345 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
346 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
347 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
348 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
349 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
350 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
351 2844163670 Ensifer sp. 1H6 Isolate Unclassified
352 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
353 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
354 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
355 2854911287 Brucella lupini LUP21 Isolate Unclassified
356 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
357 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
358 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
359 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
360 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
361 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
362 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
363 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
364 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
365 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
366 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
367 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
368 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
369 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
370 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
371 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
372 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
373 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
374 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
375 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
376 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
377 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
378 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
379 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
380 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
381 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
382 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
383 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
384 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
385 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
386 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
387 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
388 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
389 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
390 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
391 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
392 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
393 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
394 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
395 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
396 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
397 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
398 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
399 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
400 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
401 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
402 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
403 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
404 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
405 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
406 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
407 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
408 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
409 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
410 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
411 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
412 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
413 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
414 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
415 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
416 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
417 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
418 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
419 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
420 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
421 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
422 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
423 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
424 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
425 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
426 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
427 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
428 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
429 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
430 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
431 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
432 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
433 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
434 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
435 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
436 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
437 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
438 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
439 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
440 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
441 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
442 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
443 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
444 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
445 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
446 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
447 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
448 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
449 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
450 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
451 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
452 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
453 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
454 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
455 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
456 2909042592 Labrys sp. LIt4 Isolate Nodule
457 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
458 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
459 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
460 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
461 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
462 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
463 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
464 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
465 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
466 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
467 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
468 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
469 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
470 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
471 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
472 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
473 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
474 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
475 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
476 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
477 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
478 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
479 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
480 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
481 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
482 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
483 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
484 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
485 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
486 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
487 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
488 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
489 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
490 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
491 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
492 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
493 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
494 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
495 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
496 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
497 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
498 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
499 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
500 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
501 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
502 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
503 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
504 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
505 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
506 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
507 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
508 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
509 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
510 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
511 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
512 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
513 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
514 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
515 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
516 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
517 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
518 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
519 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
520 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
521 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
522 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
523 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
524 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
525 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
526 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
527 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
528 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
529 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
530 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
531 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
532 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
533 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
534 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
535 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
536 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
537 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
538 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
539 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
540 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
541 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
542 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
543 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
544 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
545 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
546 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
547 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
548 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
549 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
550 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
551 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
552 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
553 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
554 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
555 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
556 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
557 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
558 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
559 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
560 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
561 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
562 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
563 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
564 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
565 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
566 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
567 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
568 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
569 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
570 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
571 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
572 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
573 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
574 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
575 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
576 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
577 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
578 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
579 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
580 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
581 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
582 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
583 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
584 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
585 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
586 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
587 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
588 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
589 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
590 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
591 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
592 3004167301 Mesorhizobium loti 582 Isolate Unclassified
593 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
594 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
595 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
596 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
597 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
598 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
599 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
600 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
601 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
602 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
603 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
604 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
605 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
606 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
607 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
608 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
609 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
610 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
611 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
612 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
613 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
614 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
615 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
616 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
617 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
618 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
619 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
620 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
621 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
622 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
623 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
624 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
625 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
626 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
627 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.5
Metatranscriptomes 0.49
Isolates 47.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 31.67
Rhizoplane 2.8
Rhizosphere 40.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_012026 3300053087 Bacteria 3119
2 JGI25158J39367_1002269 3300002739 Bacteria 3181
3 JGI25157J39369_1000755 3300002741 Bacteria 16931
4 JGI25159J45721_1000004 3300002987 Bacteria 215789
5 JGI25159J45721_1000877 3300002987 Bacteria 13071
6 JGI25151J46595_10031663 3300003187 Bacteria 2062
7 JGI25406J46586_10043244 3300003203 Bacteria 1570
8 JGI25160J50197_1000001 3300003354 Bacteria 782301
9 JGI25160J50197_1000021 3300003354 Bacteria 215789
10 JGI25161J50226_1000001 3300003374 Bacteria 655036
11 JGI25161J50226_1000218 3300003374 Bacteria 36216
12 Ga0055529_1007706 3300003763 Bacteria 1455
13 Ga0055526_1001649 3300003771 Bacteria 15665
14 Ga0055526_1008803 3300003771 Bacteria 4965
15 Ga0055524_1002001 3300003775 Bacteria 10883
16 Ga0055524_1012328 3300003775 Bacteria 3284
17 Ga0055536_1000269 3300003781 Bacteria 39889
18 Ga0055530_10007403 3300003791 Bacteria 4633
19 Ga0055540_1028635 3300003792 Bacteria 1315
20 Ga0055531_10045958 3300003794 Bacteria 1205
21 Ga0055543_1000003 3300004625 Bacteria 358656
22 Ga0055543_1000164 3300004625 Bacteria 55304
23 Ga0058862_12092097 3300004803 Bacteria 1137
24 Ga0065165_1000033 3300005262 Bacteria 215827
25 Ga0070658_10003684 3300005327 Bacteria 12537
26 Ga0070658_10062316 3300005327 Bacteria 3039
27 Ga0070658_10505614 3300005327 Bacteria 1044
28 Ga0070680_100114357 3300005336 Bacteria 2248
29 Ga0070682_100133534 3300005337 Bacteria 1683
30 Ga0070660_100045115 3300005339 Bacteria 3373
31 Ga0070660_100082638 3300005339 Bacteria 2522
32 Ga0070691_10003400 3300005341 Bacteria 7154
33 Ga0070661_100000441 3300005344 Bacteria 31826
34 Ga0070668_100310689 3300005347 Bacteria 1324
35 Ga0070674_100154839 3300005356 Bacteria 1733
36 Ga0070659_100036819 3300005366 Bacteria 3815
37 Ga0070667_100214422 3300005367 Bacteria 1712
38 Ga0070663_100025697 3300005455 Bacteria 3979
39 Ga0070681_10081574 3300005458 Bacteria 3190
40 Ga0068867_100089377 3300005459 Bacteria 2336
41 Ga0068853_100013522 3300005539 Bacteria 6667
42 Ga0068853_100253604 3300005539 Bacteria 1615
43 Ga0070665_100142655 3300005548 Bacteria 2398
44 Ga0070665_100259649 3300005548 Bacteria 1738
45 Ga0068855_100013981 3300005563 Bacteria 9677
46 Ga0068857_100082668 3300005577 Bacteria 2869
47 Ga0068854_100178894 3300005578 Bacteria 1656
48 Ga0068856_100257097 3300005614 Bacteria 1762
49 Ga0068852_100026482 3300005616 Bacteria 4714
50 Ga0081455_10238712 3300005937 Bacteria 1337
51 Ga0081540_1033222 3300005983 Bacteria 2805
52 Ga0081539_10000991 3300005985 Bacteria 52737
53 Ga0075365_10005021 3300006038 Bacteria 7093
54 Ga0075365_10009125 3300006038 Bacteria 5680
55 Ga0075365_10023064 3300006038 Bacteria 3909
56 Ga0075365_10027527 3300006038 Bacteria 3619
57 Ga0075365_10050322 3300006038 Bacteria 2748
58 Ga0075365_10065433 3300006038 Bacteria 2436
59 Ga0075368_10084191 3300006042 Bacteria 1296
60 Ga0075364_10004345 3300006051 Bacteria 8133
61 Ga0075364_10025915 3300006051 Bacteria 3736
62 Ga0075364_10037873 3300006051 Bacteria 3124
63 Ga0075362_10028402 3300006177 Bacteria 2402
64 Ga0075367_10000307 3300006178 Bacteria 17312
65 Ga0075369_10091584 3300006186 Bacteria 1357
66 Ga0075366_10162675 3300006195 Bacteria 1352
67 Ga0075370_10017438 3300006353 Bacteria 3880
68 Ga0075370_10135090 3300006353 Bacteria 1441
69 Ga0105240_10002462 3300009093 Bacteria 29759
70 Ga0105240_10078667 3300009093 Bacteria 4060
71 Ga0105240_10207364 3300009093 Bacteria 2293
72 Ga0105240_10478269 3300009093 Bacteria 1389
73 Ga0105240_10608489 3300009093 Bacteria 1202
74 Ga0105243_10087363 3300009148 Bacteria 2559
75 Ga0105237_10003177 3300009545 Bacteria 19715
76 Ga0105237_10306985 3300009545 Bacteria 1590
77 Ga0105238_10012189 3300009551 Bacteria 8665
78 Ga0105238_10094938 3300009551 Bacteria 2970
79 Ga0105239_10202768 3300010375 Bacteria 2222
80 Ga0105239_10501933 3300010375 Bacteria 1379
81 Ga0157373_10032787 3300013100 Bacteria 3738
82 Ga0157371_10119488 3300013102 Bacteria 1873
83 Ga0157370_10005189 3300013104 Bacteria 14674
84 Ga0157370_10135644 3300013104 Bacteria 2294
85 Ga0157369_10047367 3300013105 Bacteria 4668
86 Ga0157369_10576446 3300013105 Bacteria 1162
87 Ga0171463_1017 3300013249 Bacteria 48649
88 Ga0157372_10039780 3300013307 Bacteria 5190
89 Ga0157372_10417303 3300013307 Bacteria 1564
90 Ga0157375_10564256 3300013308 Bacteria 1299
91 Ga0163163_10022780 3300014325 Bacteria 5936
92 Ga0157379_10003397 3300014968 Bacteria 13466
93 Ga0182006_1017059 3300015261 Bacteria 3091
94 Ga0182007_10036984 3300015262 Bacteria 1640
95 Ga0182005_1006094 3300015265 Bacteria 3715
96 Ga0183363_1050 3300015690 Bacteria 38817
97 Ga0163161_10327398 3300017792 Bacteria 1213
98 Ga0213874_10005742 3300021377 Bacteria 2906
99 Ga0213876_10000410 3300021384 Bacteria 35997
100 Ga0213876_10003699 3300021384 Bacteria 8674
101 Ga0209436_100276 3300025208 Bacteria 23572
102 Ga0209436_105791 3300025208 Bacteria 2790
103 Ga0207425_1020966 3300025245 Bacteria 1390
104 Ga0209026_1000089 3300025250 Bacteria 175907
105 Ga0209148_1000124 3300025254 Bacteria 185123
106 Ga0209759_1000903 3300025256 Bacteria 22112
107 Ga0209233_1000010 3300025261 Bacteria 1194329
108 Ga0209455_1000062 3300025272 Bacteria 335169
109 Ga0209130_1000003 3300025284 Bacteria 677988
110 Ga0209130_1000017 3300025284 Bacteria 388431
111 Ga0209130_1005979 3300025284 Bacteria 4064
112 Ga0209676_1000876 3300025292 Bacteria 38530
113 Ga0209025_1000161 3300025294 Bacteria 166506
114 Ga0209025_1000171 3300025294 Bacteria 160478
115 Ga0209564_1000013 3300025295 Bacteria 775755
116 Ga0209758_1023159 3300025297 Bacteria 2818
117 Ga0209050_1006499 3300025298 Bacteria 6896
118 Ga0209256_1000153 3300025299 Bacteria 144736
119 Ga0209256_1002058 3300025299 Bacteria 17780
120 Ga0207426_1000006 3300025302 Bacteria 1025969
121 Ga0207426_1000011 3300025302 Bacteria 791203
122 Ga0209051_1003752 3300025303 Bacteria 9766
123 Ga0207647_10046819 3300025904 Bacteria 2693
124 Ga0207645_10174448 3300025907 Bacteria 1410
125 Ga0207705_10000364 3300025909 Bacteria 41147
126 Ga0207705_10075867 3300025909 Bacteria 2443
127 Ga0207654_10121712 3300025911 Bacteria 1639
128 Ga0207707_10001430 3300025912 Bacteria 22073
129 Ga0207695_10001222 3300025913 Bacteria 44042
130 Ga0207695_10119740 3300025913 Bacteria 2602
131 Ga0207695_10223077 3300025913 Bacteria 1792
132 Ga0207671_10002469 3300025914 Bacteria 19748
133 Ga0207671_10020709 3300025914 Bacteria 5003
134 Ga0207660_10003724 3300025917 Bacteria 9937
135 Ga0207657_10000762 3300025919 Bacteria 34172
136 Ga0207657_10052274 3300025919 Bacteria 3547
137 Ga0207649_10000497 3300025920 Bacteria 27895
138 Ga0207652_10002976 3300025921 Bacteria 14158
139 Ga0207694_10010487 3300025924 Bacteria 6989
140 Ga0207690_10048947 3300025932 Bacteria 2814
141 Ga0207669_10040766 3300025937 Bacteria 2697
142 Ga0207669_10190603 3300025937 Bacteria 1479
143 Ga0207667_10187878 3300025949 Bacteria 2120
144 Ga0207667_10254975 3300025949 Bacteria 1794
145 Ga0207668_10013045 3300025972 Bacteria 5105
146 Ga0207640_10209220 3300025981 Bacteria 1484
147 Ga0207639_10048569 3300026041 Bacteria 3213
148 Ga0207678_10046895 3300026067 Bacteria 3737
149 Ga0207678_10379667 3300026067 Bacteria 1222
150 Ga0207678_10409154 3300026067 Bacteria 1175
151 Ga0207674_10044684 3300026116 Bacteria 4562
152 Ga0207674_10240224 3300026116 Bacteria 1758
153 Ga0207683_10196277 3300026121 Bacteria 1834
154 Ga0209813_10050583 3300027866 Bacteria 1297
155 Ga0268266_10030466 3300028379 Bacteria 4584
156 Ga0307515_10000017 3300028794 Bacteria 550465
157 Ga0307515_10001903 3300028794 Bacteria 46429
158 Ga0307515_10016193 3300028794 Bacteria 13668
159 Ga0265338_10091621 3300028800 Bacteria 2510
160 Ga0265324_10002198 3300029957 Bacteria 10199
161 Ga0265328_10006035 3300031239 Bacteria 5158
162 Ga0265325_10006313 3300031241 Bacteria 7213
163 Ga0265339_10025804 3300031249 Bacteria 3369
164 Ga0265331_10000019 3300031250 Bacteria 258837
165 Ga0265331_10000080 3300031250 Bacteria 137743
166 Ga0265327_10000454 3300031251 Bacteria 73503
167 Ga0265327_10027230 3300031251 Bacteria 3294
168 Ga0265316_10014590 3300031344 Bacteria 6908
169 Ga0307513_10002030 3300031456 Bacteria 28510
170 Ga0307513_10183207 3300031456 Bacteria 1954
171 Ga0307408_100123653 3300031548 Bacteria 2008
172 Ga0265314_10040241 3300031711 Bacteria 3356
173 Ga0265314_10130882 3300031711 Bacteria 1565
174 Ga0307409_100542804 3300031995 Bacteria 1140
175 Ga0316053_103587 3300032120 Bacteria 926
176 Ga0373927_0005801 3300035695 Bacteria 8473
177 Ga0373925_0007826 3300037068 Bacteria 7782
178 Ga0395900_0000318 3300037418 Bacteria 71328
179 Ga0395900_0177761 3300037418 Bacteria 2164
180 Ga0395900_0586506 3300037418 Bacteria 1056
181 Ga0395898_0000547 3300037466 Bacteria 71322
182 Ga0395898_0048465 3300037466 Bacteria 4166
183 Ga0395905_0000305 3300037471 Bacteria 71315
184 Ga0395905_0000571 3300037471 Bacteria 49947
185 Ga0395905_0007862 3300037471 Bacteria 10560
186 Ga0395905_0033095 3300037471 Bacteria 4859
187 Ga0395905_0040245 3300037471 Bacteria 4384
188 Ga0395905_0046561 3300037471 Bacteria 4067
189 Ga0395905_0103674 3300037471 Bacteria 2670
190 Ga0436364_0194000 3300037853 Bacteria 2867
191 Ga0395901_0000093 3300038443 Bacteria 120300
192 Ga0395901_0027220 3300038443 Bacteria 5873
193 Ga0395901_0118786 3300038443 Bacteria 2778
194 Ga0395901_0140178 3300038443 Bacteria 2541
195 Ga0395901_0175338 3300038443 Bacteria 2249
196 Ga0395901_0393133 3300038443 Bacteria 1425
197 Ga0400485_05700 3300038735 Bacteria 1442
198 Ga0436365_0053390 3300039437 Bacteria 8756
199 Ga0436365_1238706 3300039437 Bacteria 138652
200 Ga0436361_0301911 3300039447 Bacteria 1855
201 Ga0436363_0105350 3300039450 Bacteria 3172
202 Ga0439436_0000675 3300041404 Bacteria 9161
203 Ga0439438_019223 3300041405 Bacteria 1933
204 Ga0439438_025738 3300041405 Bacteria 1600
205 Ga0439447_009157 3300041407 Bacteria 3018
206 Ga0439466_0053595 3300041411 Bacteria 1315
207 Ga0439465_0001295 3300041413 Bacteria 8044
208 Ga0439465_0003165 3300041413 Bacteria 5369
209 Ga0439465_0013380 3300041413 Bacteria 2560
210 Ga0439465_0020602 3300041413 Bacteria 2067
211 Ga0439465_0042638 3300041413 Bacteria 1471
212 Ga0439449_0020546 3300042007 Bacteria 2474
213 Ga0439456_011381 3300042013 Bacteria 1840
214 Ga0450906_000779 3300042145 Bacteria 6947
215 Ga0439434_0015284 3300042435 Bacteria 2288
216 Ga0453684_0020194 3300044712 Bacteria 10075
217 Ga0466960_0003996 3300044901 Bacteria 5733
218 Ga0466959_0017433 3300045049 Bacteria 5264
219 Ga0451576_0005584 3300045051 Bacteria 15714
220 Ga0495638_0000679 3300046460 Bacteria 36986
221 Ga0495638_0011460 3300046460 Bacteria 6108
222 Ga0495638_0033393 3300046460 Bacteria 3291
223 Ga0495580_0002971 3300046472 Bacteria 14554
224 Ga0495605_0001576 3300046474 Bacteria 14807
225 Ga0495662_0005789 3300046476 Bacteria 6185
226 Ga0495585_0011315 3300046492 Bacteria 5284
227 Ga0495585_0146189 3300046492 Bacteria 1235
228 Ga0495583_0001761 3300046506 Bacteria 20650
229 Ga0495583_0055184 3300046506 Bacteria 1796
230 Ga0495606_0001738 3300046507 Bacteria 27981
231 Ga0495606_0175510 3300046507 Bacteria 1240
232 Ga0495610_0108185 3300046512 Bacteria 1235
233 Ga0495610_0108302 3300046512 Bacteria 1234
234 Ga0495616_0020450 3300046513 Bacteria 3600
235 Ga0495620_0067235 3300046515 Bacteria 1475
236 Ga0495631_0000730 3300046518 Bacteria 21123
237 Ga0495632_0013426 3300046519 Bacteria 4675
238 Ga0495643_0010833 3300046522 Bacteria 5589
239 Ga0495643_0060060 3300046522 Bacteria 2019
240 Ga0495587_0084674 3300046536 Bacteria 1836
241 Ga0495609_0011369 3300046538 Bacteria 4241
242 Ga0495597_0140982 3300046542 Bacteria 994
243 Ga0495633_0031225 3300046558 Bacteria 2585
244 Ga0495656_0110228 3300046615 Bacteria 1286
245 Ga0495668_0008861 3300046616 Bacteria 6234
246 Ga0495611_0013690 3300046648 Bacteria 3457
247 Ga0495625_0002939 3300046660 Bacteria 17768
248 Ga0495625_0087967 3300046660 Bacteria 2153
249 Ga0495625_0240197 3300046660 Bacteria 1180
250 Ga0495588_0004788 3300046674 Bacteria 5988
251 Ga0495588_0085964 3300046674 Bacteria 1645
252 Ga0495588_0139954 3300046674 Bacteria 1278
253 Ga0495657_0027610 3300046675 Bacteria 4003
254 Ga0495658_0003511 3300046683 Bacteria 7758
255 Ga0495649_0143104 3300046694 Bacteria 1258
256 Ga0495600_0039364 3300046809 Bacteria 3078
257 Ga0495604_0009407 3300047317 Bacteria 7728
258 Ga0495672_0008168 3300047320 Bacteria 7764
259 Ga0495676_0056828 3300047321 Bacteria 3092
260 Ga0495687_059507 3300047443 Bacteria 1580
261 Ga0495686_0002387 3300047472 Bacteria 17834
262 Ga0495626_0046945 3300048091 Bacteria 2009
263 Ga0496100_0057774 3300048903 Bacteria 2543
264 Ga0496101_0052347 3300048904 Bacteria 2944
265 Ga0496101_0253222 3300048904 Bacteria 1372
266 Ga0496101_0379156 3300048904 Bacteria 1113
267 Ga0496102_0101991 3300048905 Bacteria 2667
268 Ga0496104_0006266 3300048907 Bacteria 10455
269 Ga0496105_0005288 3300048908 Bacteria 9785
270 Ga0496107_0033482 3300048910 Bacteria 3677
271 Ga0496108_0002415 3300048911 Bacteria 14924
272 Ga0496109_0005060 3300048912 Bacteria 11012
273 Ga0496110_0123495 3300048913 Bacteria 2334
274 Ga0496111_0000899 3300048914 Bacteria 16197
275 Ga0496112_0004003 3300048915 Bacteria 12351
276 Ga0496113_0009963 3300048916 Bacteria 6262
277 Ga0496114_0337304 3300048917 Bacteria 1333
278 Ga0496115_0060534 3300048918 Bacteria 3051
279 Ga0496115_0062146 3300048918 Bacteria 3012
280 Ga0496115_0191444 3300048918 Bacteria 1690
281 Ga0496115_0288731 3300048918 Bacteria 1346
282 Ga0496117_0001837 3300048920 Bacteria 28723
283 Ga0496119_0000597 3300048922 Bacteria 48924
284 Ga0496119_0009875 3300048922 Bacteria 8108
285 Ga0496119_0067815 3300048922 Bacteria 2102
286 Ga0496119_0084268 3300048922 Bacteria 1823
287 Ga0496120_0004279 3300048923 Bacteria 12121
288 Ga0496120_0046021 3300048923 Bacteria 2524
289 Ga0496121_0014899 3300048924 Bacteria 8196
290 Ga0496121_0093552 3300048924 Bacteria 2340
291 Ga0496121_0099702 3300048924 Bacteria 2244
292 Ga0496122_0000464 3300048925 Bacteria 84473
293 Ga0496122_0001337 3300048925 Bacteria 40284
294 Ga0496123_0000147 3300048926 Bacteria 143834
295 Ga0496123_0001933 3300048926 Bacteria 27009
296 Ga0496124_0001975 3300048927 Bacteria 27965
297 Ga0496125_0003542 3300048928 Bacteria 18812
298 Ga0496125_0042303 3300048928 Bacteria 3882
299 Ga0496125_0042682 3300048928 Bacteria 3859
300 Ga0496125_0057957 3300048928 Bacteria 3132
301 Ga0496126_0000159 3300048929 Bacteria 155348
302 Ga0496126_0000601 3300048929 Bacteria 67983
303 Ga0496126_0040671 3300048929 Bacteria 4309
304 Ga0496126_0372352 3300048929 Bacteria 1164
305 Ga0495678_007759 3300049459 Bacteria 5526
306 Ga0501031_0037769 3300049568 Bacteria 3152
307 Ga0501031_0040544 3300049568 Bacteria 3040
308 Ga0501031_0158152 3300049568 Bacteria 1481
309 Ga0501032_0000024 3300049569 Bacteria 143876
310 Ga0501032_0025428 3300049569 Bacteria 4081
311 Ga0501032_0059597 3300049569 Bacteria 2562
312 Ga0501033_0000391 3300049570 Bacteria 42136
313 Ga0501033_0000761 3300049570 Bacteria 29642
314 Ga0501033_0026641 3300049570 Bacteria 4350
315 Ga0501033_0077922 3300049570 Bacteria 2432
316 Ga0501033_0085303 3300049570 Bacteria 2313
317 Ga0501033_0170294 3300049570 Bacteria 1564
318 Ga0501033_0293658 3300049570 Bacteria 1146
319 Ga0501034_0000140 3300049571 Bacteria 134996
320 Ga0501034_0001662 3300049571 Bacteria 28665
321 Ga0501034_0012775 3300049571 Bacteria 8660
322 Ga0501034_0032089 3300049571 Bacteria 5336
323 Ga0501034_0046132 3300049571 Bacteria 4403
324 Ga0501034_0110748 3300049571 Bacteria 2736
325 Ga0501034_0126770 3300049571 Bacteria 2537
326 Ga0501034_0133499 3300049571 Bacteria 2465
327 Ga0501034_0321635 3300049571 Bacteria 1480
328 Ga0501036_0000443 3300049572 Bacteria 29542
329 Ga0501037_0000024 3300049573 Bacteria 146046
330 Ga0501037_0000818 3300049573 Bacteria 23265
331 Ga0501037_0085127 3300049573 Bacteria 2289
332 Ga0501037_0107988 3300049573 Bacteria 2005
333 Ga0501037_0134238 3300049573 Bacteria 1773
334 Ga0501037_0192105 3300049573 Bacteria 1445
335 Ga0501038_0000064 3300049574 Bacteria 87975
336 Ga0501038_0035848 3300049574 Bacteria 4355
337 Ga0501038_0071828 3300049574 Bacteria 2935
338 Ga0501038_0114276 3300049574 Bacteria 2233
339 Ga0501038_0199300 3300049574 Bacteria 1607
340 Ga0501039_0000017 3300049575 Bacteria 189412
341 Ga0501039_0102757 3300049575 Bacteria 2231
342 Ga0501043_0000050 3300049579 Bacteria 107465
343 Ga0501043_0000124 3300049579 Bacteria 70977
344 Ga0501043_0003156 3300049579 Bacteria 13634
345 Ga0501043_0045975 3300049579 Bacteria 3432
346 Ga0501043_0162767 3300049579 Bacteria 1743
347 Ga0501047_0002344 3300049581 Bacteria 18111
348 Ga0501047_0130263 3300049581 Bacteria 2396
349 Ga0501047_0223423 3300049581 Bacteria 1739
350 Ga0501047_0278230 3300049581 Bacteria 1519
351 Ga0501068_0164490 3300049584 Bacteria 1399
352 Ga0501069_0000004 3300049585 Bacteria 192353
353 Ga0501069_0029583 3300049585 Bacteria 3006
354 Ga0501069_0041303 3300049585 Bacteria 2549
355 Ga0501069_0191142 3300049585 Bacteria 1184
356 Ga0501070_0000031 3300049586 Bacteria 138137
357 Ga0501070_0000148 3300049586 Bacteria 64874
358 Ga0501070_0000694 3300049586 Bacteria 30882
359 Ga0501070_0001919 3300049586 Bacteria 18354
360 Ga0501070_0017646 3300049586 Bacteria 5992
361 Ga0501070_0052822 3300049586 Bacteria 3372
362 Ga0501070_0241825 3300049586 Bacteria 1477
363 Ga0501073_0031453 3300049589 Bacteria 3787
364 Ga0501073_0112523 3300049589 Bacteria 1888
365 Ga0501074_0000006 3300049590 Bacteria 112293
366 Ga0501074_0020074 3300049590 Bacteria 4856
367 Ga0501074_0098200 3300049590 Bacteria 2096
368 Ga0501074_0230576 3300049590 Bacteria 1318
369 Ga0501074_0243704 3300049590 Bacteria 1278
370 Ga0501080_0000693 3300049742 Bacteria 27033
371 Ga0501080_0003339 3300049742 Bacteria 14170
372 Ga0501080_0005406 3300049742 Bacteria 11390
373 Ga0501080_0132306 3300049742 Bacteria 2309
374 Ga0501080_0148412 3300049742 Bacteria 2168
375 Ga0501080_0388074 3300049742 Bacteria 1257
376 Ga0501083_0000066 3300049744 Bacteria 71496
377 Ga0501083_0011927 3300049744 Bacteria 6089
378 Ga0501273_014424 3300049770 Bacteria 1017
379 Ga0501035_0000011 3300049822 Bacteria 305794
380 Ga0501035_0000021 3300049822 Bacteria 209085
381 Ga0501035_0000593 3300049822 Bacteria 39882
382 Ga0501035_0001755 3300049822 Bacteria 21897
383 Ga0501035_0003715 3300049822 Bacteria 14551
384 Ga0501035_0005312 3300049822 Bacteria 12184
385 Ga0501035_0006966 3300049822 Bacteria 10558
386 Ga0501035_0035511 3300049822 Bacteria 4523
387 Ga0501035_0087852 3300049822 Bacteria 2740
388 Ga0501035_0176204 3300049822 Bacteria 1844
389 Ga0501035_0258932 3300049822 Bacteria 1475
390 Ga0501044_0000588 3300049823 Bacteria 44117
391 Ga0501044_0000803 3300049823 Bacteria 37863
392 Ga0501044_0002607 3300049823 Bacteria 20483
393 Ga0501044_0006574 3300049823 Bacteria 12830
394 Ga0501044_0012369 3300049823 Bacteria 9238
395 Ga0501044_0014696 3300049823 Bacteria 8442
396 Ga0501044_0035448 3300049823 Bacteria 5225
397 Ga0501044_0051016 3300049823 Bacteria 4267
398 Ga0501044_0064037 3300049823 Bacteria 3754
399 Ga0501044_0083723 3300049823 Bacteria 3225
400 Ga0501044_0124050 3300049823 Bacteria 2581
401 Ga0501044_0174053 3300049823 Bacteria 2122
402 Ga0501044_0180460 3300049823 Bacteria 2078
403 Ga0501044_0184173 3300049823 Bacteria 2054
404 Ga0501044_0189219 3300049823 Bacteria 2022
405 Ga0501044_0217547 3300049823 Bacteria 1862
406 Ga0501044_0297099 3300049823 Bacteria 1545
407 Ga0501044_0365018 3300049823 Bacteria 1361
408 nmdc:mga03683_19775_c1 3300050489 Bacteria 2574
409 nmdc:mga00v17_10499_c1 3300050491 Bacteria 5058
410 nmdc:mga0yw44_16779_c1 3300050492 Bacteria 3966
411 nmdc:mga07m45_12959_c1 3300050496 Bacteria 4411
412 nmdc:mga07m45_45525_c2 3300050496 Bacteria 2088
413 Ga0500610_0001958 3300053079 Bacteria 7335
414 Ga0500643_015186 3300053087 Bacteria 2648
415 Ga0500556_0000290 3300053104 Bacteria 39103
416 Ga0500557_000475 3300053105 Bacteria 5336
417 Ga0500594_0003391 3300053118 Bacteria 3493
418 Ga0500595_011555 3300053119 Bacteria 3450
419 Ga0500652_007639 3300053131 Bacteria 3553
420 Ga0500568_0000353 3300053139 Bacteria 35729
421 Ga0500568_0000963 3300053139 Bacteria 19793
422 Ga0500616_0000577 3300053153 Bacteria 44621
423 Ga0500616_0024660 3300053153 Bacteria 3340
424 Ga0500616_0067490 3300053153 Bacteria 1834
425 Ga0500616_0097589 3300053153 Bacteria 1442
426 Ga0500620_002422 3300053155 Bacteria 3756
427 Ga0500636_0034146 3300053177 Bacteria 3011
428 Ga0500645_022807 3300053730 Bacteria 1921
429 Ga0501084_0175458 3300054114 Bacteria 1809
430 Ga0587080_020673 3300059503 Bacteria 1077
431 Ga0587106_009420 3300059605 Bacteria 1241
432 Ga0501082_0063528 3300060353 Bacteria 3179
433 Ga0501082_0136418 3300060353 Bacteria 2129
434 Ga0501082_0204825 3300060353 Bacteria 1716
435 Ga0530510_0020554 3300061734 Bacteria 4694
436 2503200336 2503198000 Bacteria 6884444
437 2509115035 2508501123 Bacteria 6283661
438 2509139563 2508501127 Bacteria 7037543
439 2509373788 2509276018 Bacteria 6910194
440 2509395142 2509276022 Bacteria 6200534
441 2510314124 2510065059 Bacteria 6847884
442 2510895535 2510461076 Bacteria 8618824
443 2511122246 2510917020 Bacteria 5657507
444 2511182554 2510917028 Bacteria 6185411
445 2511390104 2511231027 Bacteria 5013807
446 2512932298 2512875016 Bacteria 6529530
447 2512960305 2512875024 Bacteria 7195110
448 2513614237 2513237090 Bacteria 7096802
449 2513865843 2513237138 Bacteria 7368160
450 2513908669 2513237144 Bacteria 7530820
451 2513925255 2513237146 Bacteria 7166346
452 2513997747 2513237159 Bacteria 6810126
453 2514034613 2513237164 Bacteria 7563725
454 2514419411 2513237305 Bacteria 7293571
455 2514587748 2513237351 Bacteria 6968952
456 2524458774 2524023209 Bacteria 6679728
457 2585153002 2582581280 Bacteria 5994497
458 2585167379 2582581283 Bacteria 6030556
459 2585195039 2582581293 Bacteria 5907401
460 2585228442 2582581299 Bacteria 6518058
461 2585265600 2582581306 Bacteria 6450535
462 2585388805 2582581865 Bacteria 6644329
463 2585395491 2582581866 Bacteria 6859583
464 2585400876 2582581867 Bacteria 7184437
465 2585822222 2585427590 Bacteria 6824633
466 2588518362 2588253730 Bacteria 6881675
467 2597812333 2597489875 Bacteria 7010078
468 2599417165 2599185170 Bacteria 7295545
469 2599936185 2599185301 Bacteria 6161860
470 2600194770 2599185352 Bacteria 7228948
471 2643730053 2643221541 Bacteria 5498788
472 2643747166 2643221545 Bacteria 5083237
473 2643770805 2643221550 Bacteria 4619371
474 2643776326 2643221551 Bacteria 3750538
475 2643781202 2643221552 Bacteria 5708754
476 2643794773 2643221555 Bacteria 3749717
477 2643804270 2643221557 Bacteria 7184309
478 2643839233 2643221564 Bacteria 4193379
479 2643927214 2643221584 Bacteria 5511711
480 2643998425 2643221598 Bacteria 4578346
481 2644045539 2643221606 Bacteria 5588032
482 2644050298 2643221607 Bacteria 6314006
483 2644064956 2643221610 Bacteria 7480339
484 2644086708 2643221614 Bacteria 4260023
485 2644106982 2643221618 Bacteria 7717186
486 2644129670 2643221623 Bacteria 5239945
487 2644148726 2643221626 Bacteria 8069654
488 2644158281 2643221627 Bacteria 6761570
489 2644193670 2643221634 Bacteria 6705461
490 2644204640 2643221636 Bacteria 6583769
491 2644208853 2643221637 Bacteria 5345260
492 2644242488 2643221643 Bacteria 5749658
493 2644309942 2643221655 Bacteria 7722067
494 2644331088 2643221659 Bacteria 7890716
495 2644341662 2643221661 Bacteria 4267604
496 2644367949 2643221666 Bacteria 4265935
497 2644376635 2643221668 Bacteria 7306521
498 2644392835 2643221671 Bacteria 5496681
499 2644416629 2643221675 Bacteria 7473456
500 2644449669 2643221680 Bacteria 7473610
501 2644483218 2643221686 Bacteria 6310811
502 2644494365 2643221688 Bacteria 5260751
503 2644499776 2643221689 Bacteria 6042950
504 2644507638 2643221691 Bacteria 5093099
505 2644543818 2643221698 Bacteria 7756764
506 2644616397 2643221712 Bacteria 7729434
507 2644652383 2643221718 Bacteria 5345506
508 2644675898 2643221723 Bacteria 7095460
509 2644689801 2643221726 Bacteria 7455827
510 2644745202 2643221736 Bacteria 6608466
511 2688597506 2687453392 Bacteria 6880454
512 2694631257 2693429783 Bacteria 7019804
513 2694638739 2693429784 Bacteria 7241525
514 2723574738 2721755686 Bacteria 7343952
515 2739310111 2738543024 Bacteria 5603683
516 2753359855 2751185800 Bacteria 5467370
517 2756671800 2756170246 Bacteria 7451806
518 2757571648 2757320392 Bacteria 3737298
519 2758642177 2758568016 Bacteria 5645291
520 2765466565 2765235802 Bacteria 5618596
521 2770196921 2767802442 Bacteria 5747986
522 2776270470 2775506902 Bacteria 6208009
523 2776281611 2775506904 Bacteria 5954060
524 2792752000 2791355123 Bacteria 8049106
525 2819537562 2818991435 Bacteria 5433759
526 2819646376 2818991454 Bacteria 5563326
527 2837680529 2837678835 Bacteria 5252418
528 2838038631 2838035591 Bacteria 7166484
529 2838076711 2838074704 Bacteria 6785777
530 2838661449 2838661181 Bacteria 7385261
531 2839997457 2839993093 Bacteria 5512535
532 2840768930 2840764183 Bacteria 6358399
533 2841738341 2841734538 Bacteria 6784580
534 2841915798 2841911363 Bacteria 6173697
535 2841921821 2841917233 Bacteria 6173500
536 2842298122 2842298080 Bacteria 6123127
537 2842360278 2842357229 Bacteria 6485165
538 2842510958 2842509118 Bacteria 6850950
539 2842522005 2842521101 Bacteria 6569494
540 2842872094 2842871566 Bacteria 4827117
541 2844008266 2844002411 Bacteria 7168230
542 2844012885 2844009547 Bacteria 6728125
543 2844164096 2844163670 Bacteria 7266046
544 2847675235 2847670302 Bacteria 6165597
545 2847691417 2847686936 Bacteria 6278406
546 2852390398 2852387548 Bacteria 8025568
547 2854912512 2854911287 Bacteria 5582813
548 2856314957 2856314179 Bacteria 6477897
549 2856323411 2856320880 Bacteria 7263508
550 2856329282 2856328259 Bacteria 6528202
551 2856336391 2856334872 Bacteria 7037011
552 2856342081 2856342000 Bacteria 7176905
553 2856368296 2856364286 Bacteria 6939991
554 2857351513 2857349434 Bacteria 7926032
555 2857375484 2857367948 Bacteria 6965560
556 2869163973 2869162929 Bacteria 6399702
557 2869174044 2869169390 Bacteria 6659796
558 2869241297 2869234852 Bacteria 6654993
559 2869255180 2869249662 Bacteria 6868783
560 2869261878 2869256925 Bacteria 6981691
561 2869266493 2869264136 Bacteria 6880765
562 2869275395 2869271264 Bacteria 6908218
563 2869282890 2869278585 Bacteria 7077053
564 2869290085 2869285874 Bacteria 6901219
565 2871432369 2871429161 Bacteria 6547891
566 2871436727 2871435913 Bacteria 6880295
567 2871450983 2871444079 Bacteria 6423508
568 2871456655 2871451962 Bacteria 7336357
569 2871462033 2871459585 Bacteria 6866887
570 2871472872 2871466892 Bacteria 6923287
571 2871474891 2871474448 Bacteria 6806570
572 2871481509 2871481445 Bacteria 6700002
573 2871492991 2871488783 Bacteria 6929816
574 2871502552 2871495908 Bacteria 6935695
575 2874105624 2874102143 Bacteria 6342645
576 2874110766 2874109183 Bacteria 6517025
577 2874117021 2874116593 Bacteria 6674494
578 2874127031 2874123672 Bacteria 7238285
579 2874133965 2874131515 Bacteria 6820270
580 2874142551 2874139085 Bacteria 7021506
581 2874152333 2874146452 Bacteria 7533118
582 2874159736 2874155637 Bacteria 6724144
583 2874162852 2874162495 Bacteria 6174670
584 2874168945 2874168670 Bacteria 8062617
585 2876367669 2876363079 Bacteria 6544991
586 2876374921 2876369609 Bacteria 6807521
587 2876378656 2876377896 Bacteria 6565995
588 2876389097 2876386047 Bacteria 6698674
589 2876393970 2876392853 Bacteria 6660880
590 2876404159 2876399893 Bacteria 6927900
591 2876409067 2876406927 Bacteria 6191900
592 2876418252 2876413966 Bacteria 6831344
593 2876424244 2876420981 Bacteria 6687741
594 2878042200 2878035449 Bacteria 6555736
595 2878739207 2878738818 Bacteria 7136951
596 2878749982 2878745973 Bacteria 6867388
597 2878757037 2878753008 Bacteria 6922523
598 2878766444 2878760144 Bacteria 6823465
599 2878773640 2878767105 Bacteria 6898628
600 2878779257 2878774303 Bacteria 6108671
601 2878783695 2878781027 Bacteria 6834456
602 2878795545 2878788777 Bacteria 6567085
603 2881150813 2881147464 Bacteria 7779814
604 2881161346 2881155292 Bacteria 6461656
605 2881167086 2881161766 Bacteria 7127907
606 2881849981 2881845957 Bacteria 6611900
607 2881853858 2881853255 Bacteria 6698367
608 2881866633 2881861095 Bacteria 7128710
609 2882640703 2882632389 Bacteria 8154593
610 2882919576 2882912400 Bacteria 6801539
611 2885308595 2885305155 Bacteria 7348390
612 2885312640 2885312484 Bacteria 6415165
613 2885321460 2885318864 Bacteria 6729568
614 2885335784 2885334103 Bacteria 7216818
615 2885349060 2885342637 Bacteria 7011821
616 2885351614 2885350715 Bacteria 6787678
617 2888338572 2888337043 Bacteria 6629336
618 2888346077 2888343758 Bacteria 6611049
619 2888355395 2888350351 Bacteria 7372807
620 2889010374 2889010040 Bacteria 6749192
621 2889017961 2889016732 Bacteria 6700763
622 2889796024 2889790730 Bacteria 5689708
623 2889919826 2889914905 Bacteria 5702301
624 2891373506 2891373044 Bacteria 5202277
625 2894655777 2894652903 Bacteria 4587256
626 2894820464 2894817345 Bacteria 4892941
627 2896392152 2896384573 Bacteria 7700774
628 2903450447 2903448605 Bacteria 7357801
629 2903500763 2903492973 Bacteria 13473544
630 2903503287 2903492973 Bacteria 13473544
631 2903515401 2903513507 Bacteria 6344008
632 2903521814 2903521522 Bacteria 6525694
633 2903528191 2903528002 Bacteria 6586099
634 2903547593 2903540706 Bacteria 7062119
635 2904582038 2904578770 Bacteria 5302906
636 2904660301 2904659560 Bacteria 6685615
637 2906312341 2906308376 Bacteria 6841989
638 2906325050 2906321335 Bacteria 6579571
639 2906330401 2906328253 Bacteria 6585166
640 2906356570 2906354277 Bacteria 6991324
641 2906365953 2906363423 Bacteria 6856682
642 2906376402 2906370794 Bacteria 6881062
643 2906378929 2906378014 Bacteria 6911440
644 2906392062 2906386501 Bacteria 5977019
645 2906398037 2906393657 Bacteria 6790866
646 2906405944 2906401398 Bacteria 6693206
647 2906411934 2906408224 Bacteria 6162342
648 2906419601 2906414383 Bacteria 6580790
649 2909043156 2909042592 Bacteria 6499737
650 2915653239 2915650412 Bacteria 4288180
651 2917556695 2917554339 Bacteria 4987857
652 2919123184 2919119836 Bacteria 5208557
653 2919451946 2919450847 Bacteria 5631160
654 2920761371 2920760137 Bacteria 7427611
655 2920825414 2920822456 Bacteria 6897201
656 2922133852 2922130491 Bacteria 7173936
657 2922155617 2922151315 Bacteria 6902399
658 2922164924 2922158528 Bacteria 6573167
659 2922173630 2922172374 Bacteria 6167644
660 2922180775 2922178524 Bacteria 6025201
661 2922187206 2922185730 Bacteria 7113964
662 2923559251 2923556063 Bacteria 6793593
663 2924718510 2924710171 Bacteria 6752351
664 2924720480 2924718760 Bacteria 6331356
665 2924732240 2924726620 Bacteria 6271473
666 2924740608 2924733363 Bacteria 7574837
667 2924744951 2924741084 Bacteria 6661321
668 2924753355 2924748358 Bacteria 6154725
669 2924755895 2924754689 Bacteria 6774424
670 2924763735 2924762789 Bacteria 6561353
671 2924776672 2924776078 Bacteria 7492003
672 2924786340 2924784321 Bacteria 7416538
673 2928524032 2928521798 Bacteria 4960112
674 2933023238 2933016740 Bacteria 6355406
675 2937819517 2937813078 Bacteria 7783518
676 2937829011 2937822353 Bacteria 7290551
677 2937839603 2937836603 Bacteria 6811263
678 2937844354 2937843397 Bacteria 5256375
679 2937850945 2937848649 Bacteria 6983481
680 2937863499 2937861824 Bacteria 6660327
681 2937873427 2937868953 Bacteria 6639878
682 2937880832 2937877337 Bacteria 7246526
683 2937897460 2937891427 Bacteria 6357007
684 2937977024 2937972304 Bacteria 7532020
685 2937984996 2937980651 Bacteria 6517427
686 2938001468 2937994558 Bacteria 7036190
687 2938015512 2938014810 Bacteria 6700592
688 2939671825 2939669807 Bacteria 5028511
689 2941504806 2941499720 Bacteria 7599444
690 2954012977 2954011201 Bacteria 4762601
691 2958039673 2958034702 Bacteria 6989922
692 2958042770 2958041894 Bacteria 13082850
693 2958052698 2958041894 Bacteria 13082850
694 2958069382 2958064165 Bacteria 7158582
695 2958073974 2958071322 Bacteria 6815895
696 2958088612 2958084443 Bacteria 7312792
697 2958097978 2958092219 Bacteria 6861151
698 2958107917 2958100919 Bacteria 6800575
699 2958109774 2958108152 Bacteria 6681128
700 2958116434 2958115193 Bacteria 6923548
701 2958125694 2958122699 Bacteria 7280457
702 2958134472 2958130278 Bacteria 6897202
703 2958139159 2958137437 Bacteria 6050276
704 2958159341 2958158011 Bacteria 6058449
705 2958171622 2958165035 Bacteria 6906348
706 2958178081 2958172287 Bacteria 6716688
707 2958180953 2958179912 Bacteria 6874908
708 2961078790 2961077736 Bacteria 7079850
709 2961115625 2961114664 Bacteria 6680456
710 2961131373 2961127735 Bacteria 7196641
711 2961137959 2961136820 Bacteria 6775228
712 2961170063 2961163497 Bacteria 6901077
713 2961175635 2961170736 Bacteria 7072258
714 2961186912 2961183825 Bacteria 6688536
715 2963646906 2963644680 Bacteria 6530403
716 2965024814 2965018300 Bacteria 6883036
717 2965029747 2965025482 Bacteria 6532201
718 2965032299 2965032056 Bacteria 6887443
719 2965045928 2965040258 Bacteria 6855979
720 2965055373 2965047637 Bacteria 6623551
721 2965065224 2965062239 Bacteria 7412989
722 2965093326 2965089291 Bacteria 6866420
723 2965107040 2965102966 Bacteria 6800987
724 2965119546 2965119406 Bacteria 6956431
725 2967999308 2967996073 Bacteria 6787468
726 2968007721 2968003550 Bacteria 6929263
727 2968021003 2968016561 Bacteria 7022047
728 2968088293 2968083720 Bacteria 7351627
729 2968095054 2968091066 Bacteria 6052692
730 2968101481 2968097103 Bacteria 6107094
731 2968111358 2968110612 Bacteria 6814636
732 2968119625 2968117919 Bacteria 6536078
733 2968130612 2968128360 Bacteria 6270294
734 2968144723 2968138860 Bacteria 6605449
735 2968178455 2968171901 Bacteria 6894245
736 2970474300 2970469710 Bacteria 6969209
737 2970494463 2970489779 Bacteria 6517260
738 2970508223 2970503327 Bacteria 7099517
739 2970511454 2970510686 Bacteria 7006402
740 2970527594 2970524798 Bacteria 6840927
741 2970534907 2970532167 Bacteria 6553173
742 2970544208 2970540015 Bacteria 6977556
743 2970554175 2970547951 Bacteria 6931819
744 2970561300 2970554993 Bacteria 6814252
745 2970597499 2970593180 Bacteria 7073582
746 2970624419 2970619444 Bacteria 6986144
747 2970628594 2970627176 Bacteria 6680862
748 2977826196 2977821940 Bacteria 6906439
749 2977834981 2977828996 Bacteria 7007971
750 2977848129 2977843712 Bacteria 6753583
751 2977853695 2977851361 Bacteria 6694324
752 2977864638 2977858184 Bacteria 6215359
753 2977869077 2977864932 Bacteria 7534097
754 2977878067 2977872689 Bacteria 7270173
755 2977899273 2977898635 Bacteria 6675551
756 2977909752 2977907340 Bacteria 6577984
757 2977919952 2977915119 Bacteria 6829656
758 2977923627 2977922695 Bacteria 6956781
759 2977936537 2977935797 Bacteria 6252826
760 2977944498 2977942078 Bacteria 7570577
761 2977952787 2977950692 Bacteria 6893264
762 2977959183 2977957713 Bacteria 6877875
763 2977976518 2977971508 Bacteria 7472917
764 2977990466 2977986579 Bacteria 6581278
765 2979710594 2979710463 Bacteria 6785254
766 2979745889 2979742915 Bacteria 7301278
767 2979771303 2979764755 Bacteria 6610066
768 2979774868 2979772303 Bacteria 6618277
769 2979795835 2979793036 Bacteria 6808957
770 2979813407 2979808191 Bacteria 7179355
771 2987638697 2987636660 Bacteria 8088555
772 2987646517 2987645492 Bacteria 6117018
773 2987654268 2987652177 Bacteria 6969023
774 2987666304 2987659509 Bacteria 6966464
775 2987669908 2987666974 Bacteria 6509233
776 2987676205 2987673487 Bacteria 6884027
777 2989349978 2989349275 Bacteria 6349068
778 2989775727 2989771324 Bacteria 5605128
779 2996314390 2996310559 Bacteria 6357320
780 2996339898 2996336353 Bacteria 5511628
781 2996345002 2996341866 Bacteria 6643098
782 2996352364 2996348954 Bacteria 7239054
783 2996390295 2996386984 Bacteria 6978667
784 3000139878 3000135777 Bacteria 6891109
785 3002144920 3002141150 Bacteria 5254435
786 3004167937 3004167301 Bacteria 8330599
787 3004195310 3004188549 Bacteria 6952365
788 3004203624 3004195979 Bacteria 6776956
789 3004205060 3004203850 Bacteria 7307914
790 3004215314 3004211236 Bacteria 7417683
791 3004225843 3004218560 Bacteria 7421728
792 3004236683 3004232784 Bacteria 6662140
793 3004255535 3004248173 Bacteria 6563236
794 3004275558 3004268573 Bacteria 7043476
795 3004279046 3004275668 Bacteria 7114440
796 3004335424 3004334049 Bacteria 8449246
797 3005414419 3005409236 Bacteria 7188837
798 637075398 637000159 Bacteria 7596297
799 649872055 649633066 Bacteria 6690028
800 8001849964 8001845381 Bacteria 5804942
801 8002289309 8002285264 Bacteria 6717907
802 8004301125 8004300914 Bacteria 6132239
803 8004367719 8004361976 Bacteria 6858373
804 8004378612 8004374579 Bacteria 6898112
805 8004392290 8004387939 Bacteria 7049250
806 8004403178 8004395343 Bacteria 6620908
807 8004449205 8004445564 Bacteria 6322258
808 8004638698 8004633249 Bacteria 6723080
809 8004641131 8004640170 Bacteria 6723001
810 8004708875 8004703790 Bacteria 8006957
811 8004718600 8004714634 Bacteria 6776161
812 8004733551 8004727605 Bacteria 6643904
813 8005303282 8005301065 Bacteria 6614431
814 8005691946 8005688590 Bacteria 6610080
815 8024488171 8024486573 Bacteria 6540512
816 8045864513 8045864390 Bacteria 5043873
817 8046771800 8046767195 Bacteria 7547379
818 8054561074 8054558443 Bacteria 5204801
819 8054563843 8054563764 Bacteria 5592885
820 8055619806 8055617313 Bacteria 7548464
821 8057575558 8057575449 Bacteria 7367519
822 Ga0500643_012026
823 JGI25158J39367_1002269
824 JGI25157J39369_1000755
825 JGI25159J45721_1000004
826 JGI25159J45721_1000877
827 JGI25151J46595_10031663
828 JGI25406J46586_10043244
829 JGI25160J50197_1000001
830 JGI25160J50197_1000021
831 JGI25161J50226_1000001
832 JGI25161J50226_1000218
833 Ga0055529_1007706
834 Ga0055526_1001649
835 Ga0055526_1008803
836 Ga0055524_1002001
837 Ga0055524_1012328
838 Ga0055536_1000269
839 Ga0055530_10007403
840 Ga0055540_1028635
841 Ga0055531_10045958
842 Ga0055543_1000003
843 Ga0055543_1000164
844 Ga0058862_12092097
845 Ga0065165_1000033
846 Ga0070658_10003684
847 Ga0070658_10062316
848 Ga0070658_10505614
849 Ga0070680_100114357
850 Ga0070682_100133534
851 Ga0070660_100045115
852 Ga0070660_100082638
853 Ga0070691_10003400
854 Ga0070661_100000441
855 Ga0070668_100310689
856 Ga0070674_100154839
857 Ga0070659_100036819
858 Ga0070667_100214422
859 Ga0070663_100025697
860 Ga0070681_10081574
861 Ga0068867_100089377
862 Ga0068853_100013522
863 Ga0068853_100253604
864 Ga0070665_100142655
865 Ga0070665_100259649
866 Ga0068855_100013981
867 Ga0068857_100082668
868 Ga0068854_100178894
869 Ga0068856_100257097
870 Ga0068852_100026482
871 Ga0081455_10238712
872 Ga0081540_1033222
873 Ga0081539_10000991
874 Ga0075365_10005021
875 Ga0075365_10009125
876 Ga0075365_10023064
877 Ga0075365_10027527
878 Ga0075365_10050322
879 Ga0075365_10065433
880 Ga0075368_10084191
881 Ga0075364_10004345
882 Ga0075364_10025915
883 Ga0075364_10037873
884 Ga0075362_10028402
885 Ga0075367_10000307
886 Ga0075369_10091584
887 Ga0075366_10162675
888 Ga0075370_10017438
889 Ga0075370_10135090
890 Ga0105240_10002462
891 Ga0105240_10078667
892 Ga0105240_10207364
893 Ga0105240_10478269
894 Ga0105240_10608489
895 Ga0105243_10087363
896 Ga0105237_10003177
897 Ga0105237_10306985
898 Ga0105238_10012189
899 Ga0105238_10094938
900 Ga0105239_10202768
901 Ga0105239_10501933
902 Ga0157373_10032787
903 Ga0157371_10119488
904 Ga0157370_10005189
905 Ga0157370_10135644
906 Ga0157369_10047367
907 Ga0157369_10576446
908 Ga0171463_1017
909 Ga0157372_10039780
910 Ga0157372_10417303
911 Ga0157375_10564256
912 Ga0163163_10022780
913 Ga0157379_10003397
914 Ga0182006_1017059
915 Ga0182007_10036984
916 Ga0182005_1006094
917 Ga0183363_1050
918 Ga0163161_10327398
919 Ga0213874_10005742
920 Ga0213876_10000410
921 Ga0213876_10003699
922 Ga0209436_100276
923 Ga0209436_105791
924 Ga0207425_1020966
925 Ga0209026_1000089
926 Ga0209148_1000124
927 Ga0209759_1000903
928 Ga0209233_1000010
929 Ga0209455_1000062
930 Ga0209130_1000003
931 Ga0209130_1000017
932 Ga0209130_1005979
933 Ga0209676_1000876
934 Ga0209025_1000161
935 Ga0209025_1000171
936 Ga0209564_1000013
937 Ga0209758_1023159
938 Ga0209050_1006499
939 Ga0209256_1000153
940 Ga0209256_1002058
941 Ga0207426_1000006
942 Ga0207426_1000011
943 Ga0209051_1003752
944 Ga0207647_10046819
945 Ga0207645_10174448
946 Ga0207705_10000364
947 Ga0207705_10075867
948 Ga0207654_10121712
949 Ga0207707_10001430
950 Ga0207695_10001222
951 Ga0207695_10119740
952 Ga0207695_10223077
953 Ga0207671_10002469
954 Ga0207671_10020709
955 Ga0207660_10003724
956 Ga0207657_10000762
957 Ga0207657_10052274
958 Ga0207649_10000497
959 Ga0207652_10002976
960 Ga0207694_10010487
961 Ga0207690_10048947
962 Ga0207669_10040766
963 Ga0207669_10190603
964 Ga0207667_10187878
965 Ga0207667_10254975
966 Ga0207668_10013045
967 Ga0207640_10209220
968 Ga0207639_10048569
969 Ga0207678_10046895
970 Ga0207678_10379667
971 Ga0207678_10409154
972 Ga0207674_10044684
973 Ga0207674_10240224
974 Ga0207683_10196277
975 Ga0209813_10050583
976 Ga0268266_10030466
977 Ga0307515_10000017
978 Ga0307515_10001903
979 Ga0307515_10016193
980 Ga0265338_10091621
981 Ga0265324_10002198
982 Ga0265328_10006035
983 Ga0265325_10006313
984 Ga0265339_10025804
985 Ga0265331_10000019
986 Ga0265331_10000080
987 Ga0265327_10000454
988 Ga0265327_10027230
989 Ga0265316_10014590
990 Ga0307513_10002030
991 Ga0307513_10183207
992 Ga0307408_100123653
993 Ga0265314_10040241
994 Ga0265314_10130882
995 Ga0307409_100542804
996 Ga0316053_103587
997 Ga0373927_0005801
998 Ga0373925_0007826
999 Ga0395900_0000318
1000 Ga0395900_0177761
1001 Ga0395900_0586506
1002 Ga0395898_0000547
1003 Ga0395898_0048465
1004 Ga0395905_0000305
1005 Ga0395905_0000571
1006 Ga0395905_0007862
1007 Ga0395905_0033095
1008 Ga0395905_0040245
1009 Ga0395905_0046561
1010 Ga0395905_0103674
1011 Ga0436364_0194000
1012 Ga0395901_0000093
1013 Ga0395901_0027220
1014 Ga0395901_0118786
1015 Ga0395901_0140178
1016 Ga0395901_0175338
1017 Ga0395901_0393133
1018 Ga0400485_05700
1019 Ga0436365_0053390
1020 Ga0436365_1238706
1021 Ga0436361_0301911
1022 Ga0436363_0105350
1023 Ga0439436_0000675
1024 Ga0439438_019223
1025 Ga0439438_025738
1026 Ga0439447_009157
1027 Ga0439466_0053595
1028 Ga0439465_0001295
1029 Ga0439465_0003165
1030 Ga0439465_0013380
1031 Ga0439465_0020602
1032 Ga0439465_0042638
1033 Ga0439449_0020546
1034 Ga0439456_011381
1035 Ga0450906_000779
1036 Ga0439434_0015284
1037 Ga0453684_0020194
1038 Ga0466960_0003996
1039 Ga0466959_0017433
1040 Ga0451576_0005584
1041 Ga0495638_0000679
1042 Ga0495638_0011460
1043 Ga0495638_0033393
1044 Ga0495580_0002971
1045 Ga0495605_0001576
1046 Ga0495662_0005789
1047 Ga0495585_0011315
1048 Ga0495585_0146189
1049 Ga0495583_0001761
1050 Ga0495583_0055184
1051 Ga0495606_0001738
1052 Ga0495606_0175510
1053 Ga0495610_0108185
1054 Ga0495610_0108302
1055 Ga0495616_0020450
1056 Ga0495620_0067235
1057 Ga0495631_0000730
1058 Ga0495632_0013426
1059 Ga0495643_0010833
1060 Ga0495643_0060060
1061 Ga0495587_0084674
1062 Ga0495609_0011369
1063 Ga0495597_0140982
1064 Ga0495633_0031225
1065 Ga0495656_0110228
1066 Ga0495668_0008861
1067 Ga0495611_0013690
1068 Ga0495625_0002939
1069 Ga0495625_0087967
1070 Ga0495625_0240197
1071 Ga0495588_0004788
1072 Ga0495588_0085964
1073 Ga0495588_0139954
1074 Ga0495657_0027610
1075 Ga0495658_0003511
1076 Ga0495649_0143104
1077 Ga0495600_0039364
1078 Ga0495604_0009407
1079 Ga0495672_0008168
1080 Ga0495676_0056828
1081 Ga0495687_059507
1082 Ga0495686_0002387
1083 Ga0495626_0046945
1084 Ga0496100_0057774
1085 Ga0496101_0052347
1086 Ga0496101_0253222
1087 Ga0496101_0379156
1088 Ga0496102_0101991
1089 Ga0496104_0006266
1090 Ga0496105_0005288
1091 Ga0496107_0033482
1092 Ga0496108_0002415
1093 Ga0496109_0005060
1094 Ga0496110_0123495
1095 Ga0496111_0000899
1096 Ga0496112_0004003
1097 Ga0496113_0009963
1098 Ga0496114_0337304
1099 Ga0496115_0060534
1100 Ga0496115_0062146
1101 Ga0496115_0191444
1102 Ga0496115_0288731
1103 Ga0496117_0001837
1104 Ga0496119_0000597
1105 Ga0496119_0009875
1106 Ga0496119_0067815
1107 Ga0496119_0084268
1108 Ga0496120_0004279
1109 Ga0496120_0046021
1110 Ga0496121_0014899
1111 Ga0496121_0093552
1112 Ga0496121_0099702
1113 Ga0496122_0000464
1114 Ga0496122_0001337
1115 Ga0496123_0000147
1116 Ga0496123_0001933
1117 Ga0496124_0001975
1118 Ga0496125_0003542
1119 Ga0496125_0042303
1120 Ga0496125_0042682
1121 Ga0496125_0057957
1122 Ga0496126_0000159
1123 Ga0496126_0000601
1124 Ga0496126_0040671
1125 Ga0496126_0372352
1126 Ga0495678_007759
1127 Ga0501031_0037769
1128 Ga0501031_0040544
1129 Ga0501031_0158152
1130 Ga0501032_0000024
1131 Ga0501032_0025428
1132 Ga0501032_0059597
1133 Ga0501033_0000391
1134 Ga0501033_0000761
1135 Ga0501033_0026641
1136 Ga0501033_0077922
1137 Ga0501033_0085303
1138 Ga0501033_0170294
1139 Ga0501033_0293658
1140 Ga0501034_0000140
1141 Ga0501034_0001662
1142 Ga0501034_0012775
1143 Ga0501034_0032089
1144 Ga0501034_0046132
1145 Ga0501034_0110748
1146 Ga0501034_0126770
1147 Ga0501034_0133499
1148 Ga0501034_0321635
1149 Ga0501036_0000443
1150 Ga0501037_0000024
1151 Ga0501037_0000818
1152 Ga0501037_0085127
1153 Ga0501037_0107988
1154 Ga0501037_0134238
1155 Ga0501037_0192105
1156 Ga0501038_0000064
1157 Ga0501038_0035848
1158 Ga0501038_0071828
1159 Ga0501038_0114276
1160 Ga0501038_0199300
1161 Ga0501039_0000017
1162 Ga0501039_0102757
1163 Ga0501043_0000050
1164 Ga0501043_0000124
1165 Ga0501043_0003156
1166 Ga0501043_0045975
1167 Ga0501043_0162767
1168 Ga0501047_0002344
1169 Ga0501047_0130263
1170 Ga0501047_0223423
1171 Ga0501047_0278230
1172 Ga0501068_0164490
1173 Ga0501069_0000004
1174 Ga0501069_0029583
1175 Ga0501069_0041303
1176 Ga0501069_0191142
1177 Ga0501070_0000031
1178 Ga0501070_0000148
1179 Ga0501070_0000694
1180 Ga0501070_0001919
1181 Ga0501070_0017646
1182 Ga0501070_0052822
1183 Ga0501070_0241825
1184 Ga0501073_0031453
1185 Ga0501073_0112523
1186 Ga0501074_0000006
1187 Ga0501074_0020074
1188 Ga0501074_0098200
1189 Ga0501074_0230576
1190 Ga0501074_0243704
1191 Ga0501080_0000693
1192 Ga0501080_0003339
1193 Ga0501080_0005406
1194 Ga0501080_0132306
1195 Ga0501080_0148412
1196 Ga0501080_0388074
1197 Ga0501083_0000066
1198 Ga0501083_0011927
1199 Ga0501273_014424
1200 Ga0501035_0000011
1201 Ga0501035_0000021
1202 Ga0501035_0000593
1203 Ga0501035_0001755
1204 Ga0501035_0003715
1205 Ga0501035_0005312
1206 Ga0501035_0006966
1207 Ga0501035_0035511
1208 Ga0501035_0087852
1209 Ga0501035_0176204
1210 Ga0501035_0258932
1211 Ga0501044_0000588
1212 Ga0501044_0000803
1213 Ga0501044_0002607
1214 Ga0501044_0006574
1215 Ga0501044_0012369
1216 Ga0501044_0014696
1217 Ga0501044_0035448
1218 Ga0501044_0051016
1219 Ga0501044_0064037
1220 Ga0501044_0083723
1221 Ga0501044_0124050
1222 Ga0501044_0174053
1223 Ga0501044_0180460
1224 Ga0501044_0184173
1225 Ga0501044_0189219
1226 Ga0501044_0217547
1227 Ga0501044_0297099
1228 Ga0501044_0365018
1229 nmdc:mga03683_19775_c1
1230 nmdc:mga00v17_10499_c1
1231 nmdc:mga0yw44_16779_c1
1232 nmdc:mga07m45_12959_c1
1233 nmdc:mga07m45_45525_c2
1234 Ga0500610_0001958
1235 Ga0500643_015186
1236 Ga0500556_0000290
1237 Ga0500557_000475
1238 Ga0500594_0003391
1239 Ga0500595_011555
1240 Ga0500652_007639
1241 Ga0500568_0000353
1242 Ga0500568_0000963
1243 Ga0500616_0000577
1244 Ga0500616_0024660
1245 Ga0500616_0067490
1246 Ga0500616_0097589
1247 Ga0500620_002422
1248 Ga0500636_0034146
1249 Ga0500645_022807
1250 Ga0501084_0175458
1251 Ga0587080_020673
1252 Ga0587106_009420
1253 Ga0501082_0063528
1254 Ga0501082_0136418
1255 Ga0501082_0204825
1256 Ga0530510_0020554
1257 2503200336
1258 2509115035
1259 2509139563
1260 2509373788
1261 2509395142
1262 2510314124
1263 2510895535
1264 2511122246
1265 2511182554
1266 2511390104
1267 2512932298
1268 2512960305
1269 2513614237
1270 2513865843
1271 2513908669
1272 2513925255
1273 2513997747
1274 2514034613
1275 2514419411
1276 2514587748
1277 2524458774
1278 2585153002
1279 2585167379
1280 2585195039
1281 2585228442
1282 2585265600
1283 2585388805
1284 2585395491
1285 2585400876
1286 2585822222
1287 2588518362
1288 2597812333
1289 2599417165
1290 2599936185
1291 2600194770
1292 2643730053
1293 2643747166
1294 2643770805
1295 2643776326
1296 2643781202
1297 2643794773
1298 2643804270
1299 2643839233
1300 2643927214
1301 2643998425
1302 2644045539
1303 2644050298
1304 2644064956
1305 2644086708
1306 2644106982
1307 2644129670
1308 2644148726
1309 2644158281
1310 2644193670
1311 2644204640
1312 2644208853
1313 2644242488
1314 2644309942
1315 2644331088
1316 2644341662
1317 2644367949
1318 2644376635
1319 2644392835
1320 2644416629
1321 2644449669
1322 2644483218
1323 2644494365
1324 2644499776
1325 2644507638
1326 2644543818
1327 2644616397
1328 2644652383
1329 2644675898
1330 2644689801
1331 2644745202
1332 2688597506
1333 2694631257
1334 2694638739
1335 2723574738
1336 2739310111
1337 2753359855
1338 2756671800
1339 2757571648
1340 2758642177
1341 2765466565
1342 2770196921
1343 2776270470
1344 2776281611
1345 2792752000
1346 2819537562
1347 2819646376
1348 2837680529
1349 2838038631
1350 2838076711
1351 2838661449
1352 2839997457
1353 2840768930
1354 2841738341
1355 2841915798
1356 2841921821
1357 2842298122
1358 2842360278
1359 2842510958
1360 2842522005
1361 2842872094
1362 2844008266
1363 2844012885
1364 2844164096
1365 2847675235
1366 2847691417
1367 2852390398
1368 2854912512
1369 2856314957
1370 2856323411
1371 2856329282
1372 2856336391
1373 2856342081
1374 2856368296
1375 2857351513
1376 2857375484
1377 2869163973
1378 2869174044
1379 2869241297
1380 2869255180
1381 2869261878
1382 2869266493
1383 2869275395
1384 2869282890
1385 2869290085
1386 2871432369
1387 2871436727
1388 2871450983
1389 2871456655
1390 2871462033
1391 2871472872
1392 2871474891
1393 2871481509
1394 2871492991
1395 2871502552
1396 2874105624
1397 2874110766
1398 2874117021
1399 2874127031
1400 2874133965
1401 2874142551
1402 2874152333
1403 2874159736
1404 2874162852
1405 2874168945
1406 2876367669
1407 2876374921
1408 2876378656
1409 2876389097
1410 2876393970
1411 2876404159
1412 2876409067
1413 2876418252
1414 2876424244
1415 2878042200
1416 2878739207
1417 2878749982
1418 2878757037
1419 2878766444
1420 2878773640
1421 2878779257
1422 2878783695
1423 2878795545
1424 2881150813
1425 2881161346
1426 2881167086
1427 2881849981
1428 2881853858
1429 2881866633
1430 2882640703
1431 2882919576
1432 2885308595
1433 2885312640
1434 2885321460
1435 2885335784
1436 2885349060
1437 2885351614
1438 2888338572
1439 2888346077
1440 2888355395
1441 2889010374
1442 2889017961
1443 2889796024
1444 2889919826
1445 2891373506
1446 2894655777
1447 2894820464
1448 2896392152
1449 2903450447
1450 2903500763
1451 2903503287
1452 2903515401
1453 2903521814
1454 2903528191
1455 2903547593
1456 2904582038
1457 2904660301
1458 2906312341
1459 2906325050
1460 2906330401
1461 2906356570
1462 2906365953
1463 2906376402
1464 2906378929
1465 2906392062
1466 2906398037
1467 2906405944
1468 2906411934
1469 2906419601
1470 2909043156
1471 2915653239
1472 2917556695
1473 2919123184
1474 2919451946
1475 2920761371
1476 2920825414
1477 2922133852
1478 2922155617
1479 2922164924
1480 2922173630
1481 2922180775
1482 2922187206
1483 2923559251
1484 2924718510
1485 2924720480
1486 2924732240
1487 2924740608
1488 2924744951
1489 2924753355
1490 2924755895
1491 2924763735
1492 2924776672
1493 2924786340
1494 2928524032
1495 2933023238
1496 2937819517
1497 2937829011
1498 2937839603
1499 2937844354
1500 2937850945
1501 2937863499
1502 2937873427
1503 2937880832
1504 2937897460
1505 2937977024
1506 2937984996
1507 2938001468
1508 2938015512
1509 2939671825
1510 2941504806
1511 2954012977
1512 2958039673
1513 2958042770
1514 2958052698
1515 2958069382
1516 2958073974
1517 2958088612
1518 2958097978
1519 2958107917
1520 2958109774
1521 2958116434
1522 2958125694
1523 2958134472
1524 2958139159
1525 2958159341
1526 2958171622
1527 2958178081
1528 2958180953
1529 2961078790
1530 2961115625
1531 2961131373
1532 2961137959
1533 2961170063
1534 2961175635
1535 2961186912
1536 2963646906
1537 2965024814
1538 2965029747
1539 2965032299
1540 2965045928
1541 2965055373
1542 2965065224
1543 2965093326
1544 2965107040
1545 2965119546
1546 2967999308
1547 2968007721
1548 2968021003
1549 2968088293
1550 2968095054
1551 2968101481
1552 2968111358
1553 2968119625
1554 2968130612
1555 2968144723
1556 2968178455
1557 2970474300
1558 2970494463
1559 2970508223
1560 2970511454
1561 2970527594
1562 2970534907
1563 2970544208
1564 2970554175
1565 2970561300
1566 2970597499
1567 2970624419
1568 2970628594
1569 2977826196
1570 2977834981
1571 2977848129
1572 2977853695
1573 2977864638
1574 2977869077
1575 2977878067
1576 2977899273
1577 2977909752
1578 2977919952
1579 2977923627
1580 2977936537
1581 2977944498
1582 2977952787
1583 2977959183
1584 2977976518
1585 2977990466
1586 2979710594
1587 2979745889
1588 2979771303
1589 2979774868
1590 2979795835
1591 2979813407
1592 2987638697
1593 2987646517
1594 2987654268
1595 2987666304
1596 2987669908
1597 2987676205
1598 2989349978
1599 2989775727
1600 2996314390
1601 2996339898
1602 2996345002
1603 2996352364
1604 2996390295
1605 3000139878
1606 3002144920
1607 3004167937
1608 3004195310
1609 3004203624
1610 3004205060
1611 3004215314
1612 3004225843
1613 3004236683
1614 3004255535
1615 3004275558
1616 3004279046
1617 3004335424
1618 3005414419
1619 637075398
1620 649872055
1621 8001849964
1622 8002289309
1623 8004301125
1624 8004367719
1625 8004378612
1626 8004392290
1627 8004403178
1628 8004449205
1629 8004638698
1630 8004641131
1631 8004708875
1632 8004718600
1633 8004733551
1634 8005303282
1635 8005691946
1636 8024488171
1637 8045864513
1638 8046771800
1639 8054561074
1640 8054563843
1641 8055619806
1642 8057575558

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

103

330

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wrv-assembly1.cif.gz_B crystal structure of t.th.hb8 branched-chain amino acid aminotransferase 0.9711 10 288
4whx-assembly1.cif.gz_E x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate 0.9685 5 288
3u0g-assembly4.cif.gz_E crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei 0.9618 5 288
6nst-assembly1.cif.gz_B crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9601 5 289
5e25-assembly2.cif.gz_B-2 crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate 0.9585 10 288
ID Description Score Start End Superfamily
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9771 139 288 3.20.10.10
6h65B02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9587 138 287 3.20.10.10
6gkrB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9561 138 288 3.20.10.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9551 11 126 3.30.470.10
5mr0A02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9537 138 287 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A3B9DK24-F1-model_v4 deleted 0.9911 110 288
AF-A0A7C9GEA6-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.989 1 295 GO:0004084
GO:0005829
GO:0009097
GO:0009098
GO:0009099
AF-A0A6L6WVE5-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9852 1 291 GO:0004084
GO:0005829
GO:0009097
GO:0009098
GO:0009099
AF-C4WFD8-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.985 1 296 GO:0008168
GO:0009097
GO:0009098
GO:0009099
GO:0032259
GO:0052655
GO:0052656
AF-F7XVU9-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9828 5 288 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656

Map